Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L004106.21ON33133115740.0
Kpol_1037.266.21ON3423419051e-121
SAKL0E01210g6.21ON3233309031e-121
KNAG0M011706.21ON3393368791e-117
TPHA0J003406.21ON3383388651e-115
NCAS0H008306.21ON3383398391e-111
YOR007C (SGT2)6.21ON3463388381e-111
Kwal_56.224336.21ON3223328301e-110
TDEL0G044806.21ON3433358311e-110
NDAI0D008106.21ON3493468291e-109
ZYRO0C07788g6.21ON3343228271e-109
Smik_15.1766.21ON3453368271e-109
TBLA0G010506.21ON3503288261e-109
CAGL0E02739g6.21ON3433228151e-107
Skud_15.1686.21ON3483387931e-104
Suva_15.1826.21ON3463357851e-102
Ecym_30256.21ON3183287811e-102
KLTH0C11220g6.21ON3273347811e-102
KLLA0D01155g6.21ON3353437631e-99
ACR005W6.21ON3273396692e-85
Kpol_1032.86.21ON3433355172e-62
NCAS0D026706.21ON3512463482e-37
TPHA0M002706.21ON3773493413e-36
NDAI0I022406.21ON3503713342e-35
TBLA0A072706.21ON3733402843e-28
AEL224W5.617ON5802361887e-15
NCAS0G008105.617ON5842341781e-13
KLLA0A07062g5.617ON5811001735e-13
SAKL0G07084g5.617ON5851231701e-12
CAGL0H08195g5.617ON5831011692e-12
NDAI0F009105.617ON5831041682e-12
Kpol_1018.695.617ON5901031683e-12
TPHA0D028805.617ON5851481673e-12
Kwal_55.199355.617ON5931001656e-12
TBLA0E033005.617ON5821021649e-12
KAFR0C058905.617ON5752381631e-11
Smik_15.2055.617ON5891031593e-11
TDEL0A048405.617ON5761001584e-11
YOR027W (STI1)5.617ON5891031585e-11
ZYRO0A05676g5.617ON5721001576e-11
Skud_15.1925.617ON5891041542e-10
KLTH0E02178g5.617ON5931001523e-10
Ecym_55825.617ON5841011513e-10
Suva_8.805.617ON5861031461e-09
NCAS0A00490singletonON620991329e-08
KNAG0B032005.617ON5791051311e-07
Skud_7.4323.481ON513881079e-05
CAGL0D05060g3.481ON510831042e-04
TDEL0D055003.481ON512871033e-04
NCAS0F034903.481ON5121091024e-04
YDR244W (PEX5)8.470ON612491024e-04
Ecym_44133.481ON5101271007e-04
KLLA0F24046g2.152ON60487980.001
Smik_4.4918.470ON61250980.001
Skud_4.5068.470ON61150970.002
Suva_2.4108.470ON61150970.002
TBLA0C039503.481ON512121970.002
NCAS0B025608.470ON57849950.003
NDAI0B057903.481ON52387950.003
YGR123C (PPT1)3.481ON51385950.003
NDAI0C051308.470ON59050950.003
Smik_6.2153.481ON51383930.005
KAFR0B066103.481ON511120920.006
SAKL0F03102g3.481ON51397890.016
AAR083C3.481ON53891890.017
KNAG0A041208.470ON60249880.023
Skud_8.1782.152ON638101870.025
AGL268C8.506ON379171870.026
Suva_7.4083.481ON51388870.028
SAKL0H10934g8.506ON38071860.028
NCAS0B024008.506ON38095860.032
Kpol_1031.648.470ON60749860.034
NCAS0G024802.152ON59694860.036
YHR117W (TOM71)2.152ON639101860.036
TBLA0D004607.412ON83587860.040
TPHA0D032203.481ON51388850.052
YBR155W (CNS1)8.506ON38592840.055
KAFR0E029808.506ON380137840.060
KLLA0C15455g8.470ON566102840.061
CAGL0K11209g8.470ON59049840.064
KLTH0F14542g3.481ON513120830.073
NCAS0B070102.152ON625107830.092
NCAS0E024907.412ON809131830.094
Kpol_1043.605.689ON70687830.094
KLLA0B10912g3.481ON512127820.12
NDAI0J001307.546ON140347820.13
NDAI0C052908.506ON37944800.15
CAGL0H07425g8.506ON380132800.16
TBLA0A016908.470ON66250810.16
Smik_2.2958.506ON38592800.17
TDEL0B016608.470ON54949800.17
KLTH0F18150g5.689ON689168800.21
Ecym_13968.470ON57349790.23
Suva_15.3142.152ON644101790.24
Kwal_27.117378.470ON57549790.26
SAKL0E14542g5.689ON69051790.28
KLTH0E10934g8.470ON56849780.31
Kwal_33.147672.152ON594125780.32
Skud_2.2828.506ON38541780.32
Kwal_55.211753.481ON511105780.33
TBLA0H015203.367ON68997780.33
NCAS0I008703.395ON58572780.33
Smik_8.1952.152ON635101780.38
Suva_4.4058.506ON38592770.41
TPHA0L012108.470ON58849770.46
KNAG0H006103.367ON973105770.47
KAFR0B002507.546ON142049770.47
Smik_2.2543.367ON1020103770.49
KLTH0B05170g2.152ON59382770.50
CAGL0C01903g7.412ON76995770.51
Kwal_23.54087.546ON141046770.53
SAKL0H11946g8.470ON57350760.61
Skud_2.2403.367ON984103760.62
Suva_4.3613.367ON963103760.62
Suva_2.347.412ON76395760.70
YBR112C (CYC8)3.367ON966103760.71
Suva_16.5217.546ON142446760.76
CAGL0I03718g7.322ON120165750.77
Smik_2.367.412ON75195750.82
YBL084C (CDC27)7.412ON75895750.91
AFR453W8.470ON56950740.95
Kpol_1006.43.367ON73297740.98
TDEL0H002507.546ON139749741.1
TDEL0C050903.367ON759110731.4
TPHA0E007407.412ON74687731.4
Kpol_1018.1067.412ON75387731.5
YPR189W (SKI3)7.546ON143245731.6
ZYRO0F08624g8.506ON37954721.7
ADR230W5.689ON68554721.7
Skud_16.4937.546ON142546721.8
ZYRO0B03828g7.412ON72787721.8
Smik_16.4537.546ON141745722.1
KNAG0F040107.546ON141846722.2
CAGL0D01364g3.367ON114846712.5
NCAS0A153007.546ON139846712.6
NDAI0C022805.219ON86291712.8
Kwal_23.36703.367ON802106703.0
TPHA0M016303.367ON104397703.2
KAFR0E028208.470ON56250703.5
TDEL0B051402.152ON599122703.6
TBLA0I007807.458ON300124693.8
SAKL0F16236g7.546ON140849704.0
KNAG0B022407.412ON73992694.2
ZYRO0B04224g3.481ON513115684.7
NDAI0B043402.152ON664118694.8
AGL294W7.412ON65687685.0
TBLA0A039508.324ON93693695.0
Kpol_1050.1127.546ON136089695.2
ZYRO0G06512g2.152ON60499685.6
TPHA0H004708.136ON81341685.6
TDEL0B023305.689ON702106685.7
ZYRO0C16522g3.367ON974103686.4
NCAS0A112003.367ON90797676.8
KLTH0F10428g3.367ON795103677.0
Kpol_172.23.367ON41846677.0
NDAI0A081703.395ON53966677.3
Ecym_10081.5ON111892678.0
ZYRO0A02926g8.470ON57748668.5
KAFR0J025706.328ON12195638.9
TPHA0G004305.689ON72846669.0
ZYRO0E04070g1.428ON416104669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00410
         (331 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   610   0.0  
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   353   e-121
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   352   e-121
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   343   e-117
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   337   e-115
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   327   e-111
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   327   e-111
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   324   e-110
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   324   e-110
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   323   e-109
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   323   e-109
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   323   e-109
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   322   e-109
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   318   e-107
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   310   e-104
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   306   e-102
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   305   e-102
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   305   e-102
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   298   1e-99
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   262   2e-85
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   203   2e-62
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   138   2e-37
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   135   3e-36
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   133   2e-35
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   114   3e-28
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    77   7e-15
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    73   1e-13
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    71   5e-13
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    70   1e-12
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    70   2e-12
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     69   2e-12
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    69   3e-12
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    69   3e-12
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    68   6e-12
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    68   9e-12
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    67   1e-11
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    66   3e-11
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    65   4e-11
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    65   5e-11
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    65   6e-11
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    64   2e-10
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    63   3e-10
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    63   3e-10
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    61   1e-09
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       55   9e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    55   1e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    46   9e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    45   2e-04
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    44   3e-04
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    44   4e-04
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    44   4e-04
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    43   7e-04
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    42   0.001
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    42   0.001
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    42   0.002
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    42   0.002
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    42   0.002
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    41   0.003
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    41   0.003
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    41   0.003
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    41   0.003
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    40   0.005
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    40   0.006
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    39   0.016
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    39   0.017
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    39   0.023
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    38   0.025
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.026
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    38   0.028
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    38   0.028
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    38   0.032
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    38   0.034
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    38   0.036
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    38   0.036
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    38   0.040
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    37   0.052
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    37   0.055
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    37   0.060
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    37   0.061
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    37   0.064
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    37   0.073
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    37   0.092
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    37   0.094
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    37   0.094
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    36   0.12 
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    36   0.13 
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    35   0.15 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    35   0.16 
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    36   0.16 
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.17 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    35   0.17 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    35   0.21 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    35   0.23 
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    35   0.24 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    35   0.26 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    35   0.28 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    35   0.31 
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    35   0.32 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.32 
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    35   0.33 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    35   0.33 
NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.3...    35   0.33 
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    35   0.38 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    34   0.41 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    34   0.46 
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    34   0.47 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    34   0.47 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    34   0.49 
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    34   0.50 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    34   0.51 
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    34   0.53 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   0.61 
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    34   0.62 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    34   0.62 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    34   0.70 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    34   0.71 
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    34   0.76 
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    33   0.77 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    33   0.82 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    33   0.91 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    33   0.95 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    33   0.98 
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    33   1.1  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    33   1.4  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    33   1.4  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    33   1.5  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    33   1.6  
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    32   1.7  
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    32   1.7  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    32   1.8  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    32   1.8  
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    32   2.1  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    32   2.2  
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    32   2.5  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            32   2.6  
NDAI0C02280 Chr3 complement(518725..521313) [2589 bp, 862 aa] {O...    32   2.8  
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    32   3.0  
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    32   3.2  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    32   3.5  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    32   3.6  
TBLA0I00780 Chr9 (143970..144872) [903 bp, 300 aa] {ON} Anc_7.45...    31   3.8  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    32   4.0  
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    31   4.2  
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    31   4.7  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    31   4.8  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    31   5.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    31   5.0  
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    31   5.2  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    31   5.6  
TPHA0H00470 Chr8 (91477..93918) [2442 bp, 813 aa] {ON} Anc_8.136...    31   5.6  
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    31   5.7  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    31   6.4  
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    30   6.8  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    30   7.0  
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    30   7.0  
NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa] ...    30   7.3  
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...    30   8.0  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    30   8.5  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    29   8.9  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    30   9.0  
ZYRO0E04070g Chr5 complement(306419..307669) [1251 bp, 416 aa] {...    30   9.0  

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/331 (92%), Positives = 307/331 (92%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120
           NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA
Sbjct: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120

Query: 121 KYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180
           KYSEAISISP             SSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL
Sbjct: 121 KYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180

Query: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240
           NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN
Sbjct: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240

Query: 241 AAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQ 300
           AAAGGFPDMSSM           PQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQ
Sbjct: 241 AAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQ 300

Query: 301 NGNTPDFSQLMNDPNIKDMAKNFFGGNNQQQ 331
           NGNTPDFSQLMNDPNIKDMAKNFFGGNNQQQ
Sbjct: 301 NGNTPDFSQLMNDPNIKDMAKNFFGGNNQQQ 331

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  353 bits (905), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/341 (57%), Positives = 237/341 (69%), Gaps = 15/341 (4%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M +SNK+I+ LI+D+L  V +KN+VSED  DSLNVA+DCI ++FEFERDS +G++KS F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  NLSLPELL-----EVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDF 115
             SL   L       A   +A E V VNV +D+ E  E     AE LKLEGNKAMA KD+
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASE----AAEALKLEGNKAMAGKDY 116

Query: 116 DLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGF 175
           +LAI KY+EAI+  P             SSLK +++A EDA SAI+++P YSKGYSRLGF
Sbjct: 117 ELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGF 176

Query: 176 AKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKK--ESTPKEES 233
           AK+A  K E+ALEAYKKVLD+EGDKATE+MKRDYETAKK+VEQSLNLEK         ES
Sbjct: 177 AKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAES 236

Query: 234 VTESAAN--AAAGGFPDMSSM-XXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNP 290
            + SAA+  A  GG PD SSM            PQLMQAAQQMM DP AM +++SMMQNP
Sbjct: 237 DSASAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNP 296

Query: 291 SIRQMAENFQNGN-TPDFSQLMNDPNIKDMAKNFFGGNNQQ 330
           S++QMA+ F +GN TPDFS LMNDP+I+DMAKN FG    Q
Sbjct: 297 SVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQ 337

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 233/330 (70%), Gaps = 10/330 (3%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNKEI+ LIVD+L    EKN VSED  DSLNVAIDCI+++FEFERD+ S ++K+ F 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  NLSLPELLEVAMEN--SAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118
           N  L ELL+ A     +  E V VN+P +    D  TK KAE LKL+GNKAMA KDF+ A
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAE----DANTKAKAEDLKLQGNKAMASKDFETA 116

Query: 119 IAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178
           I KY+EAI + P             SSLK +E++ +DAESAI+V+P+YSKGYSRLGFAKY
Sbjct: 117 IKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176

Query: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238
           AL KPEEALEAYK VLD+EGDKAT++MKRDYETAK++VEQSLNLEK   T  +E  + + 
Sbjct: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD 236

Query: 239 ANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298
           A A A GFPDM+S+           PQ+M AAQ++M +P AM +   MM+NP++RQMAEN
Sbjct: 237 AGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAEN 293

Query: 299 FQN-GNTPDFSQLMNDPNIKDMAKNFFGGN 327
           F + G TP+   LM++P IKDMAKN FG N
Sbjct: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLFGPN 323

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 232/336 (69%), Gaps = 21/336 (6%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNKE+S+LI+DYL KV  K +VS D  DSLNVAIDC+T+ F  E+D+ S  I+SKF 
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  NLSLPELLEVAMENSA------KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114
             SL ELL+ A +N+        E V +N+P++    D ETK KAE LKLEGNKA+A KD
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQE----DAETKAKAEALKLEGNKAVASKD 116

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174
           +DLA+ KY+EAI I P             ++ +++++A +DAE AI++DP YSKGYSRL 
Sbjct: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176

Query: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESV 234
           +AKY     EE+LEAYKKVL++EGD ATE+ KR YETAKKRVE+SLNLEK  S P     
Sbjct: 177 YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEK--SVP----- 229

Query: 235 TESAAN----AAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNP 290
           TESA      AA GGFPD SS+           PQ+MQAAQ MMS+P AM KIQSMMQNP
Sbjct: 230 TESAGGQTNPAAGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNP 289

Query: 291 SIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGG 326
           +I+QMAE F+ GNTPDFS++MN+P +++MA + F G
Sbjct: 290 AIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSG 325

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/338 (56%), Positives = 230/338 (68%), Gaps = 22/338 (6%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNKEI+ LIVDYL  V +K +VS D  DSLNVA+DCI ++FEFERDS    +KS F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120
              L   L      SA  ++ VN+  D    DEE K  AE LKLEGNKAMA KD++ AI 
Sbjct: 61  GNGLTSFLS----GSATNDIQVNIADDAA--DEEQKATAEGLKLEGNKAMATKDYESAIK 114

Query: 121 KYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180
           KYSEAI + P             SSLK ++ A  DAESAI+V+P YSKGYSRLGFAK+A 
Sbjct: 115 KYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQ 174

Query: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240
            K E+AL+AYKKVLD+EGDKAT+IMKRDYETAKK+VEQSLNLEK   TPK E+ TES A+
Sbjct: 175 GKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK--VTPK-EAETESNAD 231

Query: 241 --------AAAGGFPDMSSM----XXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQ 288
                      GGFPD+SSM               PQ+MQAAQQMM +PNAM +++SMMQ
Sbjct: 232 AGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQ 291

Query: 289 NPSIRQMAENFQNG-NTPDFSQLMNDPNIKDMAKNFFG 325
           NP++RQMAENF +G  TPD S +MN+P++KDMAKN FG
Sbjct: 292 NPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/339 (53%), Positives = 226/339 (66%), Gaps = 17/339 (5%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M LSNKE+ +LIVD+L  V +  ++SED  DSLNVAIDCIT+SFEFERD+ +  ++ KF 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  NLSLPELLEVAMENSA----KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFD 116
             +L E+L  A   S     +E+V VN+P +    D E K  AE  KLEGNKAMA KD+ 
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVE----DAEIKATAESFKLEGNKAMAAKDYR 116

Query: 117 LAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFA 176
           LAI KYSEAI   P             SS+K+++ A +DAE AI +DP YSKGYSRL FA
Sbjct: 117 LAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFA 176

Query: 177 KYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE--ESV 234
           KYALNKPEEALE YKKVLD+EGDKAT  MKRD+E AK RVE S+NLEK  +T  E   S 
Sbjct: 177 KYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSA 236

Query: 235 TESAANAAAG-GFPDMSSMXXXXXXXXXXX-----PQLMQAAQQMMSDPNAMSKIQSMMQ 288
            +  AN  AG G PDMSS+                PQ+MQAAQQMMSDPN+M K+Q MMQ
Sbjct: 237 GQQPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQ 296

Query: 289 NPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGGN 327
           NP++R+MA+N  +G+  +   LMN+P++KDMA N FG N
Sbjct: 297 NPNLREMAQNLASGDA-NLDDLMNNPSVKDMANNLFGPN 334

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  327 bits (838), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/338 (53%), Positives = 236/338 (69%), Gaps = 12/338 (3%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59
           M  S +EI+ LIV+Y   + EK ++SED  DSLNVA+DCI+++F FER++ SG++ KS+F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  YNLSLPELLEVAM---ENSAK---ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113
               L ++L  A    E++ K   ENV +N+P+D    D ETK KAE LK++GNKAMA K
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPED----DAETKAKAEDLKMQGNKAMANK 116

Query: 114 DFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173
           D++LAI KY+EAI + P             SSLK++++A +DAESAI +DP+Y +GYSRL
Sbjct: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176

Query: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK       ++
Sbjct: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDA 236

Query: 234 VTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIR 293
             +++  A+AGG PD+ S+           PQLMQAAQ+MMS+P AM  IQ MMQ+PSIR
Sbjct: 237 DVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIR 296

Query: 294 QMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGGNNQQ 330
           QMAE F   G TP+ S LMN+P +++MA N FGG   Q
Sbjct: 297 QMAEGFASGGGTPNLSDLMNNPALRNMAGNLFGGAGAQ 334

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 224/332 (67%), Gaps = 13/332 (3%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNK+++ LIVD+L    E  +VSED  DSLNVAIDCIT++FEF+R+S +  ++  F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  NLSLPELLEVAMENSA--KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118
             SL +++E A   S+  +E+V VN+P +    D ETK KAE LKLEGNKAMA KDF+ A
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVE----DAETKAKAESLKLEGNKAMAAKDFEQA 116

Query: 119 IAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178
           + KYSEAI + P             SSLK +E+A +DAE AI+V+P+YSKGYSRLGFA+Y
Sbjct: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176

Query: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238
           AL KPEEAL+AYKKVLD+EG+ AT+ MKRDY+TA K+V QSLN+EK       +    + 
Sbjct: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSAT 236

Query: 239 ANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298
            +      PD+SSM           PQLMQAAQQMM +PNAM   Q +M NP+++QMAE 
Sbjct: 237 GSGG---LPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAM---QEVMNNPAVKQMAEK 290

Query: 299 FQN-GNTPDFSQLMNDPNIKDMAKNFFGGNNQ 329
           FQ+ G TP  + LMN+P + DMAKN FGG  Q
Sbjct: 291 FQSGGGTPSMADLMNNPALMDMAKNMFGGGKQ 322

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 230/335 (68%), Gaps = 15/335 (4%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNKE+++LIVDYL ++ EK  VSE+  DSLNVAIDCI +SFE ++    G  K+ F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQK----GDSKAVFG 56

Query: 61  NLSLPELLEVAMENSAK------ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114
              L ELL+    +S++      E++ VN+P +    D ETK KAE LKLEGNKAMA KD
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAE----DAETKAKAETLKLEGNKAMACKD 112

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174
           FDLAI KYS+AI + P             SS+K +E+A +DAESAI+ DP YSKGYSRLG
Sbjct: 113 FDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLG 172

Query: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESV 234
           +AK+AL + E+ALEAYKKVLD+EGDKA+++MKRDYETAKK+VEQSL+LEKK  T    + 
Sbjct: 173 YAKFALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGAD 232

Query: 235 TESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQ 294
             +     +GGF D +SM           PQLMQAAQQMM +P AMS+++SMMQNP +RQ
Sbjct: 233 AGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQ 292

Query: 295 MAENFQNGNT-PDFSQLMNDPNIKDMAKNFFGGNN 328
           MAENF  GN  P+   LMN+P ++DMA + FGG N
Sbjct: 293 MAENFAQGNGMPNMGDLMNNPALRDMAGSLFGGAN 327

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  323 bits (829), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 230/346 (66%), Gaps = 25/346 (7%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M L+NK+I  LIVD+L  + EKN+VSED  DSLNVA+DCI+++ EF+R+     IK+KF 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  NLSLPELLEVAMENSA------KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114
             +L ++L      +A      +E+V VN+P +    D E K  AE  KLEGNKAMAMKD
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVE----DAEIKANAEAFKLEGNKAMAMKD 116

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174
           F LA+ KY+EAI I P             SSLK+FE+A +DAESAI++DP+YSKGYSRL 
Sbjct: 117 FHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLA 176

Query: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE--- 231
           FAKY L K EEALE+YKKVLD+EGD AT  MKRDYETAKKRVE+S+N+EK + TP++   
Sbjct: 177 FAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSK-TPEQGQG 235

Query: 232 -----ESVTESAANAAAGGFPDMSS-----MXXXXXXXXXXXPQLMQAAQQMMSDPNAMS 281
                ES   +A N  AGG PDMSS                 P  M  AQ++MSDPNAM 
Sbjct: 236 QQQTNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQ 295

Query: 282 KIQSMMQNPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGGN 327
           ++QSMM +PS+R +A NF+NGNT D + +MN+P I++MA N F GN
Sbjct: 296 QVQSMMSDPSMRDLANNFKNGNT-DMNDIMNNPAIRNMASNLFKGN 340

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 223/322 (69%), Gaps = 11/322 (3%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNK+IS+LIVDYL  V +K  VSED  DSLNVAI+CIT++F  E+ S+S    + F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSS----AAFG 56

Query: 61  NLSLPELLEVAME--NSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118
             +L ELL       +S  ENV VN+P +    D E K KAE LKLEGNKAMA KD++LA
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAE----DAELKSKAESLKLEGNKAMAGKDYELA 112

Query: 119 IAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178
           I KYSEAIS+ P             SSLK++++A +DAESA++VD +YSKGYSRLG+AK+
Sbjct: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172

Query: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238
           A  K EEALEAYKKVLD+EGD AT++MKRDYETAK++VEQ+L L K + T   +  T   
Sbjct: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232

Query: 239 ANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298
           A A  GG  D+SSM           PQ+MQAAQQMM +P AMS++++MMQNP++RQMAE 
Sbjct: 233 AGANPGGGFDLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEK 292

Query: 299 FQNGN-TPDFSQLMNDPNIKDM 319
           F  GN TP+ + +MN+P ++DM
Sbjct: 293 FAGGNGTPNLNDIMNNPALRDM 314

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 178/336 (52%), Positives = 232/336 (69%), Gaps = 16/336 (4%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59
           M  S +EI+ LIV+Y   + EK ++SED  DSLNVA+DCI+++F FERD+ SG++ KS+F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  YNLSLPELLEVAMENSAK------ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113
              SL ++L  A + S        +NV VN+P    E D ETK KAE LK++GNKAMA K
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIP----EEDAETKAKAEDLKMQGNKAMANK 116

Query: 114 DFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173
           D++LAI KY+EAI + P             SSL+++++A +DAES+I +DP+Y +GYSRL
Sbjct: 117 DYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRL 176

Query: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK  + P++  
Sbjct: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK--AVPEQSR 234

Query: 234 VTESAANAAAGG--FPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPS 291
             ++ A+  AG    PD+ S+           PQLMQAAQ+MMS+P AM  IQ MMQ+PS
Sbjct: 235 DADANASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPS 294

Query: 292 IRQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326
           IRQMAE F   G  P+ S LMN+P +++MA N FGG
Sbjct: 295 IRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 224/328 (68%), Gaps = 9/328 (2%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNK+I+ L+VD+L    EK  VS D  DSLNVAIDCIT++FEFE+D     + SKF 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  NLSLPELLEVAM----ENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFD 116
             SL ELL+ A      +S+ E++ V++   + E D+E   KAE LKLEGNKAMA KD++
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 117 LAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFA 176
           LA+ KY+ AI + P             SS + +++A +DAESAI+V+PN+SKGYSRLGFA
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 177 KYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTE 236
           K+A  K +EALEAYKK L+++GDKAT+IMKRDYETAKK+VEQSLN+EK  +     S + 
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASASA 240

Query: 237 SAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMA 296
           S     AGG PDM+SM           PQ+MQAAQQMMS+P AM +++SMMQNPSIRQMA
Sbjct: 241 S-----AGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMA 295

Query: 297 ENFQNGNTPDFSQLMNDPNIKDMAKNFF 324
           EN  +G++      MN+P I++MA N F
Sbjct: 296 ENLSSGSSEGMGDFMNNPAIREMASNLF 323

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 177/322 (54%), Positives = 217/322 (67%), Gaps = 6/322 (1%)

Query: 5   NKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNLSL 64
           +KE++ +I+ YL  V  +  V ED  DS+NVAIDCI +SFE ER     ++K    +  L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  PELLEVAMENSAK-ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYS 123
            E LE     + K E+V VN+P +    D ETK KAE LKLEGNKAMA KDF+LAIAKYS
Sbjct: 62  EECLECMKGGAVKSEDVKVNIPAE----DAETKAKAEALKLEGNKAMAGKDFELAIAKYS 117

Query: 124 EAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKP 183
           EAI + P             SSLK +++A  DAE AI +DP YSKGYSRLGFAKYA NKP
Sbjct: 118 EAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKP 177

Query: 184 EEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAA 243
           EEALEAYKKV+DLEGDKAT+IMKRDYETAKK+VEQSLNLEK       +S   + A A  
Sbjct: 178 EEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGG 237

Query: 244 GGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQNGN 303
            G  D SSM           PQ+MQAAQQMMS+P A+ ++QSMMQ+PSIRQMAE F +GN
Sbjct: 238 AGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGN 297

Query: 304 -TPDFSQLMNDPNIKDMAKNFF 324
            TP+   LM++P +++MA + F
Sbjct: 298 GTPNMDDLMSNPALRNMASSMF 319

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  310 bits (793), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/338 (50%), Positives = 222/338 (65%), Gaps = 18/338 (5%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIK-SKF 59
           M  S  EI++LIV+Y   + EK ++SED  DSLNVA+DCI+++F FER++   +++ S+F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  YNLSLPELLEVA--MENSAK----ENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113
              +L +LL     +  S K    +NV VN+P    E D E K KAE LK++GNKAMA K
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIP----EEDAEIKAKAEDLKMQGNKAMANK 116

Query: 114 DFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173
           D++LAI KY+EAI + P             SSLK +++A EDAESAI +DP Y +GYSRL
Sbjct: 117 DYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRL 176

Query: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEES 233
           GFAKYA  KPEEALEAYKKVLD+EGD ATE MKRDYE+AKK+VEQSLNLEK  + P++  
Sbjct: 177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK--TVPEQSR 234

Query: 234 VTESAANAAAGGFPDMSSMXXXXXXXXXXX----PQLMQAAQQMMSDPNAMSKIQSMMQN 289
             ++ A+A+ G                       PQLMQAAQ+MMS+P AM  IQ MMQ+
Sbjct: 235 DADANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQD 294

Query: 290 PSIRQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326
           P+I+QMAE F   G  P+ S LMN+P ++ MA N FGG
Sbjct: 295 PNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  306 bits (785), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 229/335 (68%), Gaps = 14/335 (4%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLI-KSKF 59
           M  S +EI++LIV+Y   + EK +VSED  DSLNVA+DCI+++F FERD+ S ++ KS F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  YN-------LSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAM 112
                     S  +L E   ++ A +NV VN+P    E D ETK KAE+LK++GNKAMA 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDA-QNVEVNIP----EEDAETKAKAEELKIQGNKAMAN 115

Query: 113 KDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSR 172
           K+++LAI KY+EAI + P             SSLK++++A +DAESAI VDP+Y +GYSR
Sbjct: 116 KEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSR 175

Query: 173 LGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEE 232
           LGFAKYA  KPEEALEAYKKVLD+EGD AT+ MKRDYE+AKKRVEQSLNLEK       +
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRD 235

Query: 233 SVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSI 292
           +   +   A AGG PD+ S+           PQLMQAAQ+MMS+P AM  IQ+MMQ+PSI
Sbjct: 236 AGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSI 295

Query: 293 RQMAENF-QNGNTPDFSQLMNDPNIKDMAKNFFGG 326
           RQMAE F   G TP+ S LM +P +++MA + FGG
Sbjct: 296 RQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/328 (51%), Positives = 222/328 (67%), Gaps = 15/328 (4%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           MP SNKEI+ LIV +L   T+  DV E+  DSLNVAIDCI ++FE ER+ ++ ++ SK Y
Sbjct: 1   MPGSNKEIAALIVQFLSTSTK--DVQEEYVDSLNVAIDCIAEAFEIEREDSNEIV-SKAY 57

Query: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKV--KAEKLKLEGNKAMAMKDFDLA 118
           N     L+++    +++  ++ + P     +    +V  +AE LKLEGNKA A KDF+ A
Sbjct: 58  NGR--GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGA 115

Query: 119 IAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178
           + KY+EAI + P             SS K FE+A  DAESA+R++P+YS+GYSRLG AKY
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

Query: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238
           AL KPEEA+EAYKKVLD+EGD ATE MKRDYE+AKK+VE+SLNL   E+ PK E   +++
Sbjct: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNL---EALPKGEE-QQTS 231

Query: 239 ANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAEN 298
             ++AGGFPD+SSM           PQ+MQAAQ+MM +P+AM   Q MM NP+I+QMA+N
Sbjct: 232 EGSSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMAQN 288

Query: 299 F-QNGNTPDFSQLMNDPNIKDMAKNFFG 325
           F   G TP+   +M DPNIKDMA  FFG
Sbjct: 289 FASGGGTPNLGDMMKDPNIKDMAGKFFG 316

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/334 (51%), Positives = 224/334 (67%), Gaps = 18/334 (5%)

Query: 4   SNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNLS 63
           + KE+++LI+DYL +  E  ++ ED  DSLNVAIDC+T++FE E++S S +I+  F   S
Sbjct: 4   TKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQS 63

Query: 64  LPELLEVAMEN---SAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120
           L +++  + +    + +E V VN+P +    D E K KAE LKLEGNKAMA KDF+ AI+
Sbjct: 64  LEQIVGASSKGPTATQQEPVKVNIPVE----DAEIKAKAEALKLEGNKAMATKDFEHAIS 119

Query: 121 KYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180
           KYSEAI   P             SSLK + +A EDAE+AI+V+P+YSKGYSRLGFA+YAL
Sbjct: 120 KYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYAL 179

Query: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240
            +PEEAL+AYKKVLD+EG  AT+ MKRDY+TA K+VEQSLN+E+  S P   S  ES   
Sbjct: 180 GRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVER--SAPA-ASNAESPDA 236

Query: 241 AAAGGFPDMSSMXXXXXXXXXXX----PQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMA 296
           A   GFPD++SM               PQ+MQAAQQMM +PNAM   Q MM NP+I+QMA
Sbjct: 237 AGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAM---QEMMSNPAIKQMA 293

Query: 297 ENFQ-NGNTPDFSQLMNDPNIKDMAKNFFGGNNQ 329
           + FQ  G TP  + LMN+P + DMAKN FGG  Q
Sbjct: 294 DKFQSGGGTPSMADLMNNPALMDMAKNMFGGPKQ 327

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  298 bits (763), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/343 (51%), Positives = 218/343 (63%), Gaps = 21/343 (6%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M LSNKEI+ LIVD+L   +    V+ED  DSLNVAIDCIT++F+FERD T  LI   F 
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSS--VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  NLSLPELLEVAMENSA--KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLA 118
              LPELL  A  +     E V V++P +    D   K KAE+LKL+GNKAMA K FD A
Sbjct: 59  GKKLPELLASAPSSGGVSGEPVKVHIPVE----DAAAKAKAEELKLQGNKAMAAKKFDEA 114

Query: 119 IAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178
           I KY+ AI +SP             SSLK +E+A +DAE AI VDP YSKG+SRLGFAKY
Sbjct: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174

Query: 179 ALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESA 238
           ALNKPEEAL+AYKKVLD+EG+KAT++MKRDYETAKK+VE S+NLEK  ++   E V++ +
Sbjct: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKS 234

Query: 239 ANAAA---------GGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQN 289
           A                                 PQ+MQAA++MM +P  M   Q MM N
Sbjct: 235 ATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLM---QDMMSN 291

Query: 290 PSIRQMAENFQNGNT-PDFSQLMNDPNIKDMAKNFFGGNNQQQ 331
           P+++QMA  F +G   PD SQ+MNDP+I+DMAKN FGG N  Q
Sbjct: 292 PAMKQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGGGNGSQ 334

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  262 bits (669), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/339 (45%), Positives = 206/339 (60%), Gaps = 28/339 (8%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  SNK+I+ LIVD+L   T    V ED +DSL VAIDCIT++FE        L+  K  
Sbjct: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120
             SL +LL   M +++        PK   E   E K +AE LKLEGN+AMA KD++ AI 
Sbjct: 59  GRSLSQLLTTGMAHTSD----AGEPKVAAE---ELKKEAEALKLEGNRAMAAKDYETAIQ 111

Query: 121 KYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180
           KY+ AI + P             SSL+ +EKA EDAE A +VD +YSKG+SRLG+AKYAL
Sbjct: 112 KYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYAL 171

Query: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240
            + EEALEAYK+VLD+EGD ATE M+RDYE+AK++VE+S+N+++       ES   +A +
Sbjct: 172 GRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVT--ESGDSAAGS 229

Query: 241 AAAGGFPDMSSMXXXXXXXXXXX-------------PQLMQAAQQMMSDPNAMSKIQSMM 287
           A   G PD++SM                        PQ+MQAAQ+MM +P+A   IQ MM
Sbjct: 230 AGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSA---IQEMM 286

Query: 288 QNPSIRQMAENFQNGN-TPDFSQLMNDPNIKDMAKNFFG 325
            NP+I++MAENF +GN +     LM DP +++MA  FFG
Sbjct: 287 SNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  203 bits (517), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 188/335 (56%), Gaps = 17/335 (5%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M L+NK+   LIV+YL K+ +  +VSED  +SLNVAIDCI+D FE +  S   +I   F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVF- 59

Query: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDE---ETKVKAEKLKLEGNKAMAMKDFDL 117
             +  +L  + ++    +NV+ +V + E++N+E   + K +AE LKLEGNK M++K++  
Sbjct: 60  --NKSDLKTITLKGLGLQNVS-DVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKS 116

Query: 118 AIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAK 177
           AI KYS+AI I P               ++DF  A  DA +AI++DP YSK YSRLG AK
Sbjct: 117 AIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAK 176

Query: 178 YALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKK---ESTPKEESV 234
            A    E+A+ A+KKVL+LEGDK+TE+MK DYE AKK V+  + L K     S P   + 
Sbjct: 177 LAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNT 236

Query: 235 TESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQ 294
           T+   + A        S+                       +P  M +++ +MQNP +RQ
Sbjct: 237 TDVLTDIATVLGSSFGSLMNNTQM------MQRAQQMMQTQNPEMMQQVEGLMQNPVVRQ 290

Query: 295 MAENFQNGNTP-DFSQLMNDPNIKDMAKNFFGGNN 328
            AEN  NGN P   S ++N+P++K++A     G N
Sbjct: 291 FAENVANGNGPGGLSDVLNNPSVKEVANGLMNGYN 325

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  138 bits (348), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 137/246 (55%), Gaps = 33/246 (13%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDST--SGLIKSK 58
           M LSNKEI++ IV YL  +     V+ED  +S++VAI+CI DSF+ + + +  S L    
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 59  FYNLSL---PELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDF 115
             NL+L   P+L       S KE   VN              +A KLKLEGNKA+  +++
Sbjct: 61  LANLNLEPEPKL-------SEKERELVNE-------------QAIKLKLEGNKAVERENY 100

Query: 116 DLAIAKYSEAISIS-----PXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGY 170
             AI KY+ AI +      P             +    +E+A +DA + I++DP +SKGY
Sbjct: 101 KDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGY 160

Query: 171 SRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQ---SLNLEKKES 227
           SRL  AK   NK E+A+ AYK+VLDLEG+KAT+ MKRD+E  K++ E    S +++   +
Sbjct: 161 SRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSA 220

Query: 228 TPKEES 233
           TP  E+
Sbjct: 221 TPISEA 226

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  135 bits (341), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 170/349 (48%), Gaps = 56/349 (16%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M  +++EI+++IVDY  K      +++D  DSLNVAIDCI D F+ ++D  S ++K+ + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  NLSLPELL---EVAMENSAKENVTVNV---PKD-----------------------ELEN 91
           +  L   L   + +  N  K+N T+NV    KD                       ++E 
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 92  DEETKV------KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS 145
            +ETKV      KAEKLK +GN+ M  K +  AI  YS+AI + P               
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 146 LKDFEKATEDAESAIRVD----PNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL----- 196
             +F+ A  DA  +I +D    P   K Y RLG AKY +   E +L A+K+++++     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 197 EGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAAGG------FPDMS 250
           +GD+ T+ M  DYE AK++V++   ++  +ST KE S      N+   G        D+ 
Sbjct: 241 KGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGS-----GNSVNDGPKRKVTLNDIL 295

Query: 251 SMXXXXXXXXXXXPQLMQAAQQMM-SDPNAMSKIQSMMQNPSIRQMAEN 298
           +M           P   +  +Q++ S+P A  +  ++M +P +RQM EN
Sbjct: 296 NMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKEN 344

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  133 bits (334), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/371 (28%), Positives = 172/371 (46%), Gaps = 66/371 (17%)

Query: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60
           M L+ ++ ++LI+ YL  +T  N + ED K+SL VAI CI +SF  + D           
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDI---------- 50

Query: 61  NLSLP-ELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAI 119
              LP  L E  ++   +EN+       ++ N+E     AE LK EGN+AM    ++ AI
Sbjct: 51  ---LPTSLKERTLKTILQENLNTLEATQKIHNEE-----AEALKKEGNEAMIEGQYEEAI 102

Query: 120 AKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYA 179
            KY+EAI  S              S L  +E A  DA  AI +DP++SK YSRLG+AK  
Sbjct: 103 KKYTEAIQFSKNVAYYSNRSLAY-SKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCC 161

Query: 180 LNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTE--- 236
            +K E+ + AYK+ +DLEG  A++ +  DYE A+ + EQ   L+K + + + +S+ E   
Sbjct: 162 QDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ---LKKNDDSEERKSIKEVTS 218

Query: 237 --------------SAAN-------------------AAAGGFPDMSSMXXXXXXXXXXX 263
                         +A N                   + A    +++ +           
Sbjct: 219 EECPEKNNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNN 278

Query: 264 PQLMQAAQQMMSD-PNAMSKIQSMMQNPSIRQMAENFQN----GNTPDFSQLMNDPNIKD 318
           PQL Q   Q ++D P+A  +++ ++ NP +R       N    G TP   +++    + +
Sbjct: 279 PQLKQMVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTP--QEMLQSGTVNN 336

Query: 319 MAKNFFGGNNQ 329
           + ++F  G  Q
Sbjct: 337 LIQSFLAGTQQ 347

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  114 bits (284), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 89/340 (26%), Positives = 153/340 (45%), Gaps = 37/340 (10%)

Query: 3   LSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNL 62
           +++K+++ LIV++L  V  K ++S+D  DSLNVAIDCI   +       S  +  KF   
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 63  SLPELLEVAMENSAKE-----------------NVTVNVPKDELENDEETKVK------- 98
            L  +L    +N+ K                  N +V   +  + ND   K+        
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 99  -----------AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLK 147
                      A+  K EGN+ M  +D+  AI  Y+ AIS  P               + 
Sbjct: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKR 207
           D+E A  DA   I +D N+SK Y RL   K   ++  +AL+ YKK ++L  D   E + R
Sbjct: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245

Query: 208 DYETAKKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLM 267
           ++E  K +V+  ++L ++ S     +     +  +    PD+ S+           P L 
Sbjct: 246 EFEDLKLKVQTDISL-REISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQ 304

Query: 268 QAAQQMM-SDPNAMSKIQSMMQNPSIRQMAENFQNGNTPD 306
           Q   +++ ++P+A   I  ++ NP+++ + +NF+NG+  D
Sbjct: 305 QMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFD 344

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 102/236 (43%), Gaps = 56/236 (23%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           AE+ K EGN A A KDF+ AI  + +AI +S               +S++ F +A  DA+
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQ 63

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD--KATEIMKRDYETAKKR 215
             +R+ P++SKG++RLG A Y L   +EA E+YKK L+L+     A + + +   T ++R
Sbjct: 64  ECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQR 123

Query: 216 VEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQMMS 275
           +EQ                            PD+                      QM  
Sbjct: 124 MEQ----------------------------PDLGF-------------------GQMFQ 136

Query: 276 DPNAMSKIQS------MMQNPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFG 325
           DPN + K+++      MM++P +      FQ+      ++LM DP +  +     G
Sbjct: 137 DPNLIQKLKNNPKTAEMMKDPQLVAKVLQFQSNPQAISTELMRDPRLMTVMAAILG 192

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +L+G +     D+  A+  Y+E I  +P             + L  F  A +D +
Sbjct: 387 KAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCD 446

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEI 204
            AI+ DPN+ + Y R   A+ A+ +   A+E     LD   +K  E+
Sbjct: 447 MAIQKDPNFVRAYIRKATAQIAVQEYAAAIE----TLDTAREKDAEV 489

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 96  KVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXSSLKDF 149
           + KAE+ K +GN+    + FD AIA Y +A      I+                S++K  
Sbjct: 251 RSKAEEAKAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTL 310

Query: 150 EKATEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL 194
           EKA E+    +R D    +K ++RLG A Y L   ++A+E Y+K L
Sbjct: 311 EKAVEEGRE-LRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 105/234 (44%), Gaps = 52/234 (22%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           A++LK +GN A A KDF  AI  ++EAI+ S               +SLK F++A  DA+
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQ 63

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVE 217
             ++++P++SKGY+R+G A   L   ++A   YKK L+L+ +          + A + +E
Sbjct: 64  QCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNN---------KAASEGLE 114

Query: 218 QSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ----- 272
           Q               V ES  +    G  +M S            P L++  +Q     
Sbjct: 115 QV------------HRVQESRKSRPDFGMTEMFS-----------DPNLIEKLRQNPKTK 151

Query: 273 -MMSDPNAMSKIQSMMQNPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFG 325
            MM+DP+ ++K+QS   NP           G + D   LM DP +  +     G
Sbjct: 152 DMMNDPSLVAKLQSYKSNPQ----------GLSSD---LMGDPRLMTIMATLLG 192

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 79/200 (39%), Gaps = 27/200 (13%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I  +P             + L  F +A +D E
Sbjct: 389 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCE 448

Query: 158 SAIRVDPNYSKGYSRLGFAKYALN---KPEEALEAYKKVLDL--EGDKATEIMKRDYETA 212
            AI  DPN+ + Y R   A+ A+    K  E LE  KK  D    G  + EIMK   +  
Sbjct: 449 KAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKAT 508

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R +     E  E T K                    +M           P +    QQ
Sbjct: 509 QERFQAPTGNETPEETYKR-------------------AMQDPEVAAIMQDPVMQSILQQ 549

Query: 273 MMSDPNAMSKIQSMMQNPSI 292
             +DP A   +Q  M+NP I
Sbjct: 550 AQNDPAA---LQEHMKNPEI 566

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 57/131 (43%), Gaps = 10/131 (7%)

Query: 105 EGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA----TEDAESAI 160
           EGNK      FD AIA+Y++A  +                   DFE A     E  E   
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEK-GDFETAMNTLNEAVEQGR 320

Query: 161 RVDPNY---SKGYSRLGFAKYALNKPEEALEAYKKVL--DLEGDKATEIMKRDYETAKKR 215
            +  +Y   +K ++R+G A       ++A+E Y+K L      D  T++   + E  K+ 
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQE 380

Query: 216 VEQSLNLEKKE 226
           +E+ +N EK E
Sbjct: 381 IEEYINPEKAE 391

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXX-XXXXXXXSSLKDFEKATEDAE 157
           A++ K EGN+A A KD+  AI  +++AI +S               +S KDF KA +DA 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDAN 62

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
             ++++P+++KGY+RLG A Y L   +EA ++YKK L+L+
Sbjct: 63  ECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 40/91 (43%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +L+G +     D+  A+  Y+E I  +P             S L  F  A  D +
Sbjct: 388 KAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCD 447

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALE 188
            AI  DPN+ + Y R    + A+     A+E
Sbjct: 448 KAIEKDPNFVRAYIRKATGQIAIKDYAGAIE 478

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 73  ENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------I 126
           E  A+  V    P+ E    ++ K KAE  K EGNK    + FD AI KY+EA      I
Sbjct: 229 EPKAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDI 288

Query: 127 SISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEE 185
           +                ++++   KA E     +R D    SK ++R+G + + L   ++
Sbjct: 289 TYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE-LRADYKVISKSFARMGNSYHKLGDLKK 347

Query: 186 ALEAYKKVL--DLEGDKATEIMKRDYETAKKRVEQSLNLEKKE 226
           A++ Y+K L      D  T++   + E  +K  E  ++ EK E
Sbjct: 348 AIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAE 390

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 71/123 (57%), Gaps = 3/123 (2%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           A++ K +GN A A KDF+ AI  +++AI +S               +S K F KA EDA+
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAK 62

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG--DKATEIMKRDYETAKKR 215
             + ++P +SKGY+R+G A + L   +EA + YKK L+L+     A + +++ ++T + R
Sbjct: 63  QCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSR 122

Query: 216 VEQ 218
            +Q
Sbjct: 123 QQQ 125

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 96/246 (39%), Gaps = 28/246 (11%)

Query: 59  FYNLSL-----PELLEVAMENSAKENVTVNVPKDELEN--DEETKVKAEKLKLEGNKAMA 111
           FY  SL     PE+L   + N  KE     + K E E   D E   KAE+ +L+G +   
Sbjct: 355 FYQKSLTEHRTPEIL-TKLRNCEKE-----LKKQETEAYIDPE---KAEEARLQGKEYFT 405

Query: 112 MKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYS 171
             D+  A+  Y+E I  +P             S L  F +A +D   AI  DPN+ + Y 
Sbjct: 406 KGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYI 465

Query: 172 RLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKE 231
           R   A+ A+ +    +E     LD    K ++I       A  R    L ++  +   + 
Sbjct: 466 RKATAQIAVREFVSVIE----TLDEARTKDSQINN----GANAREIDQLYIKASQQRFQP 517

Query: 232 ESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQ----AAQQMMSDPNAMSKIQSMM 287
           E V ES   A A    D                Q  Q    A Q+ M +P    KIQ+++
Sbjct: 518 EDVNESPEQAYARAMKDPEVANIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLI 577

Query: 288 QNPSIR 293
               IR
Sbjct: 578 AAGIIR 583

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 95  TKVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXSSLKD 148
           +K KA+  K EGNK    + FD AI  YS+A      I+                +++K 
Sbjct: 255 SKAKADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKT 314

Query: 149 FEKATEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL 194
             +A E     +R D    SK ++R+G + + LN+ ++A+E Y+K L
Sbjct: 315 LTEAVEQGRE-LRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXX-XXXXXXXXSSLKDFEKATEDAE 157
           A++ K +GN A   KD++ AI  +S+AI +S               +SLK F +A  DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAE 63

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
             ++++P +SKGY+RLG A   L   +EA  +YKK L+L+G
Sbjct: 64  ECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 61/138 (44%), Gaps = 18/138 (13%)

Query: 59  FYNLSL-----PELLEVAMENSAKENVTVNVPKDELE---NDEETKVKAEKLKLEGNKAM 110
           FY  SL     PE+L   + N+ KE     + K E E   N E    KAE+ +LEG    
Sbjct: 352 FYQKSLTEHRTPEIL-TKLRNTEKE-----LKKQEAEEYINPE----KAEEARLEGKDYF 401

Query: 111 AMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGY 170
              D+  A+  Y+E I  +P             S L  F +A ED   AI  DPN+ + Y
Sbjct: 402 TKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAY 461

Query: 171 SRLGFAKYALNKPEEALE 188
            R   A+ A+ +   A+E
Sbjct: 462 IRKATAQIAVKEFAAAIE 479

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 62/140 (44%), Gaps = 28/140 (20%)

Query: 105 EGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIR-VD 163
            GNKA   + FD AIA Y  A ++                S  +FEK   DAE+A++ +D
Sbjct: 262 LGNKAYKARQFDEAIAHYDAAWNLH------QDITYLNNRSAAEFEKG--DAETALKTLD 313

Query: 164 PNYSKG-------------YSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKR--- 207
               KG             ++R+G   +  N  ++A+E Y+K   L   +  EI+ +   
Sbjct: 314 EAVEKGREMRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQK--SLTEHRTPEILTKLRN 371

Query: 208 -DYETAKKRVEQSLNLEKKE 226
            + E  K+  E+ +N EK E
Sbjct: 372 TEKELKKQEAEEYINPEKAE 391

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   KDF+ AI  +++AI +SP              +S K F++A  D
Sbjct: 3   LTADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A   ++++P +SKGY+RLG A++ L   EEA + YK+ L L+ +
Sbjct: 63  ATECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  YSE I  +P             S L  F +A +D +
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCD 447

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE-----GDKATEIMKRDYETA 212
           +AI+ DPN+ + Y R   A+ A+ +   AL+  ++    +     G  + EIM+   +  
Sbjct: 448 NAIKKDPNFVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKAT 507

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R +     E  E T K                    +M           P +    QQ
Sbjct: 508 QERFQAPTGNETPEETYKR-------------------AMQDPEVAAIMQDPVMQSILQQ 548

Query: 273 MMSDPNAMSKIQSMMQNPSI 292
             ++P A+   Q  M+NP I
Sbjct: 549 AQTNPAAL---QEHMKNPEI 565

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 24/148 (16%)

Query: 95  TKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATE 154
           +K++A++ K+EGNK      FD AI +Y++A +++               S  +FEK   
Sbjct: 251 SKLEADEAKVEGNKLYKAHKFDEAIEQYNKAWALN------KDITYLNNRSAAEFEKG-- 302

Query: 155 DAESAI-------------RVDPN-YSKGYSRLGFAKYALNKPEEALEAYKKVL--DLEG 198
           D E+AI             R D    +K ++R+G A +     +++++ Y+K L      
Sbjct: 303 DFETAIATLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTA 362

Query: 199 DKATEIMKRDYETAKKRVEQSLNLEKKE 226
           D  T++   + E  K+  EQ ++ EK E
Sbjct: 363 DILTKLRNCEKELKKQEAEQYIDPEKAE 390

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 60/103 (58%), Gaps = 1/103 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   KD+D AI  +S+AI +S               +SLK F  A +D
Sbjct: 3   LSADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKD 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
           AE  ++++P++SKGY+R+G A + +   +EA   YKK L+L+ 
Sbjct: 63  AEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDA 105

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 4/109 (3%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG       D+  A+  Y+E I  +P             S L  F +A +D  
Sbjct: 396 KAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCN 455

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMK 206
            AI  DPN+ + Y R   A+ A+ +   ALE     LD    K  E+ K
Sbjct: 456 KAIEKDPNFVRAYIRKATAQIAVREFSSALE----TLDAARSKDAEVNK 500

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 106 GNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXSSLKDFEKATEDAESA 159
           GNK    + FD A+AKY+EA      I+                +S+K  E+A E     
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE- 328

Query: 160 IRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL 194
           +R D    +K ++R+G     LN  ++A++ YKK L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 14/148 (9%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A + K+++ A+  +S+AI +SP              +SLK F  A  D
Sbjct: 3   LSADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE-----GDKATEIMKRDYE 210
           A    +++P +SKGY+R+G A Y L   +EA ++YKK L+L+       +  E +KR  E
Sbjct: 63  ANECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKRTQE 122

Query: 211 TAKKRVEQSLN--------LEKKESTPK 230
             K + +  L         +EK +S PK
Sbjct: 123 ARKAQPDMGLTSMFNDPNLIEKLKSNPK 150

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +++G        +  A+  Y+E I+ +P             S L  F +A  D E
Sbjct: 391 KAEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCE 450

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEI 204
            A+  DPN+ K Y R   A+ A+ +   ALE     LD+   K TE+
Sbjct: 451 KALEKDPNFVKAYIRKATAQIAIKEYSSALE----TLDIARSKDTEL 493

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXX-XXXXXXXXSSLKDFEKATEDAE 157
           AE+ K +GN A   KDF+ A   +S+AI  S               +SLK F++A EDAE
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAE 62

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
             ++++P +SKGY+R+G A+Y L   ++A + YKK L+++
Sbjct: 63  ECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEID 102

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 108/247 (43%), Gaps = 30/247 (12%)

Query: 59  FYNLSL-----PELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMK 113
           FY  SL     PE+L   + N+ KE + +   K  ++ +     KAE+ +L+G +     
Sbjct: 363 FYQRSLTEHRTPEIL-TKLRNTEKE-LKLREAKSYIDPE-----KAEEARLQGKEFFTKG 415

Query: 114 DFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173
           D+  A++ Y+E I  +P             + L  F  A +D + AI  DPN+ + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 174 GFAKYALNKPEEALEAY--KKVLDLE---GDKATEIMKRDYETAKKRVEQSLNLEKKEST 228
             A+ A+ +   A+E     +  DLE   G  A EI +   + +++R +           
Sbjct: 476 ASAQIAVREFAPAMETLDAARAKDLEINKGANAREIEQLYVKASQQRFK----------- 524

Query: 229 PKEESVTESAANAAAGGFPDMSSMXX--XXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSM 286
           P++ + T   A A A   P+++++              Q   A Q+ M +P   SKIQ++
Sbjct: 525 PEDPNETPEQAYARALKDPEVAAIMQDPVMQSILSQAQQNPAALQEHMKNPAVFSKIQTL 584

Query: 287 MQNPSIR 293
           +    IR
Sbjct: 585 IAAGIIR 591

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 87  DELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSL 146
           DE E ++++K KA+  K EGNK    + FD AI  Y++A  +                  
Sbjct: 255 DEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEK- 313

Query: 147 KDFEKA----TEDAESAIRVDPNY---SKGYSRLGFAKYALNKPEEALEAYKKVL 194
            D+E+A    TE  +    +  +Y   SK ++R+G A   ++  ++A+E Y++ L
Sbjct: 314 GDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (58%), Gaps = 1/102 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   K++D AI K+++AI +S               +S K F K  ED
Sbjct: 3   LTAQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLED 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           A   ++++P +SKGY+R+G A + +   +EA +AYKK L+L+
Sbjct: 63  ANECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELD 104

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I+  P             S L  F +A  D  
Sbjct: 388 KAEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCN 447

Query: 158 SAIRVDPNYSKGYSRLGFAKYAL 180
           +AI  DPN+ + Y R   A+ A+
Sbjct: 448 TAIEKDPNFIRAYIRKATAQIAI 470

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 75  SAKENVTVNVPKDELENDE-ETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISI 128
           + K++ TV  PK+E    E E+K+ A+  K EGNK      FD AI  Y++A  +
Sbjct: 230 TPKKSETVPEPKEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWEL 284

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 103/238 (43%), Gaps = 50/238 (21%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISIS--PXXXXXXXXXXXXXSSLKDFEKATEDA 156
           A++ K EGN A   KD+  AI  +++AI +S  P             SS K +E+A  DA
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSS-KQYEQALSDA 63

Query: 157 ESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRV 216
           +  I+++P+++KGY+R G A   L+K EEA + Y + L ++ + A               
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNAI-------------- 109

Query: 217 EQSLNLEKKESTPKEESVTESAANAAAGGFP-DMSSMXXXXXXXXXXXPQLMQAAQQ--- 272
                   K+S  +  S  +SA+    GGFP DM              P LM+  ++   
Sbjct: 110 -------AKDSLAQIVSAQQSASRGFPGGFPGDMG------LGELFKDPNLMEKLRRDPK 156

Query: 273 ---MMSDPNAMSKIQSMMQNPSIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGGN 327
              +M+D + ++KI S   NP   Q   N           +M DP I  +     G N
Sbjct: 157 VAELMNDQDFVAKINSYGNNP---QALTN----------DMMTDPRIMQLFGALLGLN 201

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 80/200 (40%), Gaps = 31/200 (15%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I  +P             + L  F  A  D  
Sbjct: 384 KAEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCN 443

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL-----EGDKATEIMKRDYETA 212
            AI  DP++ + Y R    + A+ +   A+E     LDL     +G    EI +   + +
Sbjct: 444 KAIEKDPSFIRAYLRKATCQIAVKEFAGAIE----TLDLARERDDGKNGNEINQLYAKAS 499

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
            +R +           P E + T     A A   P+++ +           P ++   QQ
Sbjct: 500 AQRFQ-----------PAEGNETPEETYARAMKDPEVAKI--------MQDPVMVSILQQ 540

Query: 273 MMSDPNAMSKIQSMMQNPSI 292
             +DP A+   Q  M+NP +
Sbjct: 541 AQNDPAAL---QEHMKNPEV 557

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 8/106 (7%)

Query: 96  KVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXSSLKDF 149
           +++A+K K EGNKA   + FD AI+ Y++A      I+                + +K  
Sbjct: 248 RIEADKAKAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTL 307

Query: 150 EKATEDAESAIRVDPN-YSKGYSRLGFAKYALNKPEEALEAYKKVL 194
            +A E+A   +R D    +K ++R+G A   L+  ++A+E Y+K L
Sbjct: 308 TEAVENARE-LRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 57/103 (55%), Gaps = 1/103 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   KD+D AI  +++AI +S               +SLK F  A  D
Sbjct: 3   LNADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
           A+  I ++P++SKGY+RLG A   L   +EA   YKK L+L+ 
Sbjct: 63  AKECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDA 105

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 83/201 (41%), Gaps = 14/201 (6%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG       D+  A+  Y+E I  +P             + L  F +A  D  
Sbjct: 395 KAEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALE----AYKKVLDL-EGDKATEIMKRDYETA 212
            AI  DPN+ + Y R   A+ A+ +   ALE    A  K  D+  G  + EI +  Y+ +
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKAS 514

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R +     E  E T   +   +    AA    P M S+            Q   A Q+
Sbjct: 515 QQRFQPGTGNETPEET--YQRAMKDPEVAAIMQDPVMQSILQQAQ-------QNPAALQE 565

Query: 273 MMSDPNAMSKIQSMMQNPSIR 293
            M +P    KIQ+++    IR
Sbjct: 566 HMKNPEVFKKIQTLIAAGIIR 586

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 68/154 (44%), Gaps = 11/154 (7%)

Query: 83  NVPKDELENDEE-TKVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXX 135
           N   D +E DE+ +K +A+K K EGNK    + FD AI  Y++A      I+        
Sbjct: 245 NKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAA 304

Query: 136 XXXXXXXXSSLKDFEKATEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL 194
                   +++     A E     +R D    S+ ++R+G A + L   ++ +E Y+K L
Sbjct: 305 EYEKGEYKTAIATLNDAVEQGRE-MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

Query: 195 --DLEGDKATEIMKRDYETAKKRVEQSLNLEKKE 226
                 D  T++   + E  K   E  +N EK E
Sbjct: 364 TEHRTADILTKLRNAEKELKKAEAEAYINPEKAE 397

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           A++ K +GN A   KD++ A   + +AI +S               +SLK F +  +DAE
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAE 63

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
             ++++P +SKGY+R+G A++ LN  E+A ++Y+K L+L+
Sbjct: 64  ECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +  +  D+  A+  Y+E I  SP             + L  F +A  D +
Sbjct: 381 KAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCD 440

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALE 188
            AI  DPN+ + Y R   A+ A+ +   A+E
Sbjct: 441 RAIEKDPNFIRAYIRKASAQIAVKEFAAAVE 471

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 15/172 (8%)

Query: 65  PELLEVAMENSAKENVTVNVPKDELENDEET-KVKAEKLKLEGNKAMAMKDFDLAIAKYS 123
           P+  E   E   KEN   N P + +E DE+  +V AE+ K EGNK    + FD AI  Y+
Sbjct: 217 PKQAEAKTEEPLKEN---NEP-EPMEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYN 272

Query: 124 EAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAI------RVDPNY-SKGYSRLGFA 176
           +A  +                   D+E A     +A+      R D    +K ++R+G A
Sbjct: 273 KAWELHKDITYLNNRAAAEYEK-GDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNA 331

Query: 177 KYALNKPEEALEAYKKVL--DLEGDKATEIMKRDYETAKKRVEQSLNLEKKE 226
            + L   ++++  Y+K L      D   ++   + E  K+  E+ ++ EK E
Sbjct: 332 YHKLGDLKKSINFYQKSLTEHRSADVLNKLRNAEKELKKQEAEEYVDPEKAE 383

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 1/103 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   KD+D AI  +++AI +S               +SLK F  A  D
Sbjct: 3   LTADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
           A   ++++P++SKGY+RLG A   L   +EA   YKK L+L+ 
Sbjct: 63  ANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDA 105

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 14/201 (6%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I  +P             + L  F +A  D  
Sbjct: 395 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCN 454

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAY--KKVLDLE---GDKATEIMKRDYETA 212
            AI  DPN+ + Y R   A+ A+ +   ALE     +  D E   G  A EI +  Y+ +
Sbjct: 455 KAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKAS 514

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R +   + E  E T   +   +    AA    P M S+            Q   A Q+
Sbjct: 515 QQRFQPGTSNETPEET--YQRAMKDPEVAAIMQDPVMQSILQQAQ-------QNPAALQE 565

Query: 273 MMSDPNAMSKIQSMMQNPSIR 293
            M +P    KIQ+++    IR
Sbjct: 566 HMKNPEVFKKIQTLIAAGIIR 586

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 10/145 (6%)

Query: 91  NDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXS 144
           +++++K++A+K K EGNK    + FD AI  Y++A      I+                +
Sbjct: 254 DEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYET 313

Query: 145 SLKDFEKATEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL--DLEGDKA 201
           ++     A E     +R D    SK ++R+G A + L   ++ +E Y+K L      D  
Sbjct: 314 AISTLNDAVEQGRE-MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADIL 372

Query: 202 TEIMKRDYETAKKRVEQSLNLEKKE 226
           T++   + E  K   E  +N EK E
Sbjct: 373 TKLRNAEKELKKAEAEAYVNPEKAE 397

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 63/100 (63%), Gaps = 1/100 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           A++ K +GN A   KD+  AI  +++AI +S               +S K FE+A +DAE
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAE 62

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
             +++ P++SKGY+R+G A++ L++ +EA ++YK+ L+L+
Sbjct: 63  ECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELD 102

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +L+G +     D+  A+  Y+E +  +P             + L  F +A ED  
Sbjct: 379 KAEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCN 438

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALE 188
            A+ +DPN+ + Y R   A+ A+ +   A+E
Sbjct: 439 KAVSIDPNFVRAYIRKATAQIAVKEFAAAIE 469

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 85  PKDE---LENDEE--TKVKAEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXX 133
           PK E   +E DEE  ++V AE  K EGNK    + F+ AI  Y++A      I+      
Sbjct: 227 PKQEPEAMEVDEEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRS 286

Query: 134 XXXXXXXXXXSSLKDFEKATEDAESAIRVD-PNYSKGYSRLGFAKYALNKPEEALEAYKK 192
                     +++K    A E     +R D    +K ++R+G A Y L    +A+E Y +
Sbjct: 287 AAEFEKGDYDTAIKTLNDAVEQGRE-LRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNR 345

Query: 193 VL 194
            L
Sbjct: 346 SL 347

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXX-XXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   K++D AI  +++AI +S               +SLK F  A  D
Sbjct: 3   LTADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A   ++++P++SKGY+RLG A   L   +EA   YKK L+L+ +
Sbjct: 63  ANECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 17/219 (7%)

Query: 83  NVPKDELENDEETKV---KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXX 139
           NV K++ + + E  +   KAE+ +LEG +     D+  A+  Y+E I  +P         
Sbjct: 377 NVEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNR 436

Query: 140 XXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAY--KKVLDLE 197
               + L  F +A  D   AI  DPN+ + Y R+  A+ A+ +   ALE     +  D E
Sbjct: 437 AAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAALETLDVARTKDAE 496

Query: 198 ---GDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXX 254
              G  A EI +  Y+ +++R +     E  E T   +   +    AA    P M S+  
Sbjct: 497 VNKGASAKEIDQLYYKASQQRFQPDTGSETPEET--YQRAMKDPEVAAIMQDPVMQSILQ 554

Query: 255 XXXXXXXXXPQLMQAAQQMMSDPNAMSKIQSMMQNPSIR 293
                     Q   A Q+ M +P    KIQ+++    IR
Sbjct: 555 QAQ-------QNPAALQEHMKNPAVFKKIQTLIAAGIIR 586

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXX-SSLKDFEKATEDAE 157
           AE+ K +GN A   KD++ A   +++AI  S               +SLK F +A  DA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDAN 62

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
             ++++P +SKGY+R+G A + L K +EA + YKK L+++
Sbjct: 63  ECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 10/199 (5%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +L+G +     D+  A+  Y+E    +P             + L  F +A +D +
Sbjct: 400 KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCD 459

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVE 217
            AI  DPN+ + Y R   A+ A+ +   A+E     LD    K TE+   +     + ++
Sbjct: 460 MAISKDPNFIRAYIRKATAQIAVREFASAIE----TLDAARAKDTEL---NNGANVREID 512

Query: 218 Q-SLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXX--XXXXXXXXXPQLMQAAQQMM 274
           Q  +   ++   P++ + T   A A A   P+++S+              Q   A Q+ M
Sbjct: 513 QLYIKASQQRFQPQDPNETPEQAYARALKDPEVASIMQDPVMQSILSQAQQNPAALQEHM 572

Query: 275 SDPNAMSKIQSMMQNPSIR 293
            +P   +KIQ+++    IR
Sbjct: 573 KNPEVFNKIQTLIAAGIIR 591

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 87  DELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSL 146
           DE + ++++K  A+  K EGNK    + FD AI  Y++A  +                  
Sbjct: 255 DEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEK- 313

Query: 147 KDFEKA----TEDAESAIRVDPNY---SKGYSRLGFAKYALNKPEEALEAYKKVL 194
            D+E+A    TE  E    +  +Y   SK ++R+G A   L   ++A+E Y+K L
Sbjct: 314 GDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATEDAE 157
           AE+ K EGN A   KDF  A+  ++ AI  S               +SLK F++A  DA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDAT 63

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
             +++  ++SKG++RLG A + L   +EA E+YKK L+L+ 
Sbjct: 64  ECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDA 104

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAEK +L+G +     D+  A+  YSE I  +P             S L  F  A +D +
Sbjct: 391 KAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCD 450

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEI 204
            AI +DP++ + Y R   A+ A+ +   A+E     LD+   K  E+
Sbjct: 451 KAIEIDPSFVRAYIRKATAQIAVQEYSAAIE----TLDVARTKDAEV 493

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEA------ISISPXXXXXXXXXXXXXSSLKDFEKA 152
           AEK K EGN+    + FD AIAKY EA      I+                S++K   +A
Sbjct: 258 AEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEA 317

Query: 153 TEDAESAIRVDPNY-SKGYSRLGFAKYALNKPEEALEAYKKVL 194
            E     +R D    +K ++RLG A Y L++ ++A+E Y+K L
Sbjct: 318 VEQGRE-LRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPX-XXXXXXXXXXXXSSLKDFEKATED 155
           + A++ K +GN A   KD+  AI  +++AI +S               +SLK F  A  D
Sbjct: 3   LTADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALND 62

Query: 156 AESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
           A   ++++P++SKGY+RLG A   L   ++A   YKK L+L+ 
Sbjct: 63  ATECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDA 105

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 14/201 (6%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I  SP             + L  F +A  D  
Sbjct: 392 KAEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCN 451

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAY--KKVLDLE---GDKATEIMKRDYETA 212
            AI  DPN+ + Y R   A+ A+ +   ALE     +  D E   G  A EI +  Y+ +
Sbjct: 452 KAIEKDPNFVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKAS 511

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R +     +  E T   +   +    AA    P M S+            Q   A Q+
Sbjct: 512 QQRFQSGTGNDSPEET--YQRAMKDPEVAAIMQDPVMQSILQQAQ-------QNPAALQE 562

Query: 273 MMSDPNAMSKIQSMMQNPSIR 293
            M +P    KIQ+++ +  IR
Sbjct: 563 HMKNPEVYKKIQTLIASGIIR 583

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 91  NDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFE 150
           +++++KV+A+K K EGNK    + F+ AI  Y++A  +                   D+E
Sbjct: 251 DEDDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEK-GDYE 309

Query: 151 KA----TEDAESAIRVDPNY---SKGYSRLGFAKYALNKPEEALEAYKKVL--DLEGDKA 201
            A    T+  E    +  +Y   SK ++R+G A + L   ++ ++ Y+K L      D  
Sbjct: 310 TAIATLTDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSLTEHRTADIL 369

Query: 202 TEIMKRDYETAKKRVEQSLNLEKKE 226
           T++   + E  K   E  +N EK E
Sbjct: 370 TKLRNAEKELKKAEAEAYINPEKAE 394

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISI-SPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           +++LK  GNK    K ++ A+  ++ A+S  S                LK + +A ED +
Sbjct: 8   SQELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGK 67

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           + + + PN+ KGYSR+G A   L K +EA E +KK L L
Sbjct: 68  NCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           K E+ ++EG +    +++  A+  Y+E I  +P               L    +  +D +
Sbjct: 428 KFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCD 487

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAY 190
            AI VDP+Y K Y R GFA+      +EALE +
Sbjct: 488 KAISVDPSYIKAYVRKGFAQITERDLDEALETW 520

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 97  VKAEKLKLEGNKAMAMKDFDLAIAKYSEAISIS--PXXXXXXXXXXXXXSSLKDFEKATE 154
           + A++ K +GN A A K +D A+  +++AI +S  P             S  K F +A +
Sbjct: 3   LTADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQK-FNEALK 61

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           DA    +++P+++KGY+R G A + +   ++A  +YKK L+L+ +
Sbjct: 62  DALECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 76/200 (38%), Gaps = 27/200 (13%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KAE+ +LEG +     D+  A+  Y+E I  +P             S L  F  A  D  
Sbjct: 384 KAEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCN 443

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAY--KKVLDLE---GDKATEIMKRDYETA 212
            AI  DPN+ + Y R   A+ A+     A+E     +  D E   G  A EI +   + A
Sbjct: 444 KAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKAA 503

Query: 213 KKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXPQLMQAAQQ 272
           ++R + +   E  E T +                    +M           P L    QQ
Sbjct: 504 QQRFQPATGDETPEQTYER-------------------AMRDPEVAKIMQDPVLQSILQQ 544

Query: 273 MMSDPNAMSKIQSMMQNPSI 292
             +DP A+   Q  M+NP I
Sbjct: 545 AQNDPAAL---QEHMKNPEI 561

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 18/114 (15%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           +E+KV AE+ K+EGNKA   ++FD AIA Y++A  +                S  +FEK 
Sbjct: 245 DESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWELD------NNITYLNNRSAAEFEKG 298

Query: 153 TEDA---------ESAIRVDPNY---SKGYSRLGFAKYALNKPEEALEAYKKVL 194
             D          E    +  +Y   +K ++R+G A   +   +EA+  Y+K L
Sbjct: 299 EYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           E  +VKA + K EGN  +  K F  AI KY+EAI +                 + +F+ A
Sbjct: 6   EADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSA 65

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYAL 180
             D + AI++DP   K Y R   +  AL
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRALSCMAL 93

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA + K EGN  + ++D+  AI KY +AI +                 L +F+ A++D +
Sbjct: 8   KALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCD 67

Query: 158 SAIRVDPNYSKGYSRLGFAKYAL 180
            A+ +DP   K Y R G A   L
Sbjct: 68  KALALDPKNVKAYHRRGLACVGL 90

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%)

Query: 94  ETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKAT 153
           E   +A KLK EGN  +  +DF  AI  Y++AI +                 L +F+ + 
Sbjct: 7   EQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSL 66

Query: 154 EDAESAIRVDPNYSKGYSRLGFAKYAL 180
            D + A+++DP  +K Y R G +   L
Sbjct: 67  NDCDEALKLDPKNAKAYHRRGLSYIGL 93

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%)

Query: 94  ETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKAT 153
           + K +A   K EGN  +  +++  AI  YS+AI + P               L +F+   
Sbjct: 7   DAKEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCM 66

Query: 154 EDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKAT 202
            D + A+R+DP   K Y R G +   L + ++A    + VL  +   AT
Sbjct: 67  NDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           DF+K  +  ESA+RV+PN    ++RLG +    N+ EEA++AY + L L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 520

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 52/127 (40%), Gaps = 26/127 (20%)

Query: 105 EGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDP 164
           +GNK +A KD+  AI  Y++AI +                 L  F+ A ED+  AI +D 
Sbjct: 15  QGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDS 74

Query: 165 NYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEK 224
           +  KGY R G A   L                          +D+ +AK+ +E  L ++ 
Sbjct: 75  SNVKGYHRRGMAYAGL--------------------------QDFISAKRDLEVVLRVKP 108

Query: 225 KESTPKE 231
            E+T K 
Sbjct: 109 GEATAKR 115

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 86  KDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS 145
           KDE    E+    A  LK +GN+    KDF+ AI  Y+ AIS+                S
Sbjct: 92  KDEF-TPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVS 149

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSR 172
           + +FEK  ED  +A+++ P+YSK + R
Sbjct: 150 INNFEKVVEDTTAALKLKPDYSKCWLR 176

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           DF+K  +  ESA++V+PN    ++RLG +    N+ EEA++AY + L L+
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           DF+K  +  ESA++V+PN    ++RLG +    N+ EEA++AY + L L+
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           DF+K  +  ESA++V+PN    ++RLG +    N+ EEA++AY + L L+
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 2/121 (1%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA + K  GN A+  +D+  AI  Y+EAI +                 + +F+    D +
Sbjct: 11  KALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCD 70

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVE 217
            A+ +DP   K Y R G +   L + + A +  K VL  + + AT   KR  +  +K + 
Sbjct: 71  KALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDATA--KRGLDVCEKFIR 128

Query: 218 Q 218
           +
Sbjct: 129 E 129

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 33/49 (67%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           DF+K  E  + +++++PN    ++RLG +    NKPE+A++AY + L+L
Sbjct: 446 DFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%)

Query: 94  ETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKAT 153
           E   +A  LK EGNK +  K +  A+  Y++AI +                 L +F+   
Sbjct: 8   EAAQQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCL 67

Query: 154 EDAESAIRVDPNYSKGYSRLGFAKYAL 180
           +D  SA+ +DP   K Y R G ++  L
Sbjct: 68  DDCNSALELDPKNIKAYHRRGLSQLGL 94

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%)

Query: 96  KVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATED 155
           + KA + K EGN  +  K F  AI KY+EAI +                 + +F+ A  D
Sbjct: 9   RAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALND 68

Query: 156 AESAIRVDPNYSKGYSRLGFAKYAL 180
            + AI++DP   K Y R   +  AL
Sbjct: 69  CDEAIKLDPKNIKAYHRRALSCMAL 93

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 34/50 (68%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           DF+K  E  ++A++++PN    ++RLG +    N+ EEA++AY K ++L+
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLK 505

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA + K EGN  +  K F  AI KY+EAI +                 + +F+ A  D +
Sbjct: 11  KALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCD 70

Query: 158 SAIRVDPNYSKGYSRLGFAKYAL 180
            AI++DP   K Y R   +  AL
Sbjct: 71  EAIKLDPKNIKAYHRRALSCMAL 93

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A   K EGNK +  +DF  A   Y++AI   P               L +F  A  D  +
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQ 218
           AI ++ +  K Y R G A   L   + A   +  VL  + +    I K  ++T +K + +
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDI--IAKNGFDTCEKVIRE 126

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA + K +GN  +  K+F  A   YS+AI +                 L +F+ A  D  
Sbjct: 11  KALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCN 70

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
            AI +DP   K Y R G +   L +  +A +  K VL
Sbjct: 71  KAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 35/91 (38%)

Query: 90  ENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDF 149
             D  T   A   K EGN+ +  KD+  A+  Y+ AI                   L  F
Sbjct: 29  RRDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRF 88

Query: 150 EKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180
           + A ED+  AI +D    K Y R G A   L
Sbjct: 89  QSALEDSARAIELDAGNVKAYHRRGLAHCGL 119

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           DF K  +  ++A++V+PN    ++RLG A    N+ EE+++AY + L L
Sbjct: 461 DFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQL 509

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A +LK +GN     K+FD AI  Y  AI + P              S  D  K  E    
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 185 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 224

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 75/171 (43%), Gaps = 8/171 (4%)

Query: 75  SAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXX 134
           ++ ENV +   K  L  D E    AE  K +GN    +K F  A   Y++ I +      
Sbjct: 54  ASGENVELEALK-ALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAG 112

Query: 135 XXXXXXXXXSS----LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEA- 189
                    ++    LK++ +   D   A++++P   K + R+G A   L+K EEA EA 
Sbjct: 113 ISELLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEAV 172

Query: 190 -YKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLE-KKESTPKEESVTESA 238
            +   +D E +    ++    +  K R E    LE +++   +  S+ E+A
Sbjct: 173 DFGLRVDTENEALLSLLSAISKKQKARHEHEQKLESRRKEMERLASILEAA 223

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           E  +  A + K EGN  +  K F  AI KY++AI +                 + +F+ A
Sbjct: 6   EADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSA 65

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYAL 180
             D + A+++DP   K Y R   +  AL
Sbjct: 66  LNDCDEALKLDPKNIKAYHRRALSCMAL 93

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKAT--- 202
           LK+  +   D + A+R +P   K + R+G A ++LNK EEA EA +  L  + + A    
Sbjct: 131 LKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNAALGA 190

Query: 203 ---EIMKRDYE 210
              +I+K+D E
Sbjct: 191 LLDKIVKKDEE 201

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN    +K F  A   Y++ I I               ++    LK++     
Sbjct: 80  AENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIN 139

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEA 189
           D + A+ ++P   K Y R+G A Y LN  EEA E+
Sbjct: 140 DCKHALTLNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +F+K  +  ++A++V PN    ++RLG +    N+ EEA++AY K L+L
Sbjct: 465 EFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNL 513

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 88  ELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLK 147
           +L ND+  +  A  LK +GN     KDF+ AI  Y+ A+S+               SSL 
Sbjct: 84  DLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLK-EDPVYYSNISACYSSLL 142

Query: 148 DFEKATEDAESAIRVDPNYSK-------GYSRLG 174
           ++EK  E A  A+ + P+YSK        Y +LG
Sbjct: 143 NYEKVIEMATKALALRPDYSKVLVRRANAYEKLG 176

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A +LK  GN     K+F+ AI  Y  AI + P              S  D EK  E    
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 187 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 226

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 37/87 (42%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           GN    + D D AI    +A +I+P             +S+  F+ A      AI  DPN
Sbjct: 625 GNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNCYRKAIACDPN 684

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKK 192
           +   Y  LG     L + ++AL  ++K
Sbjct: 685 HYNAYYGLGTCCMRLGQYDQALLYFEK 711

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 10/136 (7%)

Query: 104 LEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVD 163
           LEG++  ++  FD A   Y +AI+  P               L  +++A    E A  ++
Sbjct: 657 LEGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMIN 716

Query: 164 PNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD---------KATEIMKRDYETAKK 214
           P+ +      G A   LN  E+AL  Y+   +L+ +         K    M R Y  A +
Sbjct: 717 PSNAILLCCCGSALEKLNFNEKALNYYELACNLQPNSSFAKFKLAKLLYSMSR-YNLALE 775

Query: 215 RVEQSLNLEKKESTPK 230
            +EQ + +  +E TP 
Sbjct: 776 ILEQVIEMAPEEVTPH 791

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           +E    A   K +GN+ +   D+D AI  YS+AI++                   +F  A
Sbjct: 6   QEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSA 65

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYAL 180
             D ++A+++DP   K Y R G +   +
Sbjct: 66  VVDCDNALKLDPKNIKAYHRRGLSYVGI 93

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN+    K F  A   YS+ +++               ++    LK++ +  E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEA 186
           D   A+ ++P   K Y R   A + LNK EEA
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 19/137 (13%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN    +K F  A   Y++ I +               ++    LK+F     
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEALE-------------AYKKVLDLEGDKA 201
           D ++A+  +P   K Y R+G A  A+NK E A E             +++ +L++  +K 
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFENLLNIIKNKE 197

Query: 202 TEIMKRDYETAKKRVEQ 218
            EI  R YE  K + +Q
Sbjct: 198 EEI--RKYEEKKLKAQQ 212

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 14/102 (13%)

Query: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMK 206
           ++F K  +   +A+ V+PN    ++RLG +    N+ EEA++AY K L L   K + +  
Sbjct: 430 EEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALAL---KPSFVRA 486

Query: 207 R-----------DYETAKKRVEQSLNLEKKESTPKEESVTES 237
           R            Y+ A + +  +L++ + E+ P   SV +S
Sbjct: 487 RYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQS 528

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +F++  +  ++A++V+PN    ++RLG +    N+ EEA++AY + L L
Sbjct: 439 EFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQL 487

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           EE   KA + K +GN  +  K +  A+  YS+AI +                 L +F  A
Sbjct: 6   EEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTA 65

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD-----KATEIMKR 207
            ED   +I +DP   K   R G +   L +  +A +  K +L ++ +     KA E+ +R
Sbjct: 66  LEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCER 125

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           EE K  + +LK +GNK    KD+  AI  Y+ A+ ++              S L   +K 
Sbjct: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPIFYSNISACYVS-LGQLDKV 174

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
            E +  A+ ++PNYSK   R   A  +L    +AL     VL L GD
Sbjct: 175 IESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGD 220

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 10/131 (7%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           G  +M + +++ A+  + +A SI+P               L + EKA    E A ++ P 
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKAT---------EIMKRDYETAKKRV 216
            S    +     Y++ K  +AL+A+++++ +  ++AT         +IM R  + A KR 
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQLYQIMGRK-KDAIKRY 783

Query: 217 EQSLNLEKKES 227
             ++NL+ K S
Sbjct: 784 TIAMNLDPKGS 794

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 12/87 (13%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG------- 198
           L++ +KA E +   I ++P   KGY R+G       K  EA + YKK L +         
Sbjct: 84  LQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLLMSREMLQKFD 143

Query: 199 ----DKATEIMKRDYETAKKRV-EQSL 220
               +K  +I+K+  +  KKR+  QSL
Sbjct: 144 IVVPEKFRDIIKQQRDIVKKRINNQSL 170

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 3/127 (2%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA +LK EGNK +  K +  A   Y++AI   P               L +F+ + +DA+
Sbjct: 12  KALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAK 71

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVE 217
            AI +D N  K Y R   +   L    E  +A K ++ +   K  E+  ++      +V 
Sbjct: 72  RAIELDNNNLKAYHRRAMSYIGL---LEFRKARKDLIIVLKFKPNELTAKNALAICDKVI 128

Query: 218 QSLNLEK 224
           Q  N EK
Sbjct: 129 QKENFEK 135

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEG 198
           + E  +SAIRVDPN  + +  LG A  A  + E +++ ++K ++L+G
Sbjct: 688 SIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDG 734

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEA 189
           LK+F +   D ++A++++P   K Y R+  A +AL+K EEA E+
Sbjct: 128 LKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 8/132 (6%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN    +K F  A   YS+ I +               ++    +K++ +   
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEA--YKKVLDLEGDKATEIMKRDYETA 212
           D + A++++P   K Y R+  A  AL + +EALE+  + + +D   +K+ + +K   ET 
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKID-NTNKSLKTLKLHIETK 199

Query: 213 KKRVE-QSLNLE 223
           +  +E + L LE
Sbjct: 200 QLEIEARRLKLE 211

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           D++K  +  ++A+ V+PN    ++RLG +    N+ EEA+ AY + L L+
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLK 557

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN+    K F  A   Y++ I++               ++    LK++ +  E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEA 186
           D   A+ ++P   K Y R   A ++L+K EEA
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +F+K  +  ++A+ V+PN    ++RLG +    N+ EEA++AY K L L
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQL 459

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 71/168 (42%), Gaps = 22/168 (13%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIM 205
           + D +KA +DA  A R +P   K Y R G     L    +ALE Y+     EG KA   M
Sbjct: 84  IGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----EGVKAIRDM 138

Query: 206 KRDYET-AKKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMXXXXXXXXXXXP 264
            R Y     K++ ++L  +K   + + +    S A+ +                     P
Sbjct: 139 TRKYHLDPPKKLYEALEYQKNLVSRRLKGPKTSVASKS--------------ERKRTLLP 184

Query: 265 QLMQAAQQMMS-DPNAMSKIQSMMQNPSIRQMAENFQNGNTPDFSQLM 311
           Q+MQ  ++ M+ D  A+  +  + Q P +  + +   N ++ D S+ +
Sbjct: 185 QVMQPTEKKMAVDTRAIPILDILGQCP-LEILKKILCNLDSTDLSRCL 231

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +F+K  +  ++A+ V PN    ++RLG +    N+ EEA++AY + + L
Sbjct: 436 EFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQL 484

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A +LK +GN     K F  AI  Y  AI + P              S  D +K  E    
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 191 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 230

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           D++K  +   +A+ V P+    ++RLG +    N+ EEA++AY+K L L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           L   +KA +DA++ IRV+P+  K Y R G     LNK +EA   Y + L +
Sbjct: 84  LGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGLKM 134

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           D++K  +   +A+ V P+    ++RLG +    N+ EEA++AY+K L L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (44%), Gaps = 5/125 (4%)

Query: 87  DELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSL 146
           DEL  +E+ K  A  LK +GN+    K F+ A+  YS AI +                SL
Sbjct: 85  DELSAEEKDKF-AMGLKDKGNEFFKNKQFEDALKYYSLAIEVK-EDPVFYSNRSACYVSL 142

Query: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEA---LEAYKKVLDLEGDKATE 203
              EK  ED  +A+++ P+YSK   R   A  +L K  +A   L A     D  G     
Sbjct: 143 GQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDFNGSSIEP 202

Query: 204 IMKRD 208
           +++R+
Sbjct: 203 LLERN 207

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEA 186
           LK++ +  ED   A+ ++P  +K Y R   A + LNK EEA
Sbjct: 134 LKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 6/105 (5%)

Query: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKA 152
           +E   +A + K +GN  +  K +  A+  YS+AI +                 L +F  A
Sbjct: 4   QEAAQQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTA 63

Query: 153 TEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
            ED + AI +DP   K   R G +   L      LE +K   DL 
Sbjct: 64  QEDCDKAIALDPKNIKAIHRRGLSYVGL------LEFFKARKDLR 102

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 4/97 (4%)

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIR--VDPNYSKGYSR 172
           F  A   Y  A++I P               L D +KA    + A+    DPN  K +  
Sbjct: 214 FHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHG 273

Query: 173 LGFAKYALNKPEEALEAYKKVLDLEGD--KATEIMKR 207
           +G         + A EA+KKVLDL+ +  KA EI  R
Sbjct: 274 IGILYDRYGSLDFAEEAFKKVLDLDPNFEKANEIYFR 310

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 55/132 (41%), Gaps = 5/132 (3%)

Query: 114 DFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSKGYSRL 173
           + D+A+    +++ + P              + KDF  A E  + A+  D      +  +
Sbjct: 395 NLDIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSI 454

Query: 174 GFAKYALNKPEEALEAYKKVLDLEGDKATEI---MKRDYETAKKRVEQSLN-LEKKESTP 229
           G   Y + +  +AL+AY + + L     +E+   +   YET   ++  +L+  E+  S  
Sbjct: 455 GVLYYQIGQNHDALDAYTRAIRL-NPYISEVWYNLGTLYETCNDQITDALDSYERALSLD 513

Query: 230 KEESVTESAANA 241
            E  V +   NA
Sbjct: 514 PENPVIQGRLNA 525

>NCAS0I00870 Chr9 (160192..161949) [1758 bp, 585 aa] {ON} Anc_3.395
           YPR088C
          Length = 585

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 24/72 (33%)

Query: 264 PQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENFQN------GNTPDFSQLM---NDP 314
           PQ+MQ AQQ +             QNP    M +N QN      G  PD +++M    DP
Sbjct: 528 PQMMQQAQQRLR------------QNPG---MMQNMQNMFGGAGGGMPDMNEMMKMMQDP 572

Query: 315 NIKDMAKNFFGG 326
           N++ MA+ F  G
Sbjct: 573 NMQKMAQQFGMG 584

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 1/101 (0%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A +LK +GN     K+F  AI  Y  AI + P              S  D  K  E    
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSS----LKDFEKATE 154
           AE  K +GN+    K F  A   Y++ +++               ++    LK++ K  E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVE 142

Query: 155 DAESAIRVDPNYSKGYSRLGFAKYALNKPEEA 186
           D   A+ ++P   K Y R+  + + L K EEA
Sbjct: 143 DCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +F+K  +  ++A+ + P     ++RLG +    ++PEEA++AY K L L
Sbjct: 446 EFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQL 494

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%)

Query: 90  ENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDF 149
           + D  T+  AE      + A  + D D A   Y   +  +P              S   F
Sbjct: 56  QQDPLTQSTAETWLSIASLAETVGDADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMF 115

Query: 150 EKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           ++A E  E A++V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 116 QRAAELYERALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 160

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 30/49 (61%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDK 200
           + E  +SA+RVDPN  + +  LG A +A  + E +++ ++K ++L  D 
Sbjct: 703 SIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDH 751

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 41/103 (39%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +P              S   F++
Sbjct: 41  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 100

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 101 AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 91  NDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFE 150
           +DE+    A  LK +GN+    K +D AI  YS AI +                SL   E
Sbjct: 87  SDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVK-EDPVFYSNRSACYVSLGQQE 145

Query: 151 KATEDAESAIRVDPNYSKGYSR 172
           K  ED  +A+++ P+YSK   R
Sbjct: 146 KVVEDTTAALKLKPDYSKCLLR 167

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 36/95 (37%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           K E     GN     KD + AI  + +A  I P             SS   F+ A +   
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFR 609

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKK 192
            AI  DP +   Y  +G     L   +EAL  ++K
Sbjct: 610 KAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEK 644

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 30/46 (65%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           + E  +SA+RVDP+  + +  LG A YA  + E +++ ++K L++E
Sbjct: 699 SIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVE 744

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +D++K  +  ++A+ V P+    ++RLG +    N+ EEA++AY + L L
Sbjct: 436 EDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQL 485

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 41/103 (39%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +P              S   F++
Sbjct: 33  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 92

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 93  AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 135

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 41/103 (39%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +P              S   F++
Sbjct: 43  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 102

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 103 AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 145

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 36/95 (37%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           K E     GN     KD D AI  + +A  + P             SS    + A     
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKK 192
            A+  DP +   Y  LG +   L + EEAL  ++K
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEK 638

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 41/103 (39%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +P              S   F++
Sbjct: 39  DPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQR 98

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 99  AAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 141

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 29/46 (63%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           + E  +SA+RVDPN  + +  LG A +A  + E +++ + K ++L+
Sbjct: 714 SIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQ 759

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] {ON}
            highly similar to uniprot|P53622 Saccharomyces cerevisiae
            YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 174  GFAKYALNKPEEALEAYKKV------LDLEGDKATEIMKRDYETAKKRV-EQSLNLEKKE 226
            GF  +  NK EEA+E +++V      L LE D   E+  +  ETAK+ +   S+ LE++ 
Sbjct: 997  GFKLFKANKLEEAIETFREVIYRVLFLTLEDDDEEELAHKALETAKEYILGLSIELERRS 1056

Query: 227  STPKE 231
              P++
Sbjct: 1057 LAPED 1061

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 36/95 (37%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           K E     GN     KD D AI  + +A  + P             SS    + A     
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKK 192
            A+  DP +   Y  LG +   L + EEAL  ++K
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEK 626

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 36/95 (37%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           K E     GN     KD D AI  + +A  + P             SS    + A     
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKK 192
            A+  DP +   Y  LG +   L + EEAL  ++K
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEK 633

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           +DF+K  +   +A+ V P+    ++RLG +    N+ EEA++AY + + L
Sbjct: 431 EDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQL 480

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIR--VDPNYSKGYSR 172
           FD A+  Y +A+++                 L + +KA    + A+    DPN  + +  
Sbjct: 85  FDKAVHYYEKAVALDSTLAEVWSLLGHSYLMLDELQKAYNAYQQALYHLADPNVPRLWHG 144

Query: 173 LGFAKYALNKPEEALEAYKKVLDLEG--DKATEIMKR 207
           +G         E A EA+ KVL+L+   DKA EI  R
Sbjct: 145 IGILYDRYGSLEYAEEAFAKVLELDPKFDKANEIYFR 181

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 36/86 (41%)

Query: 109 AMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPNYSK 168
           A  + D    I  Y   ++  P              S   F+KA    E A+ +D   ++
Sbjct: 45  AETLNDTTTLIRAYHSVLAHDPLSVTALVSLANFYRSTDAFDKAVHYYEKAVALDSTLAE 104

Query: 169 GYSRLGFAKYALNKPEEALEAYKKVL 194
            +S LG +   L++ ++A  AY++ L
Sbjct: 105 VWSLLGHSYLMLDELQKAYNAYQQAL 130

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDK 200
           + E  +SA+R+DP   + +  LG A YA  + E +++ +++ L+L+ + 
Sbjct: 685 SIEWFQSALRIDPKDVESWVGLGQAYYACGRIEASMKVFERALELDSEH 733

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 45/110 (40%)

Query: 85  PKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXS 144
           P+ + + D  T+  AE      + A  + D D A   Y   +  +               
Sbjct: 12  PEQDFQLDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNQASTKALTSLAHLYR 71

Query: 145 SLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           S   F+KA E  E A+ V+P  S  ++ LG     L+  ++A  AY++ L
Sbjct: 72  SRDMFQKAAELYEKALAVNPELSDVWATLGHCYLMLDDLQKAYNAYQQAL 121

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 33/87 (37%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           GN     K+   AI  + +A  + P             +S   F+ A      AI  DP 
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKK 192
           +   Y  LG     L + EEAL  ++K
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEK 621

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 35/87 (40%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           GN     KD + AI  + +A  + P             SS   F+ A      A+  DP 
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKK 192
           +   Y  LG +   L + +EAL  ++K
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEK 628

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           G   M +  +D A+  + +A SI+P               L+  EKA    E A  + P+
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKAT 202
            S    +     Y++ +   AL+ ++++  L  D+AT
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           + E  +SA+RVDPN  + +  LG A +A  + E +++ + K + L
Sbjct: 721 SIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQL 765

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           +K+F +     + A++ +P   K Y R+  A Y LNK +EA E+ K  L ++ +
Sbjct: 129 IKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSE 182

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199
           L   ++A  DA   I VD    KGY R G     L + EEAL+ Y+  L   G+
Sbjct: 83  LNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVYENGLKQAGE 136

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           + E  +SA+RVDPN  + +  LG A +A  + E +++ + K + L+
Sbjct: 714 SIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLK 759

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 33/87 (37%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           GN     +D D AI  + +A  + P             SS    + A      AI  DP 
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKK 192
           +   Y  LG     L + EEAL  ++K
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEK 602

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           + E  +SA+R+DPN  + +  LG A +A  + E +++ + K + L
Sbjct: 706 SIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQL 750

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           + E   SA+RVDPN  + +  LG A +A  + E + + ++K ++++
Sbjct: 704 SVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEID 749

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 149 FEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           F+KA E  E A++V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 98  FQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           + E  +SAIRVDPN  + +  LG A     + E +++ ++K ++L+
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELD 729

>NDAI0C02280 Chr3 complement(518725..521313) [2589 bp, 862 aa] {ON}
           Anc_5.219 YLR001C
          Length = 862

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 11/91 (12%)

Query: 35  VAIDCITDSFEFERDS-TSGLIKSKFYN-LSLPELLEVAMENSAKENVTVNVPKDELEND 92
           + ID I D  +F+ +    GL  SKF   +   +L  +  + S+ EN+T+ VP+  L ND
Sbjct: 317 IDIDAIVDVVQFDAEKYLHGLNNSKFVEEIYFRKLQHLIQDESSLENITIFVPEPSL-ND 375

Query: 93  EETKVKA--------EKLKLEGNKAMAMKDF 115
           +    K+        E+L LE N+A+A   F
Sbjct: 376 DIGFTKSTILYHFVKEQLWLEENEALATSAF 406

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 41/106 (38%)

Query: 89  LENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKD 148
           L  D  T+  AE      + A  + D D A   Y   +  +P              S   
Sbjct: 56  LAVDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDM 115

Query: 149 FEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           F++A E  + A+ V+P     ++ LG     L+  + A  AY++ L
Sbjct: 116 FQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQAL 161

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 4/97 (4%)

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRV--DPNYSKGYSR 172
           F  A   Y  A+S++P               L D ++A    + A+    +PN  K +  
Sbjct: 105 FQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNSYQQALYYLSNPNVPKLWHG 164

Query: 173 LGFAKYALNKPEEALEAYKKVLDLEG--DKATEIMKR 207
           +G         E A EA+ KVL+L+   DKA EI  R
Sbjct: 165 IGILYDRYGSLEYAEEAFAKVLELDPNFDKANEIYFR 201

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLE 197
           DF+K  E  ++A+  +P     ++RLG A    N+ E++++AY K + L+
Sbjct: 421 DFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLK 470

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 50/122 (40%), Gaps = 19/122 (15%)

Query: 89  LENDEET-----KVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXX 143
           LEN EE      +  A  LK  GN+    KD+D A+  Y+ A+ +               
Sbjct: 86  LENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVK-KDPVFYSNISACY 144

Query: 144 SSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYK------KVLDLE 197
            SL   +K  E++  A+ + P+YSK   R   A        E+LE Y        VL L 
Sbjct: 145 VSLGQLDKVVENSTKALELKPDYSKALLRRASAN-------ESLENYADAMFDLSVLSLN 197

Query: 198 GD 199
           GD
Sbjct: 198 GD 199

>TBLA0I00780 Chr9 (143970..144872) [903 bp, 300 aa] {ON} Anc_7.458
           YJR088C
          Length = 300

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (41%), Gaps = 26/124 (20%)

Query: 15  YLVKVT----EKNDVSEDVKDSLNVAIDCITDS----FEFERDSTSGLIKSKFYNLSLPE 66
           YL+KVT     KND          VAI+ I +S     EF+ D  S L+ SK        
Sbjct: 91  YLMKVTLLQINKND---------TVAINFINNSIDQVLEFDTDPYSYLLLSK-------- 133

Query: 67  LLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAI 126
              + M+N+ K N   +  +  +E  E+  +  E     G K   +  FD AI  + E +
Sbjct: 134 -RLITMQNNVKTNKPDDTLRHIMELIEKFPIDPELWWYAGEKYFELGLFDQAIYCFEELV 192

Query: 127 SISP 130
            + P
Sbjct: 193 VLMP 196

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDK 200
           + E  +SA+RVD N  + +  LG A YA  + E +++ ++K  +L  D 
Sbjct: 697 SIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDH 745

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 39/92 (42%)

Query: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAES 158
           A    L+G++  A + +D A   Y +AI+  P             S L  ++KA    E 
Sbjct: 555 AYAYTLQGHEHAANETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEK 614

Query: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAY 190
           A  ++P  +      G +   LN P++AL  Y
Sbjct: 615 ARVINPVNAILICCCGHSLEKLNLPDQALTYY 646

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 5/115 (4%)

Query: 98  KAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAE 157
           KA + K +GN  +  +DF  A   Y++AI +                   +F+ +  D +
Sbjct: 11  KALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCD 70

Query: 158 SAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL-----DLEGDKATEIMKR 207
            A+ +D    K Y R G +   L + ++A    K VL     D+  D+A +I ++
Sbjct: 71  KALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 89  LENDEETKVK-AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLK 147
           + N+E  K K A++LK +GN+    KD + AI  Y  A+ +                ++ 
Sbjct: 147 IANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD-QDPVFYSNISACYFAMN 205

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIM 205
             +K  E +  A+ + P+YSK   R   A  AL   +EAL  +  +L L G+ + + +
Sbjct: 206 QLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDF-SILSLFGEYSGQYL 262

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMK 206
           KD E A +  E A+R+D +    YS +    +A+N+ ++ +E+  K L+L+ D +  +++
Sbjct: 172 KDNENAIKYYEYALRLDQD-PVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLR 230

Query: 207 R 207
           R
Sbjct: 231 R 231

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%)

Query: 106 GNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIRVDPN 165
           GN     +D D AI    +A S++P             S+   F+ A      A+ ++PN
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 166 YSKGYSRLGFAKYALNKPEEALEAYKK 192
           +   +  LG +   L + +EAL  ++K
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEK 531

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 18  KVTEKNDVSEDVKDSLNVA-IDCITDSFEFERDSTSGLIKSKFYNLSLPELLEVAMENSA 76
           ++TEK    ED+K +++ + +  +   F+  R      IKS  + LSL   LEV +  ++
Sbjct: 298 RLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYK--IKSVAWTLSLSTKLEVVVTTNS 355

Query: 77  KENVTVNVPKDELENDEETKVKAEKLKLEGNKA 109
                 +VP ++ +    T +KA  ++L+G++ 
Sbjct: 356 NTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRT 388

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYET 211
           A E  +SA+R++PN  + +  LG +  +  + E ++  ++K  +L+ D     +   Y T
Sbjct: 687 AIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDH----LYAKYFT 742

Query: 212 AKKRVEQ-------SLNLEKKESTPKEES 233
           A+   E        S+  E    TPKEES
Sbjct: 743 AQSLSEMGEYVKSISIFEEIIMETPKEES 771

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 4/99 (4%)

Query: 102 LKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIR 161
           LK +GN+    KD+D A+  Y  A+++                S+   +K  E++  A+ 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYV-SMNQLDKVVENSTKALE 167

Query: 162 VDPNYSKGYSRLGFAKYAL-NKPEEALEAYKKVLDLEGD 199
           + P+YSK   R   A  +L N P+   +    VL L GD
Sbjct: 168 LKPDYSKALLRRASANESLENYPDAMFDL--SVLSLNGD 204

>TPHA0H00470 Chr8 (91477..93918) [2442 bp, 813 aa] {ON} Anc_8.136
           YGL178W
          Length = 813

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 30  KDSLNVAIDCITDSFEFERDSTSGLIKSKFYNLSLPELLEV 70
           KD + V ID I         + +GLIK KF N +L  LL+V
Sbjct: 495 KDLIQVCIDIILTIVNIFTRNLNGLIKDKFANYTLQTLLDV 535

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 46/106 (43%), Gaps = 24/106 (22%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLG--------------FAKYALNKPEEALEAYK 191
           L D +KA   A   + VDP   K Y RLG                K  L + +EA E+Y 
Sbjct: 86  LGDLKKALSYATKMVEVDPYNLKCYIRLGKILQKQVRDKQAYETYKLGLRRTKEAHESYS 145

Query: 192 KVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTES 237
             +     K  EI K+     K+R+  S+    KE++P   +VTES
Sbjct: 146 WEV---SQKLIEIAKQQKIAIKRRLGDSI----KENSP---AVTES 181

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 40/103 (38%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +               S   F++
Sbjct: 47  DPLTQATAETWLSLASLAETLGDADRAAMAYDATLQYNQASTKALTSLAHLYRSRDMFQR 106

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 107 AAELYERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 149

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 4/97 (4%)

Query: 115 FDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEKATEDAESAIR--VDPNYSKGYSR 172
           F  A   Y  A+SI+P               L D ++A    + A+    +PN  K +  
Sbjct: 106 FQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNSYQQALYHLSNPNVPKLWHG 165

Query: 173 LGFAKYALNKPEEALEAYKKVLDLEG--DKATEIMKR 207
           +G         + A EA+ KVL+L+   +KA EI  R
Sbjct: 166 IGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFR 202

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 40/103 (38%)

Query: 92  DEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPXXXXXXXXXXXXXSSLKDFEK 151
           D  T+  AE      + A  + D D A   Y   +  +P              S   F++
Sbjct: 55  DPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQR 114

Query: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           A E  + A+ ++P     ++ LG     L+  + A  AY++ L
Sbjct: 115 AAELYQRALSINPELGDIWATLGHCYLMLDDLQRAYAAYQQAL 157

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 149 FEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVL 194
           F++A E  E A+ V+P  S  ++ LG     L+  + A  AY++ L
Sbjct: 113 FQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 158

>NDAI0A08170 Chr1 complement(1870449..1872068) [1620 bp, 539 aa]
           {ON} Anc_3.395 YPR088C
          Length = 539

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 264 PQLMQAAQQMMS-DPNAMSKIQSMMQNPSIRQMAENFQNG-NTPDFSQLMNDPNIKDMAK 321
           PQLMQ AQQ +S +PN M  + +M                 +  +  ++M DP +++MAK
Sbjct: 473 PQLMQQAQQKLSQNPNLMKNMMNMFGGAGGMPGMGGAGGMPDMNEMMKMMQDPGMQEMAK 532

Query: 322 NF-FGG 326
            F  GG
Sbjct: 533 QFGMGG 538

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
           similar to Ashbya gossypii AFR745W
          Length = 1118

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 13/92 (14%)

Query: 3   LSNKEISTLIVDY-----LVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKS 57
           L + E+S   VDY      VK T  ND+S DV  + N   D +TD+F         + + 
Sbjct: 345 LDDFELSGQEVDYSSTATRVKETVSNDISSDVSSNTNAVYDNLTDNF-------GTITRD 397

Query: 58  KFYNLSLPELLEV-AMENSAKENVTVNVPKDE 88
            +   + P LL + +M+N+  +++ ++   DE
Sbjct: 398 AYAEEAKPPLLPLQSMKNTVGQDIILDSSSDE 429

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%)

Query: 149 FEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDL 196
           F+K  +  ++A+ V+ N    ++RLG +    ++ EEA++AY + L L
Sbjct: 442 FDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQL 489

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 148 DFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKR 207
           ++  A +  E  I ++P    GYS    A    NK +EA+   +       D    + K 
Sbjct: 18  NYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQ-------DGLKRVSKN 70

Query: 208 D--YETAKKRVEQSLNLEKK---ESTPKEESVTES 237
           D  +ET +K++E  L L +K   +  PKE ++ E+
Sbjct: 71  DATHETIQKKLEYRLELAEKALNKEVPKEVNLVEN 105

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 146 LKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYK 191
           L++ +KA++ ++  I VDP   KGY  +G      NK + A +AYK
Sbjct: 85  LQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>ZYRO0E04070g Chr5 complement(306419..307669) [1251 bp, 416 aa] {ON}
           highly similar to uniprot|P00560 Saccharomyces
           cerevisiae YCR012W PGK1 3-phosphoglycerate kinase
           catalyzes transfer of high-energy phosphoryl groups from
           the acyl phosphate of 1 3-bisphosphoglycerate to ADP to
           produce ATP key enzyme in glycolysis and gluconeogenesis
          Length = 416

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 3   LSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNL 62
           L N E   L +    KV +K  + +++ D +N+ I     SF F++   +  I    ++ 
Sbjct: 199 LENPERPFLAILGGAKVADKIQLIDNLLDKVNILIIGGGMSFTFKKVLDNTQIGDSIFDQ 258

Query: 63  SLPELLEVAMENSAKENVTVNVPKDELENDE-----ETKVKAEK 101
           +  EL+   +E + K NV + +P D +  D+      TKV +EK
Sbjct: 259 AGSELVPKLVEKAKKNNVEIVLPVDWVVGDKFGPDANTKVVSEK 302

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,935,591
Number of extensions: 1361282
Number of successful extensions: 7926
Number of sequences better than 10.0: 293
Number of HSP's gapped: 7962
Number of HSP's successfully gapped: 370
Length of query: 331
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 221
Effective length of database: 40,868,139
Effective search space: 9031858719
Effective search space used: 9031858719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)