Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L004807.128ON1801809471e-132
NCAS0E021507.128ON1851874058e-50
YIL009C-A (EST3)7.128ON1811823796e-46
KNAG0L009607.128ON1851863771e-45
Skud_9.1637.128ON1801823526e-42
NDAI0E036907.128ON1962003485e-41
Smik_9.1857.128ON1821833371e-39
Suva_9.1957.128ON1891893137e-36
Sklu_YGOB_EST37.128ON1961893084e-35
TDEL0H029007.128ON1881913075e-35
TPHA0C043107.128ON2012043042e-34
Zrou_YGOB_EST37.128ON1681633012e-34
Kpol_1062.557.128ON1821852989e-34
CAGL0C03828g7.128ON1801852752e-30
KLLA0D14289g7.128ON1841832468e-26
Kwal_YGOB_EST37.128ON1921832432e-25
TBLA0A009607.128ON2151232401e-24
ADL016C7.128ON2021882346e-24
Kthe_YGOB_EST37.128ON1931852251e-22
Sklu_YGOB_Anc_7.128singletonOFF981001343e-10
ZYRO0C05258gsingletonOFF87821185e-08
Kwal_55.20848singletonOFF96971011e-05
KLTH0F12606gsingletonOFF9693905e-04
Kpol_1030.33singletonOFF1379143730.43
Kpol_YGOB_1030.337.380ON1376143730.44
KNAG0D033504.145ON32572672.3
TDEL0D063603.568ON58548637.2
CAGL0C01969g3.568ON61948638.6
NDAI0B062803.568ON60548639.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00480
         (180 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   369   e-132
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   160   8e-50
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   150   6e-46
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   149   1e-45
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   140   6e-42
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   138   5e-41
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   134   1e-39
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   125   7e-36
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   123   4e-35
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   122   5e-35
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   121   2e-34
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   120   2e-34
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   119   9e-34
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   110   2e-30
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    99   8e-26
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...    98   2e-25
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    97   1e-24
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...    95   6e-24
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    91   1e-22
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    56   3e-10
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    50   5e-08
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    44   1e-05
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    39   5e-04
Kpol_1030.33 s1030 (68892..73031) [4140 bp, 1379 aa] {OFF} (6889...    33   0.43 
Kpol_YGOB_1030.33 s1030 (68901..73031) [4131 bp, 1376 aa] {ON} A...    33   0.44 
KNAG0D03350 Chr4 complement(600866..601843) [978 bp, 325 aa] {ON...    30   2.3  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...    29   7.2  
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...    29   8.6  
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...    29   9.5  

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  369 bits (947), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/180 (100%), Positives = 180/180 (100%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60
           MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60

Query: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNC 120
           TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNC
Sbjct: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNC 120

Query: 121 TLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFVYSTY 180
           TLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFVYSTY
Sbjct: 121 TLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFVYSTY 180

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  160 bits (405), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 122/187 (65%), Gaps = 11/187 (5%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQG---LLRPIYRAIPPINNTNVRNPLSSRP 57
           MP V L+S+ ++ DSIF+  WI+ LL E+ Q    L     R +P +N  ++R P  S P
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCS-P 59

Query: 58  SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117
            +LT    CHFTK+ KF+K+ N+ I ASIRD+RFQ+LVEFTP CVS FER +  RLTS+T
Sbjct: 60  KVLTNH--CHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSET 117

Query: 118 TNCTLLIGDCSIEYKSSHEISQNY-RLNFPNKR----LLPVLTINQASILDRDQATLLEQ 172
            NC L+IGD +I YKS  +I+  +  ++F   +    L+P+L INQAS+ D DQ   L  
Sbjct: 118 LNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRS 177

Query: 173 FPFVYST 179
           FPFVYST
Sbjct: 178 FPFVYST 184

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  150 bits (379), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 117/182 (64%), Gaps = 9/182 (4%)

Query: 1   MPTVKLTSQHTRP-DSIFIHDWIKPLLDENCQ-GLLRPIYRAIPPINNTNVRNPLSSRPS 58
           MP V L S H++P DS+F+  WIK L+++N +     P    IP +   ++  P  S P+
Sbjct: 1   MPKVILES-HSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMS-PT 58

Query: 59  LLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTT 118
           +LT    CHF KI KFY V ++K++ASIRD+  QILVEF+  CVS FERT+ CR+TS+TT
Sbjct: 59  ILTNP--CHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETT 116

Query: 119 NCTLLIGDCSIEYKSSHEISQNYRL---NFPNKRLLPVLTINQASILDRDQATLLEQFPF 175
           NC ++IGD  + Y ++     ++++   N  +K ++PVL +NQA+I D DQ   L  FPF
Sbjct: 117 NCLMIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPF 176

Query: 176 VY 177
           VY
Sbjct: 177 VY 178

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  149 bits (377), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 114/186 (61%), Gaps = 11/186 (5%)

Query: 1   MPTVKLT-SQHTRPDSIFIHDWIKPLLDENCQ--GLLRPIYRAIPPINNTNVRNPLSSRP 57
           MP VKL+ + H   + IF H WIK L+    +   L+RP+ + IP +   +++NP  S+ 
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSKR 60

Query: 58  SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117
            L   K K HF K++KFY V N+K+FA IRD+  Q+LVEF P CVS FER + CR+TS T
Sbjct: 61  VL---KNKTHFAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGT 117

Query: 118 TNCTLLIGDCSIEYKSSHEISQNYRLN-FPNKRLL----PVLTINQASILDRDQATLLEQ 172
            NC  +IG+C +EY+S   ++  +R+N  P K+ L    PVL INQA++ D  Q      
Sbjct: 118 VNCLFVIGNCDLEYRSVARVNDEFRINILPRKQKLMDQIPVLVINQATVADWGQMEAQTT 177

Query: 173 FPFVYS 178
           FPFV+ 
Sbjct: 178 FPFVHQ 183

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  140 bits (352), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 111/182 (60%), Gaps = 10/182 (5%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60
           MP + L S     DSIF+  WIK L+ +N     RP  R IP +   ++  P  S   +L
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQH-RPSERVIPSLTRQDLLVPHMS-AQIL 58

Query: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL-VEFTPHCVSTFERTNRCRLTSDTTN 119
           T    CHFTKI +FY V N+K+ ASIRD+  QIL VEF+  CVS FER++ CR+TS+T N
Sbjct: 59  TNP--CHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116

Query: 120 CTLLIGDCSIEYKSSHEISQNYRLNF----PNKRLLPVLTINQASILDRDQATLLEQFPF 175
           C ++IGD  + Y +S+++   +++      PN+ +LPVL INQ +I D DQ   L  FPF
Sbjct: 117 CLMIIGDADLIYVTSNQVMARFKIRVSSISPNE-ILPVLKINQTTIFDIDQVGSLSTFPF 175

Query: 176 VY 177
           VY
Sbjct: 176 VY 177

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  138 bits (348), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 111/200 (55%), Gaps = 32/200 (16%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSR---- 56
           MP V L+S+ T  DS+F+  WI  ++ +  Q       +   P N       LS R    
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQA------KTYLPGNQRLSIARLSRRDMDA 54

Query: 57  PSLLTTKVK--CHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLT 114
           P +  T +    HF K+ KF+ V N+KIFASIRD+ +QILVEFTP CV  FER  R R+T
Sbjct: 55  PEISETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRIT 114

Query: 115 SDTTNCTLLIGDCSIEYKSSHEISQNYRLNFP-------------NKR---LLPVLTINQ 158
           S+T NC  +IGDC++ YK+  +I    R +FP             NK    L PVL INQ
Sbjct: 115 SETVNCLFVIGDCTVIYKTRSQI----RSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQ 170

Query: 159 ASILDRDQATLLEQFPFVYS 178
           AS+ D DQ  LL +FPF+Y+
Sbjct: 171 ASLFDSDQVQLLFEFPFIYN 190

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 113/183 (61%), Gaps = 10/183 (5%)

Query: 1   MPTVKLTSQHTRP-DSIFIHDWIKPLLDENCQG-LLRPIYRAIPPINNTNVRNPLSSRPS 58
           MP V L S H++P DSIF+  WIK L+++N +     P    IP +   +++ P  S   
Sbjct: 1   MPRVVLES-HSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMS-AK 58

Query: 59  LLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL-VEFTPHCVSTFERTNRCRLTSDT 117
           +LT    CHF KI +FY V ++K+ ASIRD+  QIL VEF+P CVS FER + CR+T++T
Sbjct: 59  ILTNP--CHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116

Query: 118 TNCTLLIGDCSIEYKSSHEISQNYRL---NFPNKRLLPVLTINQASILDRDQATLLEQFP 174
            NC ++IGD S+   +S  +  ++++   +  +  L+PVL INQ +I D DQ   L  FP
Sbjct: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176

Query: 175 FVY 177
           FVY
Sbjct: 177 FVY 179

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  125 bits (313), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 105/189 (55%), Gaps = 15/189 (7%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60
           MP V L S   + DSIF+  WIK L+D+N +    P    IP +   ++  P    P +L
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMC-PQIL 59

Query: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL---------VEFTPHCVSTFERTNRC 111
           T     HF +I +FY V +++++AS+RD+  QIL         VEF+  CVS FER N  
Sbjct: 60  TNPF--HFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117

Query: 112 RLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLNFPN---KRLLPVLTINQASILDRDQAT 168
           R+TS+TTNC ++IGD  + Y +S +    + +   +      +P+L INQA+I D DQ  
Sbjct: 118 RITSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVG 177

Query: 169 LLEQFPFVY 177
            L  FPFVY
Sbjct: 178 SLNNFPFVY 186

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  123 bits (308), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 110/189 (58%), Gaps = 13/189 (6%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIK----PLLDENCQ-GLLRPIYRAIPPINNTNVRNPLS- 54
           MP V L+S++   DSI++H+WI     P + E    G++  +   +P +++ ++ + +  
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 55  SRPSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLT 114
           SR  +L  +   HF K+ KFY+V N++++AS RD+   ILVEFT  CVS FER +  R+T
Sbjct: 61  SRKIILNHR---HFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRIT 117

Query: 115 SDTTNCTLLIGDCSIEYKSSHEISQNYRLNF----PNKRLLPVLTINQASILDRDQATLL 170
           S+TTN   +IGD  + +     +SQ + ++     P   L+P+L +NQA + D DQ    
Sbjct: 118 SETTNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESN 177

Query: 171 EQFPFVYST 179
            +FPF Y +
Sbjct: 178 RKFPFFYQS 186

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  122 bits (307), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 112/191 (58%), Gaps = 17/191 (8%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIK----PLLDENCQGLLRPIYRAIPPINNTNVRNPLSSR 56
           MP   L+S   + D++F+  WI+    PL+ +     L P++  IP +   ++R P  S 
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL-PVFNFIPKLQLKDLRKPQLS- 58

Query: 57  PSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSD 116
           P +L  +   HF K+VKF+ V  F++FA++RD+  QILVEFTP CVS FERT+R R+T +
Sbjct: 59  PRIL--RNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLE 116

Query: 117 TTNCTLLIGDCSIEYKSSHEISQNYRLNFPN-------KR--LLPVLTINQASILDRDQA 167
           T +   +I DC + ++  + I +N+ ++  N       KR   +PVL +NQAS  + DQ 
Sbjct: 117 TEHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQI 176

Query: 168 TLLEQFPFVYS 178
              E FP++Y+
Sbjct: 177 ESFEHFPYLYT 187

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  121 bits (304), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 102/204 (50%), Gaps = 33/204 (16%)

Query: 1   MPTVKLTSQ-HTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSL 59
           MP + L S+ +  PDSIF+  WIK  +++  +  +  I      +NNTNV+         
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVK-------LQ 53

Query: 60  LTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTN 119
           L  K      K+   Y + N+ +F SIRD + Q+LVEFT +CVS FER  + R+T  T N
Sbjct: 54  LILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113

Query: 120 CTLLIGDCSIEYKSSHEISQNYR---LNFPN----------------------KRLLPVL 154
           C  LIGDC I+Y +  E+ +N++   L F N                       RL P+L
Sbjct: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173

Query: 155 TINQASILDRDQATLLEQFPFVYS 178
            +NQ  I D DQ    E +PFVYS
Sbjct: 174 QVNQVMIFDWDQVVTFENYPFVYS 197

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 8/163 (4%)

Query: 14  DSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLLTTKVKCHFTKIVK 73
           DS+F+  WI+  L E+   L     R IPP+   ++  P  S   L   +   HF K+ +
Sbjct: 12  DSVFLQPWIQTALAEHDPRLGD---RLIPPVPTQDLSQPELSSKVLSNIR---HFVKVTR 65

Query: 74  FYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNCTLLIGDCSIEYKS 133
           F+ V+++ ++ASIRD++ Q+LVEFTP CVS FER    R+T++TTNC  +I DC + Y S
Sbjct: 66  FFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFIIADCQLIYHS 125

Query: 134 SHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFV 176
              I  +Y++    +   PVL +NQ +I D DQ   LE +P V
Sbjct: 126 PSYIENHYKIV--TRGETPVLRVNQTAIFDWDQVESLETYPLV 166

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  119 bits (298), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 103/185 (55%), Gaps = 11/185 (5%)

Query: 1   MPTVKLTSQHTR-PDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSL 59
           MP + L S  +   DS ++ +WI  ++D N           IP ++     +  S   S+
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRNYDNTGE----VIPILDEYGFNDSQSYMSSV 56

Query: 60  LTTKVK--CHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117
           +   +K   HF K+  F+ V ++ ++ASIRD +FQ+L EFT +CVS+FER    R+T +T
Sbjct: 57  INLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRITENT 116

Query: 118 TNCTLLIGDCSIEYKSSHEISQNYRLNFPN----KRLLPVLTINQASILDRDQATLLEQF 173
            NC  LIGDC +++ +  EI + Y+L+  +      L PVL+INQA + D  Q    E+F
Sbjct: 117 INCLFLIGDCKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKSFEKF 176

Query: 174 PFVYS 178
            ++Y+
Sbjct: 177 DWIYN 181

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  110 bits (275), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 96/185 (51%), Gaps = 16/185 (8%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDEN--CQGLLRPIYRAIPPINNTNVRNPLSSRPS 58
           MP     S+    +S+++H W++ +L E+   Q +       IP ++      PL SR  
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDMLLESKTSQNI-----AVIPRVDPDEASIPLLSRRI 55

Query: 59  LLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTT 118
               +   HF KI KF++V N+ ++AS++D++ QIL +FTP CVS FE  NR R+TSDT 
Sbjct: 56  YANRR---HFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTV 112

Query: 119 NCTLLIGDCSIEYKSSHEISQNYR------LNFPNKRLLPVLTINQASILDRDQATLLEQ 172
           N   +IGD  +      E+   +        N  +   +P L INQA ILD DQ    + 
Sbjct: 113 NTLFMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFKM 172

Query: 173 FPFVY 177
            PFVY
Sbjct: 173 TPFVY 177

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 99.4 bits (246), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 99/183 (54%), Gaps = 6/183 (3%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLD----ENCQGLLRPIYRAIPPINNTNVRNPLSSR 56
           MP V L+S+ T  DS+F+ +WIKP +     +N +    P  R +  + +    + + S 
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQREL--VTDLLEHDIIESA 58

Query: 57  PSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSD 116
                      F +IVKF++V ++ ++A+IRD+   IL  FT  CV  +E  N  R+T +
Sbjct: 59  FQTALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLN 118

Query: 117 TTNCTLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLTINQASILDRDQATLLEQFPFV 176
           T N   +IG+ ++++ +  E    +  +FP  R++PVL I +A + DRDQ +   QF +V
Sbjct: 119 TLNTLFVIGNVTLQFWNHRECKLWFNQDFPGLRMVPVLKIEKARMFDRDQISSNVQFEWV 178

Query: 177 YST 179
           Y T
Sbjct: 179 YDT 181

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score = 98.2 bits (243), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 99/183 (54%), Gaps = 8/183 (4%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLR-PIYRAIPPINNTNVR--NPLSSRP 57
           MP      +  + +S F+  WI+  + E  +G +  P++ A+     + VR   P+    
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60

Query: 58  SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117
            LL  +   HF KI  F+K+ NF ++AS RD   QILVEFTP CVS FER +  R+T+ T
Sbjct: 61  QLLQNRR--HFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITART 118

Query: 118 TNCTLLIGDCSIEYKSSHEISQNY-RLNFPNKRL--LPVLTINQASILDRDQATLLEQFP 174
            N   LIG  +I+Y   +E+ + +   +  + R+  LPVL +N+ ++ D DQ     +F 
Sbjct: 119 VNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFN 178

Query: 175 FVY 177
           ++Y
Sbjct: 179 YLY 181

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 97.1 bits (240), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 74/123 (60%), Gaps = 11/123 (8%)

Query: 67  HFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTNCTLLIGD 126
           H  KI KF+KV N+KI AS++D   QILVE TP CV+ +ER  R R+TS+T +C  +IGD
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 127 CSIEYKSSHEISQNYRLN-FPN----------KRLLPVLTINQASILDRDQATLLEQFPF 175
           C + +++ +E+  N+  N F N            L+PVL INQ   +DR  +  L   PF
Sbjct: 151 CRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRDSLIPVLVINQIICVDRHPSKSLSTLPF 210

Query: 176 VYS 178
           ++S
Sbjct: 211 LHS 213

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score = 94.7 bits (234), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 94/188 (50%), Gaps = 21/188 (11%)

Query: 1   MPTVKLTSQHTRPDSIFIHDW----IKPLLDENCQGLLRPIYR------AIPPINNTNVR 50
           MP V L S+  + DSIF+ +W    + P L+ +  G   P         A+PP   T   
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERS--GACAPWAGVECFIPALPPATAT--- 55

Query: 51  NPLSSRPSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNR 110
             LS  P+++    +  F +IV+F +V +F + A  RD    ILVEFTPHCVS FER   
Sbjct: 56  --LSLEPTVIQNPKR--FLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYH 111

Query: 111 CRLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLN--FPNKRLLPVLTINQASILDRDQAT 168
            R+TS T N   +IG+ S+ + +  + +  + +         LPVL +   +I D+DQ  
Sbjct: 112 QRITSSTVNSLFVIGNTSLLFYARSDAAAAFEVPALMNGSSTLPVLRVGDCAIFDQDQVE 171

Query: 169 LLEQFPFV 176
              +FP V
Sbjct: 172 SHRRFPLV 179

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 98/185 (52%), Gaps = 12/185 (6%)

Query: 1   MPTVKLTSQHTRPDSIFIHDWI-KPLLDENCQGLLRPIYRAIP----PINNTNVRNPLSS 55
           M  +  +++  + +S+F+ +WI   +L    +    PI+ A+P    P+   +   P  S
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 56  RPSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTS 115
              LL  +   HF KI  F++VE F +FAS RD   +ILVEFTP CVS FER N  R+T+
Sbjct: 61  E-ILLNRR---HFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITA 116

Query: 116 DTTNCTLLIGDCSIEYKSSHEISQNYRLNF---PNKRLLPVLTINQASILDRDQATLLEQ 172
            T N  LLIG  +++Y   HE    + L+    P   ++PVL + Q ++ D DQ      
Sbjct: 117 KTVNTILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPS 176

Query: 173 FPFVY 177
           F ++Y
Sbjct: 177 FDYLY 181

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 9/100 (9%)

Query: 1  MPTVKLTSQHTRPDSIFIHDWIK----PLLDENCQ-GLLRPIYRAIPPINNTNVRNPLS- 54
          MP V L+S++   DSI++H+WI     P + E    G++  +   +P +++ ++ + +  
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 55 SRPSLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL 94
          SR  +L  +   HF K+ KFY+V N++++AS RD+   IL
Sbjct: 61 SRKIILNHR---HFIKLTKFYQVNNYQVYASARDSLCSIL 97

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 50.1 bits (118), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 8/82 (9%)

Query: 14 DSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNP-LSSRPSLLTTKVKCHFTKIV 72
          DS+F+  WI+  L E+   L     R IPP+   ++  P LSS+   + + ++ HF K+ 
Sbjct: 12 DSVFLQPWIQTALAEHDPRLGD---RLIPPVPTQDLSQPELSSK---VLSNIR-HFVKVT 64

Query: 73 KFYKVENFKIFASIRDTRFQIL 94
          +F+ V+++ ++ASIRD++ Q+L
Sbjct: 65 RFFDVDHYTVYASIRDSKAQLL 86

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 1  MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLR-PIYRAIPPINNTNVR--NPLSSRP 57
          MP      +  + +S F+  WI+  + E  +G +  P++ A+     + VR   P+    
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQLSS 60

Query: 58 SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL 94
           LL  +   HF KI  F+K+ NF ++AS RD   QIL
Sbjct: 61 QLLQNRR--HFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 9/93 (9%)

Query: 7  TSQHTRPDSIFIHDWI-KPLLDENCQGLLRPIYRAIP----PINNTNVRNPLSSRPSLLT 61
          +++  + +S+F+ +WI   +L    +    PI+ A+P    P+   +   P  S   LL 
Sbjct: 7  SAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSE-ILLN 65

Query: 62 TKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL 94
           +   HF KI  F++VE F +FAS RD   +IL
Sbjct: 66 RR---HFLKITNFHRVEKFAVFASGRDNNCRIL 95

>Kpol_1030.33 s1030 (68892..73031) [4140 bp, 1379 aa] {OFF}
           (68892..73031) [4140 nt, 1380 aa]
          Length = 1379

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 33/143 (23%)

Query: 20  DWIKPLLDEN--CQGLLRPIYRAIPPINNTNVRNPLSSR---------------PSLLTT 62
           + +K L+D+N     L   ++RA+    + N+ N +S +                SL  T
Sbjct: 789 EGMKILMDDNKIIPQLASLLFRAMEGKTDGNIFNEISLKTKTVVGYFKFIGVLTKSLNGT 848

Query: 63  KVKCH---FTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTN 119
           KV      FT I K +++EN   F  +  T  +I + F+PHC +   +            
Sbjct: 849 KVLDKWNFFTVIYKMFQIENKLSFTYLMYTLPEIDLRFSPHCRTIMGK------------ 896

Query: 120 CTLLIGDCSIEYKSSHEISQNYR 142
             L+IGD  I   S+  +S N +
Sbjct: 897 -ALVIGDEQIRLNSTQYMSNNLK 918

>Kpol_YGOB_1030.33 s1030 (68901..73031) [4131 bp, 1376 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 1376

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 33/143 (23%)

Query: 20  DWIKPLLDEN--CQGLLRPIYRAIPPINNTNVRNPLSSR---------------PSLLTT 62
           + +K L+D+N     L   ++RA+    + N+ N +S +                SL  T
Sbjct: 786 EGMKILMDDNKIIPQLASLLFRAMEGKTDGNIFNEISLKTKTVVGYFKFIGVLTKSLNGT 845

Query: 63  KVKCH---FTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTN 119
           KV      FT I K +++EN   F  +  T  +I + F+PHC +   +            
Sbjct: 846 KVLDKWNFFTVIYKMFQIENKLSFTYLMYTLPEIDLRFSPHCRTIMGK------------ 893

Query: 120 CTLLIGDCSIEYKSSHEISQNYR 142
             L+IGD  I   S+  +S N +
Sbjct: 894 -ALVIGDEQIRLNSTQYMSNNLK 915

>KNAG0D03350 Chr4 complement(600866..601843) [978 bp, 325 aa] {ON}
           Anc_4.145 YGR007W
          Length = 325

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 97  FTPHCVSTFERTNRCRLTS------DTTNCTLLIGDCSIEYKSSHEISQNYRLNFPNKRL 150
           F  HC   F+R     L S      D T+  L++GD  + +    E  QN R  +PN ++
Sbjct: 173 FAKHC-QVFDRDIHTLLVSSETFQFDPTSSLLIVGDFDLFHMGHIEQLQNARDGYPNSKI 231

Query: 151 LPVLTINQASIL 162
           +  +  +Q +I+
Sbjct: 232 IVGIQDDQDNIM 243

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 108 TNRCRLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLT 155
           T R R+ +D    TL  GD  IE   SH I+Q+ +L+    R+ P+LT
Sbjct: 410 TERPRIFNDI--VTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILT 455

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 108 TNRCRLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLT 155
           T R R+ +D    TL  GD  IE   SH I+Q+ +L+    R+ P+LT
Sbjct: 441 TERPRIFNDI--ITLRSGDHIIELTLSHAIAQSSKLSRFESRISPILT 486

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 108 TNRCRLTSDTTNCTLLIGDCSIEYKSSHEISQNYRLNFPNKRLLPVLT 155
           T R R+ +D    TL  GD  IE   SH I+Q+ +L+    R+ P+LT
Sbjct: 429 TERPRIFNDI--VTLRSGDHMIELTLSHAIAQSSKLSRFESRISPLLT 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,331,204
Number of extensions: 787101
Number of successful extensions: 2623
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2631
Number of HSP's successfully gapped: 37
Length of query: 180
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 77
Effective length of database: 41,670,801
Effective search space: 3208651677
Effective search space used: 3208651677
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)