Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L014707.344ON30030014740.0
KNAG0B026407.344ON3022776841e-88
Smik_12.2637.344ON3182766349e-81
YLR205C (HMX1)7.344ON3172766321e-80
NCAS0E028907.344ON3152766261e-79
KLTH0H01386g7.344ON3072746251e-79
Kpol_530.367.344ON3112916233e-79
Suva_10.2997.344ON3202816234e-79
KLLA0D12474g7.344ON3122886208e-79
NDAI0E045007.344ON3272906219e-79
Kwal_56.246247.344ON3072736181e-78
ZYRO0F11594g7.344ON3092746102e-77
Skud_12.2687.344ON3182726113e-77
TPHA0F029207.344ON3202895974e-75
SAKL0F11242g7.344ON3092765912e-74
TDEL0C020307.344ON3112755877e-74
Ecym_47297.344ON3262785697e-71
ACL154W7.344ON3192745312e-65
CAGL0A03905g7.344ON2822564587e-55
TPHA0M018706.347ON58177693.8
SAKL0H15070g8.343ON380103684.3
Kpol_1014.14.307ON16966665.4
CAGL0M10615g6.320ON41099675.6
NDAI0E032508.472ON133148669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L01470
         (300 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   572   0.0  
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   268   1e-88
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   248   9e-81
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   248   1e-80
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   245   1e-79
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   245   1e-79
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   244   3e-79
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   244   4e-79
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   243   8e-79
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   243   9e-79
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   242   1e-78
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   239   2e-77
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   239   3e-77
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   234   4e-75
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   232   2e-74
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   230   7e-74
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   223   7e-71
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   209   2e-65
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   181   7e-55
TPHA0M01870 Chr13 complement(390700..392445) [1746 bp, 581 aa] {...    31   3.8  
SAKL0H15070g Chr8 complement(1304900..1306042) [1143 bp, 380 aa]...    31   4.3  
Kpol_1014.1 s1014 (244..753) [510 bp, 169 aa] {ON} (244..753) [5...    30   5.4  
CAGL0M10615g Chr13 (1064930..1066162) [1233 bp, 410 aa] {ON} sim...    30   5.6  
NDAI0E03250 Chr5 complement(696278..700273) [3996 bp, 1331 aa] {...    30   9.4  

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/300 (94%), Positives = 284/300 (94%)

Query: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60
           MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT
Sbjct: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60

Query: 61  LEDEIDFIISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSSRPELC 120
           LEDEIDFIISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSSRPELC
Sbjct: 61  LEDEIDFIISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSSRPELC 120

Query: 121 KFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVI 180
           KFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVI
Sbjct: 121 KFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVI 180

Query: 181 MNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQE 240
           MNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQE
Sbjct: 181 MNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQE 240

Query: 241 IGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYVXXXXXXXXXXXXXXXXKKFYLQAI 300
           IGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYV                KKFYLQAI
Sbjct: 241 IGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYVILFLIIFHLFVFINLFKKFYLQAI 300

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  268 bits (684), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 137/277 (49%), Positives = 186/277 (67%), Gaps = 11/277 (3%)

Query: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60
           M   +PSPTDTDALANRINFHTRDLHN +DK  S+K   ALRHSFIY DIL ++Y VF T
Sbjct: 1   MMSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGT 60

Query: 61  LEDEIDFIISNDRS-HIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSSRPEL 119
           +E  ID +I+++    +G IL  F+  +FRR D+I +DL FL         QW +  P+L
Sbjct: 61  VEQRIDELIASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQW-TPPPQL 119

Query: 120 CKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKF-------D 172
             FL +++S +   P+ VLA CHVLYLALFAGGR+ ++S+ KNL F  +P F       +
Sbjct: 120 AGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGF--LPNFRDKNGPGE 177

Query: 173 KMSHTDVIMNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232
           +MS   ++ NATNFF+F + I  ENKL+  YKRNY++ T+  L ED+KL +I  SR++F+
Sbjct: 178 EMSDHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFR 237

Query: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK 269
             F +++EI   N DELM   ++K+VTY +EEWKF K
Sbjct: 238 HTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK 274

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  248 bits (634), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 182/276 (65%), Gaps = 13/276 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINFHTRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS-- 115
           ID +    ++        IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++  
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128

Query: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             P L +F+N I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K+
Sbjct: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKL 186

Query: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK 269
           NFN++ EIG +N+ ELM  F++K VTYV EEW F K
Sbjct: 247 NFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNK 282

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  248 bits (632), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 183/276 (66%), Gaps = 13/276 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINF TRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 9   IPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS-- 115
           ID +    ++ +      IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++  
Sbjct: 69  IDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQ 128

Query: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             P L +F+N I  N+H+ P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K+
Sbjct: 129 KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKL 186

Query: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK 269
           NFN++ EIG +N+ ELM  F++K +TY+ EEW F K
Sbjct: 247 NFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNK 282

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  245 bits (626), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 181/276 (65%), Gaps = 15/276 (5%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTDT ALANRINF TRD HN I+K MSIK   ALRH FIY+  +L+YYY+F+ +E+E
Sbjct: 9   IPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEEE 68

Query: 65  IDFIISNDRSH----IGEILRGFFNDKFRRKDQILKDLKFL--------NVIQDQSDDQW 112
           I  + ++  +     IG +L   +  +F R + +LKDL+ L          +Q   +   
Sbjct: 69  IIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETNA 128

Query: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172
               P L  F+ +I  ++ E+P  + AYCHVLYLALFAGG+I+R+ + KNL F  +P F+
Sbjct: 129 TELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGF--LPNFN 186

Query: 173 KMSHTDVIMNATNFFKFDKD-IVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231
            +S  +V    TNFFKF  D ++ E KLK E+K+NY++ T+  LNE EK  II+ S++IF
Sbjct: 187 HLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIF 246

Query: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267
            +N   ++E+G++NK++LM   N+KMVTY++EEWKF
Sbjct: 247 DYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKF 282

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  245 bits (625), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 182/274 (66%), Gaps = 13/274 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINFHTRD HN IDK MS K  FA++H FIY+  +L+++YVF+ +E E
Sbjct: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63

Query: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDD------QWLS 114
           +D +     + +     +IL  F+ ++FRR  +IL+DL+ L   +  +        +  +
Sbjct: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123

Query: 115 SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             PEL  F++++ +++   P  +LAYCHVLYLALFAGGR+MR+++ ++   F  PKF  +
Sbjct: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLF--PKFPNL 181

Query: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           +  +V+   TNFF F D  + +EN+L+  YKR Y++ T+  L E++KL I+D+S  IF++
Sbjct: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267
           N  ++ EIG +N+ ELM   +++++T+V+EEW++
Sbjct: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQY 275

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  244 bits (623), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 190/291 (65%), Gaps = 19/291 (6%)

Query: 1   MEQQVPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT 60
           M   +PSPTD  ALANRINF TRD HN +   M I+   AL+H FIY++ L+ +Y++F T
Sbjct: 1   MTSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNT 60

Query: 61  LEDEIDFIISN-DRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSD---------- 109
           +E EID +++N D S +  IL  F+ D+FRRKD+ILKDL+ L   + Q+D          
Sbjct: 61  IETEIDLVLNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINS 120

Query: 110 DQWLSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMP 169
           D++ +   +L  F+ +I++N  E P  +LAYCHVLYLALFAGG+IM++++ K+L  F  P
Sbjct: 121 DRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIF--P 178

Query: 170 KFDKMSHTDVIMNATNFFKFDKDIVSEN---KLKSEYKRNYDILTKAKLNEDEKLEIIDI 226
           KF+ +SH ++I   TNF++F      E    KL+  YK+NY++ T+ +L E +KL +I  
Sbjct: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238

Query: 227 SREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFR---KPQIKK 274
           S+++F    N + E+GT N++ELM  F+YK+ T++VEEWK+     P +KK
Sbjct: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKK 289

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  244 bits (623), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 185/281 (65%), Gaps = 13/281 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINFHTRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 11  IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 70

Query: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS-- 115
           ID ++++  S        IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++  
Sbjct: 71  IDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 130

Query: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             P L +F++ I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K+
Sbjct: 131 KPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKL 188

Query: 175 SHTDVIMNATNFFKFDK-DIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           +  +++   TNFF F +     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 189 TQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDW 248

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKK 274
           NFN++ EIG +N+ ELM  F++K VTYV EEW F K    +
Sbjct: 249 NFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASR 289

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  243 bits (620), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 195/288 (67%), Gaps = 20/288 (6%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINF TRD+HN I+  MS+K  FA+RH FIY+  +++YYYVF  +E E
Sbjct: 9   IPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQE 68

Query: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFL--------NVIQDQSDDQW 112
           ID ++ +  +     +  IL+ F+ ++FRR D+++ DL+ L          +Q+  D   
Sbjct: 69  IDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQ 128

Query: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172
           L ++  L +F++ I SN+ + P  +LAYCHVLYLALFAGGR+M++++ +++  F  PKF 
Sbjct: 129 LPAK--LQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF--PKFG 184

Query: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231
            +S  +++  ATNFF F ++ V  EN+L+ +YK+ Y++ T+ +L E EKL II++S+ IF
Sbjct: 185 HLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIF 244

Query: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK---PQIKKYV 276
           + N  ++ EIG +N+ ELM  F+YK+++++ EEWK+ +   P++KK +
Sbjct: 245 QRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLI 292

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  243 bits (621), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 193/290 (66%), Gaps = 29/290 (10%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTDT+ALANRINFHTRD HN IDK M++K   ALRH  IY+  +L+YYY+F+ +E E
Sbjct: 9   IPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESE 68

Query: 65  IDFIIS------NDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWL----- 113
           I++++S       ++   G +L   +  +F R D++ KDLK L   + Q+D   L     
Sbjct: 69  INYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINE 128

Query: 114 -------SSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFF 166
                  +   +L +F+NFI  ++  +P  +LAYCHVLYLALFAGG+I+++ + KNL   
Sbjct: 129 EFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLG-- 186

Query: 167 FMPKFDKMSHTDVIMNATNFFKFDKD---------IVSENKLKSEYKRNYDILTKAKLNE 217
           F+P F+ +S  ++  NATNFF+F ++         I +ENKLK ++KRN+++ T++ LNE
Sbjct: 187 FLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNE 246

Query: 218 DEKLEIIDISREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267
           +EKL II+I+++IF++N   ++E+G  N+ ELM  F++K++ Y+ EEWKF
Sbjct: 247 NEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKF 296

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  242 bits (618), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 179/273 (65%), Gaps = 13/273 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINF+TRD HN IDK MS+K  FA++H FIY+  LL+++YVF+ +E E
Sbjct: 4   IPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQE 63

Query: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWL------S 114
           ID ++ N ++       +IL  F+   F R  +I +DLK L   +  SD+Q        +
Sbjct: 64  IDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNT 123

Query: 115 SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             PE   F++F+  ++   P  +LA+CHVLYLALFAGGR+MR+++ ++   F  PKF  +
Sbjct: 124 LPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLF--PKFPDL 181

Query: 175 SHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           +  +V+   TNFF F  D V +EN+L+ EYKR Y++ T+  L ED+KL I++++   F++
Sbjct: 182 TPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEW 241

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWK 266
           N  ++ EIG +N+ ELM   ++K+V++ ++EWK
Sbjct: 242 NTRVISEIGEINRQELMGKLSFKLVSFAIDEWK 274

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  239 bits (610), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 184/274 (67%), Gaps = 14/274 (5%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +P+PTD  ALANRINFHTRD HN I+  MS++  FAL+H +I++  +L+YYY+F+ +E E
Sbjct: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63

Query: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFLNVIQ---DQSDDQWLSS-- 115
           +D I+ + R+     +  +L  F+ + FRR D+I +DL  L   +   + S +Q+L+S  
Sbjct: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123

Query: 116 --RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDK 173
              P L  F++ I  N+ E P  +LAYCHVLYLALFAGG++MR+++ ++   F  PKF  
Sbjct: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKFQH 181

Query: 174 MSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232
           +S  +++   TNFF F ++   +ENKL+  YKR Y++ T+ +L E++K +II +S EIF+
Sbjct: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241

Query: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWK 266
           +N   + EIG +N+ ELM + +++++TY+ EEWK
Sbjct: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWK 275

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  239 bits (611), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 122/272 (44%), Positives = 180/272 (66%), Gaps = 13/272 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINFHTRD HN I+  M I+   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 9   IPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLS--- 114
           ID +    ++        IL+ F+ + FRR  QI KDLK L  N+ +  +S +++L+   
Sbjct: 69  IDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFE 128

Query: 115 SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             P L +F+N I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+++
Sbjct: 129 KPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFERL 186

Query: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246

Query: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEW 265
           NF+++ EIG +N+ ELM  F++K VTYV EEW
Sbjct: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  234 bits (597), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 126/289 (43%), Positives = 189/289 (65%), Gaps = 22/289 (7%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINF TRD HN I   MSI+   ALRH FIY+  L+++Y++F T+E+E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 65  IDFIISNDRSHIG-------EILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQ----WL 113
           ID +++   S +        +IL+ F+ ++FRRKD +L+DL  L   + + + Q    +L
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 114 SSR-------PELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFF 166
           +S        PEL  F ++IK    E P  ++AYCHVLYLALFAGG+IM++++ KN+  F
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 167 FMPKFDKMSHTDVIMNATNFFKFDKDIVS--ENKLKSEYKRNYDILTKAKLNEDEKLEII 224
             PKFD MSH +V    +NFF+F ++  +  ++KL+ EYK+NY++ T+ +LNE +K +II
Sbjct: 187 --PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDII 244

Query: 225 DISREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIK 273
           ++S+ IF    N++ EIG  N+ +LM  F  K +TY+VEEWK+ +   K
Sbjct: 245 EVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  232 bits (591), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 112/276 (40%), Positives = 181/276 (65%), Gaps = 17/276 (6%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINFHTRD HN I+  MS+K  FA++H  IY+  +L++YY+F  +E E
Sbjct: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65

Query: 65  IDFIISNDRSHI----GEILRGFFNDKFRRKDQILKDLKFLNVIQDQS--------DDQW 112
           ID ++ N  + +     +IL  F+ ++FRR + I +DL+ L   +  +        DD  
Sbjct: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125

Query: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172
           L   P+   F+ +I   + E P  +LAYCHVLYLALFAGG++M++++ ++   F  PKF 
Sbjct: 126 LP--PQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLF--PKFQ 181

Query: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231
            ++   ++   TNFF F ++   +E KL+ EYK+ Y++ T+ +L E++K EII +S EIF
Sbjct: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241

Query: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267
            +N +++ E+G +N++ELM  F++K+V++++EEWK+
Sbjct: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKY 277

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  230 bits (587), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 187/275 (68%), Gaps = 15/275 (5%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +P+PTD  ALANRINFHTRD HN ++  MS++  FAL+H FIY+  +L++Y++F  +E E
Sbjct: 8   IPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQE 67

Query: 65  IDFII----SNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLSS----- 115
           +D ++    +++   +  +LR F+ ++FRR ++I KDL+ L    + SD + L +     
Sbjct: 68  LDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVL-YSPEYSDSESLRNFVEHQ 126

Query: 116 --RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDK 173
              P+L  F++ I S + +    +LAYCHVLYLALFAGG++MR+++ ++   F  PKF+ 
Sbjct: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLF--PKFEY 184

Query: 174 MSHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFK 232
           ++  ++++  TNFF F D+   +ENKL+ +YK  Y++ T+ +L+E +K  I+ +S +IF 
Sbjct: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244

Query: 233 FNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267
           +N +++ EIG +N++ELM  F++K++TY+ EEWK+
Sbjct: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKY 279

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  223 bits (569), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 178/278 (64%), Gaps = 17/278 (6%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           +PSPTD  ALANRINF TRD+H   D  +  K   A+RH FIY+  +L++YY+F  +E +
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFL--------NVIQDQSDDQW 112
           ID ++    +     I  ILR F+ ++FRR  ++L+DL+F         N +Q   +D  
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141

Query: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172
           L   P+L +F++FI+    E+P  +LAYCHVLY ALFAGG++MR+++ +N+  F  PK  
Sbjct: 142 LP--PKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLF--PKPK 197

Query: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231
            +S  +   N TNFF F  D V  ENKL+ +YK+NY++ T+  L+E++KLEIID+S   F
Sbjct: 198 GISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANF 257

Query: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRK 269
           +   ++L EIG  NK ELM  F++K++T++  EW++ +
Sbjct: 258 QAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQ 295

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  209 bits (531), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 165/274 (60%), Gaps = 12/274 (4%)

Query: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64
           VP PTDT ALANRINFHTR+LH+  D  +S K   ALRH  IY+  LL+ YY+FR++E  
Sbjct: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77

Query: 65  IDFII----SNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDD---QWLSS-- 115
           ID ++    + D + IGEILR F+  +F R   +++D +     +  +     Q+L S  
Sbjct: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137

Query: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174
             P L   +  I++     P  +LA+CHVLYLALFAGGR+MR+++++ L    +P+   +
Sbjct: 138 LPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLG--LLPRAAGL 195

Query: 175 SHTDVIMNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFN 234
           S  +  +  T+FF F      ENK +  YKR Y++ T+  L+E EK ++ID +R  F   
Sbjct: 196 SARETQLRGTHFFTFGAGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHI 255

Query: 235 FNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFR 268
             ++ E+   N+ EL+ + +Y+++T++ EEW++R
Sbjct: 256 QAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  181 bits (458), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 158/256 (61%), Gaps = 24/256 (9%)

Query: 33  MSIKATFALRHSFIYKDILLSYYYVFRTLEDEIDFIISNDRSH--------------IGE 78
           MS++   ALRH  +Y+  +L++YYVF+ +E EID ++S D +                 +
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 79  ILRGFFNDKFRRKDQILKDLKFLNVIQDQSD---DQWLSSR---PELCKFLNFIKSNLHE 132
           I++ F+  +FRR +Q+ KDL  L   +  +    D  L      P+L  F++ + + + +
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 133 HPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVIMNATNFFKF-DK 191
           +PV VLAYCHV+YLALFAGG++MR+++ +N   F  PKF+ +S  ++    TNFF F D 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLF--PKFEHLSSKELARKGTNFFTFSDA 178

Query: 192 DIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQEIGTVNKDELMK 251
            +  EN+LK +YK+NY++ T+  L E++KLEIID+++ IF+ N +++QEIG +NK+ L  
Sbjct: 179 GVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTN 238

Query: 252 NFNYKMVTYVVEEWKF 267
           N    ++ YV EE KF
Sbjct: 239 N-KLDLLQYVFEELKF 253

>TPHA0M01870 Chr13 complement(390700..392445) [1746 bp, 581 aa] {ON}
           Anc_6.347
          Length = 581

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 6/77 (7%)

Query: 147 ALFAGGRIMRASMNKNLSFFFMPKFDKMSHT-----DVIMNATNFFKFDKDIVSENKLKS 201
            + AGG  + AS   NL F F P    ++H       +I+ +T      KD++ +  L +
Sbjct: 167 VIMAGGVYLVASTGHNL-FDFKPLLISLAHIYSLSYALILLSTGLILLPKDLLQQGNLPT 225

Query: 202 EYKRNYDILTKAKLNED 218
           E   N   +  +K N+D
Sbjct: 226 ESSNNKLFVELSKTNDD 242

>SAKL0H15070g Chr8 complement(1304900..1306042) [1143 bp, 380 aa]
           {ON} similar to uniprot|Q03771 Saccharomyces cerevisiae
           YDR161W interacts with PP2C
          Length = 380

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 54/103 (52%), Gaps = 11/103 (10%)

Query: 166 FFMPKFD--KMSHTDVIMNATNFFKFDK-------DIVSENKLKSEYKRNYDILTKAKLN 216
           + M K +  ++S+  + +N  N ++F++       D+ +E+  +S Y+    +    K+ 
Sbjct: 267 YLMCKLELFRLSNPSLELNPGNIYEFNQHFQELPLDLTNESTKESAYEARVSLSFAVKIG 326

Query: 217 EDEKLEIIDISREIFKFNFNLLQEIGT-VNKDELMKNFNYKMV 258
           E+   +  +I++E+F     LLQE+G  V+  EL+K  N + V
Sbjct: 327 ENADPDD-EIAQELFSGASGLLQELGGPVDITELLKLKNGEEV 368

>Kpol_1014.1 s1014 (244..753) [510 bp, 169 aa] {ON} (244..753) [510
           nt, 170 aa]
          Length = 169

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 21  HTRDLHNVIDKTMSIKAT--------FALRHSFIYKDILLSYYYVFRTLEDEIDFIISND 72
           H  DL   I  ++++ A         F+   S +Y+ IL++ Y++   +    +  I ND
Sbjct: 35  HLTDLKLAIGYSITLTAATSFYLDKKFSYSESLVYQKILVAAYFILSVIFWWFNKFIQND 94

Query: 73  RSHIGE 78
            S++GE
Sbjct: 95  ISYVGE 100

>CAGL0M10615g Chr13 (1064930..1066162) [1233 bp, 410 aa] {ON}
           similar to uniprot|P53723 Saccharomyces cerevisiae
           YNR021w
          Length = 410

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 17/99 (17%)

Query: 9   TDTDALAN-RINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRT--LEDEI 65
           T   A+A+ R+N H   L+N           F L   FI + IL   + V ++  LE  I
Sbjct: 115 TGRSAIASIRVNLHLPPLNN----------PFTL---FI-EGILAYAFPVLKSKELESFI 160

Query: 66  DFIISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVI 104
           + +I  +  H G   +   NDK + +  IL   KF+  +
Sbjct: 161 EVVIRPNGIHFGSTTQELTNDKLKARKDILAKFKFITAV 199

>NDAI0E03250 Chr5 complement(696278..700273) [3996 bp, 1331 aa] {ON}
           
          Length = 1331

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 53  SYYYVFRTLEDEIDFIISNDRSHIGEILRGFFNDKFRRKDQILKDLKF 100
           SY    R + DE+D I +   +   E +R   ND+      IL++L F
Sbjct: 942 SYLTSLRNVRDELDTIFTKATTRGAENIRVLINDQLSMISMILRNLSF 989

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,875,881
Number of extensions: 1550298
Number of successful extensions: 7384
Number of sequences better than 10.0: 63
Number of HSP's gapped: 7627
Number of HSP's successfully gapped: 63
Length of query: 300
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 191
Effective length of database: 40,982,805
Effective search space: 7827715755
Effective search space used: 7827715755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)