Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L004206.46ON46046023170.0
NCAS0H009006.46ON4954859011e-116
ZYRO0C07172g6.46ON4504238921e-115
NDAI0D008906.46ON5394768471e-107
CAGL0J11792g6.46ON5104778151e-103
TDEL0G042406.46ON4444367901e-100
Smik_13.1066.46ON5064857729e-97
Suva_13.1176.46ON5134957484e-93
SAKL0E01980g6.46ON4654207401e-92
YML043C (RRN11)6.46ON5075097422e-92
Skud_13.1056.46ON5124957372e-91
KNAG0E009106.46ON4864917046e-87
KLTH0C10582g6.46ON4814816445e-78
Kwal_56.225276.46ON4814346201e-74
KLLA0C05852g6.46ON4824796052e-72
Ecym_30496.46ON5014725976e-71
TPHA0J005106.46ON4374485622e-66
ACL020W6.46ON5394295604e-65
TBLA0B005706.46ON5174745524e-64
Kpol_1037.116.46ON4014135192e-60
KAFR0A079502.15ON551120732.0
Ecym_25156.356ON136193732.6
KLLA0F02145g1.343ON718113723.2
KNAG0E031208.28ON127658705.7
TBLA0A056301.100ON1246137689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00420
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   897   0.0  
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   351   e-116
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   348   e-115
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   330   e-107
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   318   e-103
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   308   e-100
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   301   9e-97
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   292   4e-93
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   289   1e-92
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   290   2e-92
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   288   2e-91
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   275   6e-87
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   252   5e-78
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   243   1e-74
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   237   2e-72
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   234   6e-71
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   221   2e-66
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   220   4e-65
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   217   4e-64
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   204   2e-60
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    33   2.0  
Ecym_2515 Chr2 (1003069..1007154) [4086 bp, 1361 aa] {ON} simila...    33   2.6  
KLLA0F02145g Chr6 complement(193239..195395) [2157 bp, 718 aa] {...    32   3.2  
KNAG0E03120 Chr5 (623076..626906) [3831 bp, 1276 aa] {ON} Anc_8....    32   5.7  
TBLA0A05630 Chr1 complement(1398192..1401932) [3741 bp, 1246 aa]...    31   9.7  

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/460 (94%), Positives = 436/460 (94%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDELQQRKKRDWLH 60
           MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDELQQRKKRDWLH
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDELQQRKKRDWLH 60

Query: 61  VIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDKPQETYEHWPSHRKK 120
           VIGEYG                        YNLNNEERKFFKKIDKPQETYEHWPSHRKK
Sbjct: 61  VIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNLNNEERKFFKKIDKPQETYEHWPSHRKK 120

Query: 121 TRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQ 180
           TRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQ
Sbjct: 121 TRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQ 180

Query: 181 LKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILYEKDKLRSLEF 240
           LKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILYEKDKLRSLEF
Sbjct: 181 LKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILYEKDKLRSLEF 240

Query: 241 LEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLLEYTEQLFENDDEN 300
           LEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLLEYTEQLFENDDEN
Sbjct: 241 LEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLLEYTEQLFENDDEN 300

Query: 301 IDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTHSVGSMRDISMNQVIQ 360
           IDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTHSVGSMRDISMNQVIQ
Sbjct: 301 IDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTHSVGSMRDISMNQVIQ 360

Query: 361 HINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEV 420
           HINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEV
Sbjct: 361 HINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEV 420

Query: 421 DESNVFEDSANYFEFDDTQEQLNDLDTQQYFHDTDDSSSS 460
           DESNVFEDSANYFEFDDTQEQLNDLDTQQYFHDTDDSSSS
Sbjct: 421 DESNVFEDSANYFEFDDTQEQLNDLDTQQYFHDTDDSSSS 460

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 289/485 (59%), Gaps = 53/485 (10%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKD-DRNGMITPETSEDELQQRKKRD-- 57
           MF++P  +++K ++NERK+RY YINQ +R++ R+D + + + TPE S  E  +    D  
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDAESSSLPTPENSASESHESTGEDEE 60

Query: 58  ---------WLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDKPQ 108
                    W +VIGE                              N+ER+FFK  +KPQ
Sbjct: 61  VRRRRLKRRWKNVIGE---------AVSDTDEDEDGEEEREDEGPENQERRFFKTHEKPQ 111

Query: 109 ETYEHWPS-HRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGME 167
           E+YE W + + K+  +Q+  +++ + NK+ +  +R+M  SL+H S  N   F+    G E
Sbjct: 112 ESYEIWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQE 171

Query: 168 IVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNR 227
           +V PLH   + F LK IE LTNLL++NV +G WE+AYKIFA+++RIPKVDIRS+W +G +
Sbjct: 172 LVTPLHTPES-FTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVK 230

Query: 228 ILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLL 287
           IL ++    +L+FL WM+SVYS+R+ +IQG+ +R DPVFRSGSK H+ K+T+ WLW SL+
Sbjct: 231 ILSQRAATTTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKFTITWLWKSLI 290

Query: 288 EYTEQLFENDDENIDK------------LIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKA 335
             T+    ++DE+ID             LI+K++E+VLIPPFM+D E+WFIY++CHMVKA
Sbjct: 291 YCTDT---DNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCHMVKA 347

Query: 336 DFLSSKFD-THSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAF 394
           D LS  F+   S GS RDI+ N+VIQ+I  VK +L      S+G +E  E  IT+QL  F
Sbjct: 348 DQLSLNFNLNQSNGSARDIARNEVIQNIQLVKTFLQTA--MSKGHFEYPERFITRQLNTF 405

Query: 395 EVRLYKEPVFPLEPENDLDGDNEEEVDESNV-----------FEDSANYFEFDDTQEQLN 443
           E RLY +     + +++ + DN   +D  N+            ED   + +F  T    +
Sbjct: 406 EERLYSKDETNSKDKDNNESDNGSSMDNGNIQLVPETNPIPPAEDEYVFSDFSFTN-AAH 464

Query: 444 DLDTQ 448
           DLDTQ
Sbjct: 465 DLDTQ 469

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  348 bits (892), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 185/423 (43%), Positives = 250/423 (59%), Gaps = 42/423 (9%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNG-------MITPETSEDELQQR 53
           MFE+P+ + SK     RKL+Y+YIN  ++++   D  NG       + TPE S  E  + 
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKY---DGINGISNGQTELPTPENSATETSEN 57

Query: 54  KK----------RDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKK 103
           ++          +    +IGE                            ++NEERKF++K
Sbjct: 58  EEVGQQKRRRIRKRLKSIIGE-------------SYSDLESDEEQPVEEVDNEERKFYRK 104

Query: 104 IDKPQETYEHWPSH-RKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCK 162
            +KPQ T+E W    RK+T IQR+ + Y+R N++ R+  R+M  SL   S  N+  F   
Sbjct: 105 YEKPQLTFEKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHAT 164

Query: 163 IDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVW 222
             G ++ +P +  A  FQLK I TLT+LL++NV +  WE+AYK FA+LIRIP VD+R++W
Sbjct: 165 TQGYQLFDPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLW 224

Query: 223 NVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWL 282
            +G RIL E+   RSLEFL+WMSSVYST++ F   +NYR  PVF  GSK HTPKYT  WL
Sbjct: 225 GLGERILAERQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKYTTTWL 284

Query: 283 WNSLLEYTEQL--FENDD----ENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKAD 336
           W  L+ Y   L   E D     EN   L+D+I+EMVL PP+MDDPE+WFIY++CHMVKAD
Sbjct: 285 WECLIRYANGLEDLEMDSKSAAENFQSLMDRISEMVLGPPYMDDPEVWFIYALCHMVKAD 344

Query: 337 FLSSKFDTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEV 396
            LS +FD    GS RDI+ NQVIQHI + K +L  C   S+G +   +  I +QL AFE 
Sbjct: 345 TLSQQFDPRLTGSARDIASNQVIQHIQNTKSHLQQC--SSKGGFTFPKRYIARQLAAFEA 402

Query: 397 RLY 399
           RLY
Sbjct: 403 RLY 405

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 279/476 (58%), Gaps = 63/476 (13%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRN-------GMI-TPETSEDE--- 49
           MFE+P+  N+K  + ERK+RY YINQ ++++ R  +R+       G++ TPE+S  E   
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 50  -----------LQQRKKRDWLHVIGE-------YGXXXXXXXXXXXXXXXXXXXXXXXXY 91
                       ++R +R W  VIGE                                 +
Sbjct: 61  DDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDHHESAH 120

Query: 92  NLNNEERK-FFKKIDKPQETYEHWPSHR-KKTRIQRDILTYHRYNKVSRYVERKMANSLV 149
           +++  E + FFKK +KPQET+E W ++  K+  I + ++TY +  K+ +  +RK+   L+
Sbjct: 121 HIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPLL 180

Query: 150 HVSSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAM 209
           H S  N+  F+   +G+E+V PL     NF L+ IE LT LLYLNV+R NW+IAY+IF +
Sbjct: 181 HASKINKLCFEAMSEGLELVTPL-VTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239

Query: 210 LIRIPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSG 269
           LIRI K+DIRS+W +G RIL EK   ++L+FL WM+SVYS+R+ FIQGINYR DPVF+SG
Sbjct: 240 LIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPVFKSG 299

Query: 270 SKNHTPKYTLQWLWNSLLEY-TEQLFEND-----------------DENIDK-----LID 306
           S+ HTPKYTL WLW SL++Y T+++   +                 D NID+     LI+
Sbjct: 300 SRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLLDLIE 359

Query: 307 KIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTH-SVGSMRDISMNQVIQHINDV 365
           KI+EMVLIPPFM+D E+WFIYS+CHMV AD LSSKF+   S GS  DI  NQVIQHI   
Sbjct: 360 KISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQVIQHIQKT 419

Query: 366 KRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVD 421
           K YL     K  G +E  E  I KQL  +E RLY       +P ++ +   +E+VD
Sbjct: 420 KSYLQTSMNK--GDFEYPEKYILKQLSIYEQRLYAS-----DPTSNNNNVTDEDVD 468

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  318 bits (815), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/477 (38%), Positives = 283/477 (59%), Gaps = 56/477 (11%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRF------ERKDDRNGMITPETS-------E 47
           MFE+P+  N + L+ ER++RY+YIN  +R++      +R+   N + TPE S       E
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60

Query: 48  DELQQRKK-RDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDK 106
            +L  R++ ++    +GE                           ++N  E+ F++K +K
Sbjct: 61  SQLPSREQIKEKKMKLGE--DYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEK 118

Query: 107 PQETYEHW-----PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKC 161
           P+ ++E W      + +KK  +++  + Y R N+V R  ++++  ++VH+   N+ +F  
Sbjct: 119 PEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDI 178

Query: 162 KIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSV 221
           K +G E++EPL     ++ LK IE LT +L+ +V++GNW+IAY+ F++LIRIP+VDIR++
Sbjct: 179 KSEGYEVLEPL-VDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNI 237

Query: 222 WNVGNRILYEKDKL-RSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQ 280
           W +G RIL E+ +  RSLEFL+WMS+VYS++  F+Q   +R  PVFRSGS+ HTPKY L 
Sbjct: 238 WGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALT 297

Query: 281 WLWNSLLEYTEQLF------------ENDD-------ENIDKLIDKIAEMVLIPPFMDDP 321
           WLWN L++ TE +             END+       + + +LIDKI+EMVL+PP++DDP
Sbjct: 298 WLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDP 357

Query: 322 EIWFIYSMCHMVKADFLSSKFDTHSV-GSMRDISMNQVIQHINDVKRYLNVCKEKSQGQY 380
           EIWFIYSMCHMV AD+LS KF+   + GS RDI+ NQV QHI+ VK YL  C +K  G +
Sbjct: 358 EIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQK--GNF 415

Query: 381 ESNEMIITKQLKAFEVRLYKEPVFP-----------LEPENDLDGDNEEEVDESNVF 426
           E  +  I  +L+ FE R+Y++   P               N+ D +N  ++DESN F
Sbjct: 416 EYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSF 472

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  308 bits (790), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/436 (38%), Positives = 256/436 (58%), Gaps = 31/436 (7%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRF---ERKDDRNGMITPETS-------EDEL 50
           MFE PV + ++ L N +KLRY+Y+N  + +F   ER  + NG+ TPE S       E+ L
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNTNGLPTPENSAAESSENEEAL 60

Query: 51  QQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDKPQET 110
           Q++KKR    +    G                            ++ERKF    + PQE+
Sbjct: 61  QRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVE---DEEEDQERKFLNNYELPQES 117

Query: 111 YEHW---PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGME 167
           +E W   PS  K+  IQR  +++ +Y ++ R+ +RKM  S+   S +N+ +     +G E
Sbjct: 118 FEKWQDDPS--KRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFE 175

Query: 168 IVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNR 227
           +V+P+      FQ+K I  LT LL+L+V+R  W+ AY  FA+LIR+PKVDIR++W +G+ 
Sbjct: 176 MVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDL 235

Query: 228 ILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLL 287
           IL E++ ++SLEFL WMSSVYS+R  F + +N+R  PVF  GSK H PK+   W+W SL+
Sbjct: 236 ILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKFATTWMWESLI 295

Query: 288 EYT---------EQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFL 338
           + T         EQ+  ND   +  LI++I+EMVL PP+MD  E+WFIY +CH++KAD L
Sbjct: 296 QCTKNSLETGELEQIESND--GLQDLIERISEMVLAPPYMDASEVWFIYGLCHLIKADIL 353

Query: 339 SSKFDTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRL 398
           S++FD    GS RDI+ NQVIQHI   K  L  C   S+G ++  +  I +QL+ FE RL
Sbjct: 354 SNQFDGRLAGSARDIASNQVIQHIQRTKSCLQTC--LSKGDFKYPKRYIERQLEEFEKRL 411

Query: 399 YKEPVFPLEPENDLDG 414
            ++   P + +++++ 
Sbjct: 412 DRQEDTPDDSDHEVES 427

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  301 bits (772), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 181/485 (37%), Positives = 269/485 (55%), Gaps = 48/485 (9%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRN----GMITPETSEDE------- 49
           MFE+P+ + +K  +  RKL+Y+YIN  +RRFE+   ++     + TPE S  E       
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEEDDG 60

Query: 50  -------------LQQRKKR---DWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNL 93
                        LQQRK+R    W  V+GE                             
Sbjct: 61  ERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEGKEED 120

Query: 94  NNEERKFFKKIDKPQETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHV 151
            +EERKF+KK +KP+E++E W   S + K+ I +  +TYH + K+ +   RKM   L+H 
Sbjct: 121 IDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPLLHC 180

Query: 152 SSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLI 211
           + +++ HF+    G+E ++P      N++ K I TLTNLL+LNV+R NW +AYKIFA LI
Sbjct: 181 TKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIFATLI 240

Query: 212 RIPKVDIRSVWNVGNRILYEKDKLR-SLEFLEWMSSVYSTRVTFIQGINYR-FDPVFRSG 269
           RIP V I+S+W +G  IL     L  SL+FL+WM  +YS+++ F+Q  NYR   P F++G
Sbjct: 241 RIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIVPPFQTG 300

Query: 270 SKNHTPKYTLQWLWNSLLEYTEQL---------FENDDENIDKLIDKIAEMVLIPPFMDD 320
           S+ HT K+   +LW+SL+   + +         ++ +++ +  LID+I+E VL PPFM+D
Sbjct: 301 SRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTPPFMED 360

Query: 321 PEIWFIYSMCHMVKADFLSSKFDTHS-----VGSMRDISMNQVIQHINDVKRYLNVCKEK 375
            E+WFIY+ CH++KAD LS +F   +     +G  RDI +NQVI+HI+ VK +L  C +K
Sbjct: 361 AEVWFIYASCHLLKADILSRQFANDNKTSDLIGLDRDIKINQVIKHIHYVKVFLQTCSDK 420

Query: 376 SQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVDESNVFEDS-ANYFE 434
             G +     +I  QLK FE RLY E     E E D D ++ ++   +N F D      E
Sbjct: 421 --GGFTVPNRLIESQLKGFESRLYGEAQDLREREMDDDYNSIDDNSVNNSFRDVYETNAE 478

Query: 435 FDDTQ 439
           F DTQ
Sbjct: 479 FLDTQ 483

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  292 bits (748), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 178/495 (35%), Positives = 273/495 (55%), Gaps = 61/495 (12%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER----KDDRNGMITPETSE--------- 47
           MFE+P+ + +K  +  RKL+Y+YIN  +RRF+R     +  + + TPE S          
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDEDYD 60

Query: 48  ------------------DELQQRKKRDWLHVIGE-YGXXXXXXXXXXXXXXXXXXXXXX 88
                              + ++R++R W  VIGE Y                       
Sbjct: 61  DDEEERNYESDAGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQVEHE 120

Query: 89  XXYNL--NNEERKFFKKIDKPQETYEHWP--SHRKKTRIQRDILTYHRYNKVSRYVERKM 144
                   +EERKF+KK +KP++++E W   S   K+ I +  +TYH Y K+ +   RKM
Sbjct: 121 TRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLRKM 180

Query: 145 ANSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAY 204
              L+H + +N+ +F+    G+E ++     A N+Q + I TLTNLL+LNV+R NW +AY
Sbjct: 181 EIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSRHNWPLAY 240

Query: 205 KIFAMLIRIPKVDIRSVWNVGNRILYEKDKL-RSLEFLEWMSSVYSTRVTFIQGINYR-F 262
           KIFA LIRIP V I+S+W +G +IL     L  SL+FL+WM  VYS++  F+Q +NYR  
Sbjct: 241 KIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRFVQNVNYRSV 300

Query: 263 DPVFRSGSKNHTPKYTLQWLWNSLLE---------YTEQLFENDDENIDKLIDKIAEMVL 313
            P F++GS+ HT K+ + +LW+ L+           T+  ++ ++  +++LID+I+E VL
Sbjct: 301 VPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELIDQISEWVL 360

Query: 314 IPPFMDDPEIWFIYSMCHMVKADFLSSKF-----DTHSVGSMRDISMNQVIQHINDVKRY 368
           IPPFM+D E++FIY+ CH++KAD LS +F     +   VG  +DI +NQVI++I+ VK +
Sbjct: 361 IPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNNDLVGLNKDIKINQVIKNIHYVKVF 420

Query: 369 LNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEP--VFPLEPENDLDGDNEEEVDES--N 424
           L  C +K  G +     +I  QLK+FE RLY E   +      +D D  +    D S  +
Sbjct: 421 LQTCLDK--GGFTIPNRLIENQLKSFESRLYGEAQDIHERRMVDDYDNTDNSSADNSFGD 478

Query: 425 VFEDSANYFEFDDTQ 439
           V+E +A   EF DTQ
Sbjct: 479 VYETNA---EFLDTQ 490

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  289 bits (740), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 172/420 (40%), Positives = 239/420 (56%), Gaps = 29/420 (6%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER---KDDRNGMITPETS----------E 47
           MFE+PV   +K + ++RKLRY+YIN   ++ E+   K    G+ TPE+S          E
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNPKKQTVGLPTPESSAAETSDTDELE 60

Query: 48  DELQQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDKP 107
           D   +R KR    +    G                        Y     E+    K  KP
Sbjct: 61  DSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECDY-----EKHVKNKYYKP 115

Query: 108 QETYEHWPSH-RKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGM 166
           QETYE W +    +  +    +TY +Y K+ +   R++  +L + S  +   F    +G 
Sbjct: 116 QETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGY 175

Query: 167 EIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGN 226
           E  E       N+Q   I  LTNLL++NV   NWEIAY+ F++LIR+P VDIRS+W +G 
Sbjct: 176 EPYET--SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGV 233

Query: 227 RILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSL 286
           RIL E D+ RS EFLEWMSSV+ST+  F QG N+  DPVFRSGSK HTPK+   WLW +L
Sbjct: 234 RILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETL 293

Query: 287 LEYTEQLFENDDENIDK---LIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKF- 342
           +  T +   N + +++K   L +KI+E+VL PP+MDDP+IWFIY++CH+V+AD LS +F 
Sbjct: 294 MGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQQFI 353

Query: 343 -DTH-SVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYK 400
            + H   GS RDI+ NQVIQHI + K +L  C+EK  G ++  +  I KQL  FE RLY+
Sbjct: 354 ENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEK--GGFQFPKQHIEKQLSNFENRLYQ 411

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  290 bits (742), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 178/509 (34%), Positives = 282/509 (55%), Gaps = 55/509 (10%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDR----NGMITPETSEDE------- 49
           MFE+P+ + ++  +  RKL+Y+YIN  +RRF+R   +    + + TPE S  E       
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEG 60

Query: 50  ------------LQQRKKR---DWLHVIGE-YGXXXXXXXXXXXXXXXXXXXXXXXXYNL 93
                       LQQ+K+R    W  V+GE Y                            
Sbjct: 61  QNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKED 120

Query: 94  NNEERKFFKKIDKPQETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHV 151
           ++EERKF+KK +KP++++E W   S + K  I +  +TYH + K+ +   RKM   L+H 
Sbjct: 121 SDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHC 180

Query: 152 SSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLI 211
           + +N+ +F+    G+E ++       N++ + I TLT+LL+LNV+R NW +AYKIFA LI
Sbjct: 181 TKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLI 240

Query: 212 RIPKVDIRSVWNVGNRILYE-KDKLRSLEFLEWMSSVYSTRVTFIQGINYR-FDPVFRSG 269
           RIP V I+S+W +G  IL    +    L+FL+WM  +YS++  F+Q INYR   P F++G
Sbjct: 241 RIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTG 300

Query: 270 SKNHTPKYTLQWLWNSLLEYTEQL----------FENDDENIDKLIDKIAEMVLIPPFMD 319
           S+ HT K+ + +LW+SL+   + +          F+ +++ + +LIDKI+E VL PPFM+
Sbjct: 301 SRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFME 360

Query: 320 DPEIWFIYSMCHMVKADFLSSKF-----DTHSVGSMRDISMNQVIQHINDVKRYLNVCKE 374
           D E+WFIY+ CH++KAD LS +F     +   +G  RDI +NQVI+HI+ V+ +L +C +
Sbjct: 361 DAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTFLKICLD 420

Query: 375 KSQGQYESNEMIITKQLKAFEVRLYKEP--VFPLEPENDLDGDNEEEVDES--NVFEDSA 430
           K  G +     +I  QLK+FE RLY E   +   +  N  D  +   V+ S  +V+E +A
Sbjct: 421 K--GGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVYETNA 478

Query: 431 NYF--EFDDTQEQLNDLDTQQYFHDTDDS 457
            +   +  D   + N LD + ++ D D S
Sbjct: 479 EFLDTQLMDLSPEDNGLD-EMHYSDEDSS 506

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  288 bits (737), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 179/495 (36%), Positives = 273/495 (55%), Gaps = 62/495 (12%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER----KDDRNGMITPETSE--------- 47
           MFE+P+ + +K  +  RKL+Y+YIN  +RRF++     +  + + TPE S          
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDDDYD 60

Query: 48  --------DE--------LQQ---RKKRDWLHVIGE-YGXXXXXXXXXXXXXXXXXXXXX 87
                   DE        LQQ   R++R W  V+GE Y                      
Sbjct: 61  YDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGRET 120

Query: 88  XXXYNLNNEERKFFKKIDKPQETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMA 145
                  +EERKF+KK +KP+ ++E W   S + K  I R  +TYH++ K+ +   RK+ 
Sbjct: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180

Query: 146 NSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYK 205
             L+H + +NR +F+    G+E ++       N+Q + I TLTNLL++NV+R NW +AY+
Sbjct: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240

Query: 206 IFAMLIRIPKVDIRSVWNVGNRILYE-KDKLRSLEFLEWMSSVYSTRVTFIQGINYR-FD 263
           IFA LIRIP+V ++S+W  G +IL    D   SL+FL+WM  +YS++  F+Q IN+R   
Sbjct: 241 IFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQNINHRSIV 300

Query: 264 PVFRSGSKNHTPKYTLQWLWNSLLEYTEQL---------FENDDENIDKLIDKIAEMVLI 314
           P F++GS+ HT K+   +LW SL+   + +         ++ +++ + +LIDKI+E VL 
Sbjct: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360

Query: 315 PPFMDDPEIWFIYSMCHMVKADFLSSKFDTHS-----VGSMRDISMNQVIQHINDVKRYL 369
           PPFM+D E+WFIY+ CH++KAD LS +F         +G  RDI +NQVI+HI+ VK +L
Sbjct: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420

Query: 370 NVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVDE-----SN 424
             C +K  G +     +I  QLK FE+RLY E     E E  +DG +E ++        +
Sbjct: 421 QTCLDK--GGFTIPNRLIEIQLKNFELRLYGETQDVQERE-IVDGYDETDISSVENSFGD 477

Query: 425 VFEDSANYFEFDDTQ 439
           V+E +A   EF DTQ
Sbjct: 478 VYETNA---EFLDTQ 489

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  275 bits (704), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 181/491 (36%), Positives = 263/491 (53%), Gaps = 55/491 (11%)

Query: 1   MFEIPVNVNSKTLSNE---RKLRYRYINQFTRRFERKD--DRNGMITPETSEDEL----- 50
           MFE+PV + S + S     +KLRYRY N+   +++R    D NG +TPE+S  EL     
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIKIHDENGQLTPESSHTELDDHES 60

Query: 51  -----QQRKKRDW-LHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKI 104
                + RK+R + L    E+G                          + +EERK+FK  
Sbjct: 61  RSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEE----EIGHEERKYFKNH 116

Query: 105 DKPQETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCK 162
           +KP++ YE W   + R+K  IQR  ++Y+R   + R  +RKM   L+HVS      F  +
Sbjct: 117 EKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFSAE 176

Query: 163 IDGMEIVEPLHKG--ATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRS 220
           IDG ++V    +G   T+F+ K I+ L  LL+ +++  NW +AYK+FA+LIR+P+VDIR+
Sbjct: 177 IDGYDVVS---RGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRA 233

Query: 221 VWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQ 280
           VWN+G  IL  +D   +++FLEWM SVYS +  FIQ +N+R  P FRSGS+ HT +YT  
Sbjct: 234 VWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQYTTT 293

Query: 281 WLWNSLLEYTEQLFENDD---ENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADF 337
           WLW SL   TEQ  E      E ++ L DK +E++L PP+MDD E+WFIY  C+ VKAD 
Sbjct: 294 WLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSCYFVKADI 353

Query: 338 LSSKFD---THSV----GSMRDISMNQVIQHINDVKRYLNVCKEKS-------QGQYESN 383
           LS       TH+V     S  D+  N+V+Q I   ++ L+  +EKS          +E  
Sbjct: 354 LSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAYWELP 413

Query: 384 EMIITKQLKAFEVRLYK------EPVFPLEPENDLDGDNEEEVDESNVFEDSANYFEFDD 437
              I +QL+  E RL        +P  P   EN   GD E   D++++     + F  ++
Sbjct: 414 TGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDTELAEDQADI-----DAFPIEE 468

Query: 438 TQEQLNDLDTQ 448
               L  LDTQ
Sbjct: 469 DNSFLQALDTQ 479

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  252 bits (644), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 159/481 (33%), Positives = 247/481 (51%), Gaps = 67/481 (13%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER----KDDRNGMITPETSEDE------- 49
           MFE+P+  N+K +   RKLRY+YIN   + + +     +  + + TPE S  E       
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60

Query: 50  -------LQQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFK 102
                   ++R+KR  L V+G                            +  + E++FF 
Sbjct: 61  NSADATSRRRRRKRRLLSVLGH--------AETDTELSDMEAEEGSHEADQADSEKEFFT 112

Query: 103 KIDKPQETYEHWPSHRKKT-RIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKC 161
           + +KPQET+E W + R+K   +    L+Y    ++ ++ +++++  + H+S    +HF+ 
Sbjct: 113 RHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQA 172

Query: 162 KIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSV 221
             DG E V    +   +  L  I  L  LL+ N+ +G W+ AY+ F++LIR+P +DIRSV
Sbjct: 173 MKDGYETVA---ETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSV 229

Query: 222 WNVGNRILYE-----KDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPK 276
           W  G RIL E     K    S EFL W+S ++S+R  F Q +N+  DPVFR GSK H  K
Sbjct: 230 WGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAK 289

Query: 277 YTLQWLWNSLL----EYTEQLFENDDEN--IDKLIDKIAEMVLIPPFMDDPEIWFIYSMC 330
           + + WLW  L     + TE     D  N  +  L+++++EMVLIPP+M+DPE+WFI+++C
Sbjct: 290 FVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVC 349

Query: 331 HMVKADFLSSKFDTHSVGSM---RDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMII 387
           H+V AD LS +F +  + +    RDIS NQV QHI +    +  C+ K + ++     II
Sbjct: 350 HLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKE-EFSFPRRII 408

Query: 388 TKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVDESNVFEDSANYFEFDDTQEQLNDLDT 447
            +QL  FE RLY+               N  E   S    D  + FE D++ E   +LDT
Sbjct: 409 EEQLACFEKRLYQ---------------NSGESTAS----DLGSGFELDNSPE---NLDT 446

Query: 448 Q 448
           Q
Sbjct: 447 Q 447

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  243 bits (620), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 151/434 (34%), Positives = 214/434 (49%), Gaps = 46/434 (10%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNG----MITPETSEDELQQRKKR 56
           MFE+P+  NS  +   RKLRY+YIN  ++   R  D       + TPE S  E      +
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASDGDQ 60

Query: 57  D--------------WLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFK 102
           D               L V+G                             L   E++FF 
Sbjct: 61  DSEDAGSRRRRRKRRILSVLGHIDSESELSDVDMSTESHHS--------ELQESEKEFFS 112

Query: 103 KIDKPQETYEHWPSHRKKT-RIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKC 161
             +KPQ+TYE W + R+K   +    L+Y     +    +R++   + H S   R HF  
Sbjct: 113 HHEKPQDTYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSHFNS 172

Query: 162 KIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSV 221
              G EI     + +   Q   I  L  LL++NV  G WE A++ F++LIR+P VDIRS+
Sbjct: 173 IKRGYEIYS---RPSQVHQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSM 229

Query: 222 WNVGNRILYE-----KDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPK 276
           W +G RIL E     K+   S EFL W+S +Y++R  F   +N+  DPVFR+GSK HT K
Sbjct: 230 WGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHTAK 289

Query: 277 YTLQWLWNSLLEYTEQLFE-------NDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSM 329
           +   WLW  L        E       + +  + +L++K++EMVLIPP+M+DPEIWFIY++
Sbjct: 290 FVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPYMEDPEIWFIYAL 349

Query: 330 CHMVKADFLSSKFD---THSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMI 386
           CH+V AD LS +F    + S    RDIS NQV QHI +    +  C+ K    +     I
Sbjct: 350 CHLVSADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKGDDFFFPRR-I 408

Query: 387 ITKQLKAFEVRLYK 400
           I +QL  FE RLY+
Sbjct: 409 IEEQLAFFERRLYE 422

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  237 bits (605), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 165/479 (34%), Positives = 236/479 (49%), Gaps = 53/479 (11%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRF--------------ERKDDRNGMITPETS 46
           MF++PV   S      RK+RY+YIN   R++              E  +  NG++TPE S
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 47  ED--------ELQQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEER 98
           E         E + R+KR    V+G                            + N+ E 
Sbjct: 61  ESSEAEAADLEKKHRRKRRLQSVLGN-----------ALDSSDEELDGDEDGTDENDPET 109

Query: 99  KFFKKIDKPQETYEHWPSHRK-KTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRY 157
           +F++   KPQ T+E W  +   +T IQR  +TY+   K+ +   + +   L + + K   
Sbjct: 110 QFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNM 169

Query: 158 HFKCKIDGMEIV-EPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKV 216
           +F+    G ++  +P         L     L  LLY NV   NWEIAY+ F++LIR+  V
Sbjct: 170 YFQALKFGFDVYPKPQLSKQKTMHLAH---LNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226

Query: 217 DIRSVWNVGNRILYEKDKLRSLE-FLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTP 275
           D+RS+W++G+ IL      +S E +LEW++ V+ +RV F QG NY  DPVFR GS+ HTP
Sbjct: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286

Query: 276 KYTLQWLWNSLLEYTEQLFENDDEN-IDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVK 334
            + L WLW  L   T      D E  +  LID++ EMVL PP+MDD EIW+I+ + H+V 
Sbjct: 287 TFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVM 346

Query: 335 ADFLSSKFDTHS---VGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQL 391
           A  LSSKF       +GS  DI+ NQVIQHIN+ K  L +CK  S   YE  E +I  QL
Sbjct: 347 ASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS--NYEFPENVIEHQL 404

Query: 392 KAFEVRLYKEPVFPLEPENDLDGDNEEEVDESNVFEDSANYFEFDDTQEQLNDLDTQQY 450
              E  LY + +     +      +E+ ++ S   EDS            +  LDTQQY
Sbjct: 405 VQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDS--------NLPDVGPLDTQQY 455

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  234 bits (597), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 159/472 (33%), Positives = 236/472 (50%), Gaps = 54/472 (11%)

Query: 1   MFEIPV-NVNSKTLSNERKLRYRYINQFTRRFER-----------KDDRNGMITPETSED 48
           MFE P+ + NSK     RKL+Y+YIN   R++E              D +G+ TP  S  
Sbjct: 1   MFESPIISYNSKD-RKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAA 59

Query: 49  ELQQRKKRD---------------WLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXY-N 92
           E      R+                  ++G                           Y +
Sbjct: 60  EASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGYLD 119

Query: 93  LNNEERKFFKKIDKPQETYEHWP-SHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHV 151
             + E+ F+ K   P+ETYE W  S   +  IQR  ++YH +  + +Y  +K+A SL   
Sbjct: 120 EKDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLALS 179

Query: 152 SSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLI 211
           S K    F+    G E   P  +  TN+Q   +  L +LLY+N+ RG+++ AY+ F++LI
Sbjct: 180 SKKLTGFFEVIRSGYETC-PRER-ITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLI 237

Query: 212 RIPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSK 271
           R+  VD+RS+WN+G++IL   +      FLEWMS+V ++   F Q    + DPVFRSGS+
Sbjct: 238 RMNFVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFRSGSR 297

Query: 272 NHTPKYTLQWLWNSLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCH 331
            H P + L WLW  L    ++   +   +I+ L+DKI+E+VL PP+MDD E+WFIY+MC+
Sbjct: 298 THIPNFVLSWLWLVLENAVKERVFSSGHDINWLLDKISELVLRPPYMDDAEVWFIYAMCY 357

Query: 332 MVKADFLSSKFDTHSV-----GSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMI 386
            +KAD LS +           GS  DI+ NQVI++I+ VK +L +C+EK   QY   + +
Sbjct: 358 FIKADKLSLQLKQEGSLNGLKGSQLDIARNQVIENIHHVKNHLRICEEKGGFQYP--KRV 415

Query: 387 ITKQLKAFEVRLYKEP----------VFPLEPENDLDGDNEEEVDESNVFED 428
           I  QL  FE RLY E            FPLE     + D E+ +   N  +D
Sbjct: 416 IEAQLVEFEKRLYPESSTHINYPGYETFPLE-----ESDTEDNLVSINFLQD 462

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  221 bits (562), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 233/448 (52%), Gaps = 55/448 (12%)

Query: 1   MFEIPVNVN-SKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDE---------- 49
           MFE+PV+ N +    N +KLRY+YIN    +   +  +N + TP TSE++          
Sbjct: 1   MFELPVSSNITINAFNLKKLRYQYINDINAK-HNELSKNELPTPVTSENDTGGEDLDGDS 59

Query: 50  -----------LQQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEER 98
                       Q+R+ R W  ++GE                              +EE+
Sbjct: 60  EHNLTSEDAEVAQERRIRRWKSIMGE-----AIDDDEDDNNHDDDVDNEFEDNGPTDEEK 114

Query: 99  KFFKKIDKPQETYEHWPSH--RKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNR 156
           K+F + DKPQE++E W S+  +++  + ++ +TY+R+ K  + +++K     +H++   +
Sbjct: 115 KYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTMHLNKNVK 174

Query: 157 YHFKCKIDGMEIVE----PLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIR 212
            +F+  IDG E +       ++   N+    +  LT+L+Y N+ +  W+IAYK F  L+R
Sbjct: 175 NNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLLR 234

Query: 213 IPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTR-VTFIQGINYRFDPV-FRSGS 270
           IP VDIR VWN+G+ IL   D  + ++FL+W+S+VYS +  +F+QGINYR D   F  GS
Sbjct: 235 IPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQTNFNGGS 294

Query: 271 KNHTPKYTLQWLWNSLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMC 330
           +  TP YT   LW+ L   ++   E  +  ID LI++IAEMV+IPP+ +D EIW+I+++C
Sbjct: 295 RRLTPLYTKTLLWHKLTLSSDS--ETCESEIDSLIEQIAEMVVIPPYSEDNEIWYIFALC 352

Query: 331 HMVKADFLSSKF-------------DTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQ 377
           H+VKAD LS K              DT+   +  +I  N++   IN+ K+YL    +   
Sbjct: 353 HLVKADNLSEKLYFMSRRNPEVDEMDTYPYDT--EIYNNKITICINNCKKYLRKATQDKN 410

Query: 378 GQYESNEMIITKQLKAFEVRLYKEPVFP 405
             Y +    I  +LK  E R +     P
Sbjct: 411 FDYPAR--TIETKLKTIETRTFDFESMP 436

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  220 bits (560), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 139/429 (32%), Positives = 212/429 (49%), Gaps = 37/429 (8%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKD-----------DRNGMITPETSEDE 49
           MFE P+   SK    +R L+Y+Y++   R++E+ +           D     TP+ S  E
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 50  LQQRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEE------------ 97
                  D L    +                           +L +EE            
Sbjct: 106 ASDG---DALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGSTAKD 162

Query: 98  --RKFFKKIDKPQETYEHWP-SHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSK 154
             ++FF +  KP+ TYE W  S + +  I+R +L+Y  + ++  Y  ++M  +L   + K
Sbjct: 163 YEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKK 222

Query: 155 NRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIP 214
              + +    G E      +  TN+Q   +  L  LLY N+   NW  AY+ FA+LIR+ 
Sbjct: 223 AAAYHEVMRLGYETCP--KEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMK 280

Query: 215 KVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHT 274
            VD+RS+WN+G+ IL   +     +FLEWM +V+++   F Q      DPVFRSGS+ HT
Sbjct: 281 SVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHT 340

Query: 275 PKYTLQWLWNSLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVK 334
           P + L WLW  L   T     +   ++  L++K++E+VL PP+MDD EIWF+Y+MC+ ++
Sbjct: 341 PNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQ 400

Query: 335 ADFLSSKFDTHSV----GSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQ 390
           AD LS++  +H      GS  DI+  QV Q+I  VK  L  C+EK  G +   E II +Q
Sbjct: 401 ADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREK--GNFTYPERIIQEQ 458

Query: 391 LKAFEVRLY 399
           L  FE RLY
Sbjct: 459 LLEFERRLY 467

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  217 bits (552), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/474 (31%), Positives = 242/474 (51%), Gaps = 56/474 (11%)

Query: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDELQQRKKRDWLH 60
           MFE P+N++SK L+NERK+RY+YIN FT+R+ +     G   P +S   L+  + R  + 
Sbjct: 1   MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQ---LYGDTIPSSS---LESNRSRTPIT 54

Query: 61  VIGEYGXXXXXXXXXX-----XXXXXXXXXXXXXXYN-----LNNEERKFFKKIDKPQET 110
           +                                  YN       NEE KFF + D+PQE+
Sbjct: 55  LPTPEASAHEHSDSNTNYNDDSDSISNTNTLSDDEYNSDSTGTTNEETKFFNRYDRPQES 114

Query: 111 YEHWPSH----RKKTR--------IQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYH 158
           +E W +       KT+        I R+ ++++R N+V ++  +K+   L H + + + H
Sbjct: 115 FEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEARLQHCTKRLKTH 174

Query: 159 FKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDI 218
            K   +G E      K  T+F    IE L NLLY N+   N+  AY IF+++IR+P +DI
Sbjct: 175 IKAISEGYE-TSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIFSLIIRLPNIDI 233

Query: 219 RSVWNVGNRILYEKDKLR-SLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKY 277
           R+ WN+G+ IL +K  ++ SL FL W+ S+YS+   +   INY+  P F   S+NHT K+
Sbjct: 234 RNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKTAPAFTQSSRNHTGKF 293

Query: 278 TLQWLWNSL----LEYTEQLFENDDENIDKL----------IDKIAEMVLIPPFMDDPEI 323
           T  +LW +L     ++++    N  E +++L          ++K++EMVL PPF++D EI
Sbjct: 294 TTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLSEMVLAPPFIEDSEI 353

Query: 324 WFIYSMCHMVKADFL---SSKFDTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQY 380
           W+IYS+ H++ A  L   +   D       +DI+ N++I +I   K +L   +E +Q  Y
Sbjct: 354 WYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISNIQHCKSHLQKVRE-NQNDY 412

Query: 381 ESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEE-VDESNVFEDSANYF 433
                 I  +LK  E +LY       +  +D +  NEEE +D  +V ++  N F
Sbjct: 413 NFKFQKIEIELKDMEKKLY-------DTSSDEEILNEEEFLDNEDVLDNEENNF 459

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  204 bits (519), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/413 (31%), Positives = 230/413 (55%), Gaps = 29/413 (7%)

Query: 1   MFEIP-VNVNSKTLSNERKLRYRYINQFTRRFERKDDRNGMITPETSEDEL--------Q 51
           MFE+P ++   +++ N +KLRY+Y+N    R     +  G+ TP +SE+E+         
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNRYNKNGQGLPTPVSSENEMNASEDEVSH 60

Query: 52  QRKKRDWLHVIGEYGXXXXXXXXXXXXXXXXXXXXXXXXYNLNNEERKFFKKIDKPQETY 111
           +R ++ W  ++GE                               EE+K+F + DKP++++
Sbjct: 61  KRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEGD----------EEKKYFSRYDKPEDSF 110

Query: 112 EHWPSHRK-KTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKCKIDGMEIVE 170
           E W S+ K +  I R +++Y +YNK+++Y  +K+   L+  + K + +F   IDG E+++
Sbjct: 111 ERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYELID 170

Query: 171 PLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSVWNVGNRILY 230
                  NF +  ++ LT+L+Y ++ + NW+IAY+ F +LIR+PK  IR +WN+G+ I+ 
Sbjct: 171 DNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMIIE 230

Query: 231 EKDKL-RSLEFLEWMSSVYS--TRVTFIQGINYRFDPVFRSGSKNHTPKYTLQWLWNSLL 287
             + + +++EFL+  ++++S   +  F Q +NYR  PVF  GS+N TP Y    LW  + 
Sbjct: 231 NLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTLLWKEIT 290

Query: 288 EYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDTH-- 345
             +         N ++LI+ ++E+ LIPPFM+D EIW+IY + H+ +A+ LS   + +  
Sbjct: 291 TTSTS--SRTSSNYNELIEYLSELTLIPPFMEDSEIWYIYGIVHLQRANELSMNLEHYID 348

Query: 346 SVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRL 398
           +  S +DI+ N+V+Q+I   +++L   KE S  + E  E  IT  +K  E R+
Sbjct: 349 NSSSSKDIANNEVVQNIKLAQKFLKKAKELS--KIEVPERQITLMIKNIEGRM 399

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2.15
           YNL227C
          Length = 551

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 60/120 (50%), Gaps = 10/120 (8%)

Query: 340 SKFDTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLY 399
           S ++ HS+    DI M++V   + +++R L      ++      E    + L A EV LY
Sbjct: 425 STYNLHSIDV--DIDMDKVNAELAEIERQL------AEAGMTDEEESSDEDLHAREVPLY 476

Query: 400 KEPVFPLEPENDLDGDNEEE-VDESNVFEDSANYFEFDDT-QEQLNDLDTQQYFHDTDDS 457
                 +EPEN+ D   E E +D+SN  E+S    + D+  QE+LN+L      H +DDS
Sbjct: 477 DVTEHVVEPENNEDEQVEVEIIDDSNESEESFIDEDKDEQRQEELNELLAALQGHISDDS 536

>Ecym_2515 Chr2 (1003069..1007154) [4086 bp, 1361 aa] {ON} similar to
            Ashbya gossypii AGL226C
          Length = 1361

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 42/93 (45%), Gaps = 16/93 (17%)

Query: 338  LSSKFDTHSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVR 397
            +SS  D H   +M D S+  +++H           + +S+G+  S+  I  K+ K +E  
Sbjct: 1269 ISSFLDEHPSTTMNDFSLLGLVEH-----------QVQSEGEETSHFFIYNKETKEYECS 1317

Query: 398  LYKEPVFPLEPENDLDGDNEEEVDESNVFEDSA 430
            LY EP   L     ++  N E     + F D+A
Sbjct: 1318 LYVEPFQLL-----MNHQNREPSMNGHCFNDTA 1345

>KLLA0F02145g Chr6 complement(193239..195395) [2157 bp, 718 aa] {ON}
           some similarities with uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 718

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 20/113 (17%)

Query: 288 EYTEQLFE---NDDENIDKLIDKIAEMVLI--PPFMDDPEIWFIYSMCHMVKADFLSSKF 342
           +Y E  F+   +D   I  +I+++ +M+    P   ++ + + +  +C M+  D+LSS  
Sbjct: 278 KYFEDFFDRCMDDQMTIITIIEELGDMIYAYYPWRGEEYDNFVVRVICKMLDEDYLSSFI 337

Query: 343 DTHSVGS-------------MRDISMNQVIQHINDVKRYLNVCKEKSQGQYES 382
            T+S+ S             M  ++ N  I++I  V R+L  CK   +GQ+  
Sbjct: 338 STYSMSSESFDSNRKAIMKNMITLTFNADIKNIEKVDRWL--CKVSEEGQFSG 388

>KNAG0E03120 Chr5 (623076..626906) [3831 bp, 1276 aa] {ON} Anc_8.28
           YFL036W
          Length = 1276

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 208 AMLIRIPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPV 265
           A++    K D+  +W++    L   +K+R+L  L+ +  + S R  FI   N+ F+ V
Sbjct: 74  AVVSMTEKRDVMQLWSLLEACLQTNNKVRALSILKSLYEIKSHRAAFIDDYNFYFNAV 131

>TBLA0A05630 Chr1 complement(1398192..1401932) [3741 bp, 1246 aa]
           {ON} Anc_1.100 YNL257C
          Length = 1246

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 64/137 (46%), Gaps = 16/137 (11%)

Query: 285 SLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHMVKADFLSSKFDT 344
           SL E   QLFE     +   +D +A M ++   MD     F+  +  ++K+    +KFD 
Sbjct: 177 SLYEDATQLFEVRKSYLQASLDLVAAMSVMELSMDK----FLIEIIGVLKS---KNKFDV 229

Query: 345 HSVGSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVF 404
              G++ D++  Q+  ++ D ++++    E ++         +   ++  + R+ +  V 
Sbjct: 230 AENGTIIDLT-PQIDSYLVDHQKWVKKAIESART--------LESDMERAKARIIEYSVK 280

Query: 405 PLEPENDLDGDNEEEVD 421
            + P ND+   N +E+D
Sbjct: 281 KMAPSNDIKDYNTKEID 297

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,335,838
Number of extensions: 2523716
Number of successful extensions: 13780
Number of sequences better than 10.0: 112
Number of HSP's gapped: 14074
Number of HSP's successfully gapped: 125
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)