Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L004006.20ON94294249000.0
Suva_13.1606.20ON10908498591e-98
Skud_13.1526.20ON10908458442e-96
Smik_13.1576.20ON10908468398e-96
YML002W6.20ON7377417986e-93
ZYRO0C07810g6.20ON10998508109e-92
TDEL0G044906.20ON10938717764e-87
Sklu_YGOB_Anc_6.20b6.20ON10888297183e-79
CAGL0L07634g6.20ON11308376992e-76
KNAG0M011606.20ON11319096718e-73
NCAS0H008206.20ON11467956312e-67
Kpol_1037.256.20ON11058146266e-67
Sklu_YGOB_Anc_6.20singletonOFF8496136142e-66
ACR006C6.20ON10718306043e-64
Ecym_30246.20ON10798405841e-61
TPHA0J003306.20ON11078445343e-55
Kwal_56.224246.20ON10898275253e-54
NDAI0D008006.20ON11938015202e-53
TBLA0A072606.20ON12048815202e-53
KLLA0D01133g6.20ON10677915068e-52
KLTH0C11242g6.20ON10977864693e-47
TDEL0A039205.528ON46651830.31
ADR020Cna 1ON60441762.3
ZYRO0A00506g8.876ON458170709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00400
         (942 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...  1892   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   335   1e-98
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   329   2e-96
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   327   8e-96
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   311   6e-93
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   316   9e-92
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   303   4e-87
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   281   3e-79
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   273   2e-76
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   263   8e-73
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   247   2e-67
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   245   6e-67
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   241   2e-66
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   237   3e-64
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   229   1e-61
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   210   3e-55
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   206   3e-54
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   204   2e-53
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   204   2e-53
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   199   8e-52
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   185   3e-47
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    37   0.31 
ADR020C Chr4 complement(740413..742227) [1815 bp, 604 aa] {ON} S...    34   2.3  
ZYRO0A00506g Chr1 complement(33846..35222) [1377 bp, 458 aa] {ON...    32   9.8  

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
           YML002W
          Length = 942

 Score = 1892 bits (4900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 933/942 (99%), Positives = 933/942 (99%)

Query: 1   MSQYESEIARYGPFQSIAAVFERLDSEKVTTKESFIVLISLESMGYNIFIKENDSTYRSV 60
           MSQYESEIARYGPFQSIAAVFERLDSEKVTTKESFIVLISLESMGYNIFIKENDSTYRSV
Sbjct: 1   MSQYESEIARYGPFQSIAAVFERLDSEKVTTKESFIVLISLESMGYNIFIKENDSTYRSV 60

Query: 61  DGKLQEVRVRHNLVKWKNQTFQINESDLLLLEDKRQCLVLWINDVKAADAIDTDGGKPSL 120
           DGKLQEVRVRHNLVKWKNQTFQINESDLLLLEDKRQCLVLWINDVKAADAIDTDGGKPSL
Sbjct: 61  DGKLQEVRVRHNLVKWKNQTFQINESDLLLLEDKRQCLVLWINDVKAADAIDTDGGKPSL 120

Query: 121 VGGLFHRHQSQDFSADMSGLINDWIRFVSDPQKSITDVVFGINNVIKSLPDENSVKIFEA 180
           VGGLFHRHQSQDFSADMSGLINDWIRFVSDPQKSITDVVFGINNVIKSLPDENSVKIFEA
Sbjct: 121 VGGLFHRHQSQDFSADMSGLINDWIRFVSDPQKSITDVVFGINNVIKSLPDENSVKIFEA 180

Query: 181 RLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDL 240
           RLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDL
Sbjct: 181 RLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDL 240

Query: 241 ACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEIDADNLLNFMLIIINRVKLNNLNE 300
           ACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEIDADNLLNFMLIIINRVKLNNLNE
Sbjct: 241 ACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEIDADNLLNFMLIIINRVKLNNLNE 300

Query: 301 HFHYLQNFNFKQNKDFGILNYAISTLGAVLYYIDNNLDKFKRYTDAIQDSKISEEKLKYR 360
           HFHYLQNFNFKQNKDFGILNYAISTLGAVLYYIDNNLDKFKRYTDAIQDSKISEEKLKYR
Sbjct: 301 HFHYLQNFNFKQNKDFGILNYAISTLGAVLYYIDNNLDKFKRYTDAIQDSKISEEKLKYR 360

Query: 361 NENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTT 420
           NENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTT
Sbjct: 361 NENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTT 420

Query: 421 AASXXXXXXXXXGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTG 480
           AAS         GTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTG
Sbjct: 421 AASILINIIINNGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTG 480

Query: 481 QTPLFNIFRSYDQSIKSYKKMSRRSFRFAMDSGDFQLKKHIDNSNNTLLHILKTNIQMIL 540
           QTPLFNIFRSYDQSIKSYKKMSRRSFRFAMDSGDFQLKKHIDNSNNTLLHILKTNIQMIL
Sbjct: 481 QTPLFNIFRSYDQSIKSYKKMSRRSFRFAMDSGDFQLKKHIDNSNNTLLHILKTNIQMIL 540

Query: 541 PHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSL 600
           PHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSL
Sbjct: 541 PHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSL 600

Query: 601 TNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIR 660
           TNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIR
Sbjct: 601 TNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIR 660

Query: 661 FNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNVILDTIL 720
           FNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNVILDTIL
Sbjct: 661 FNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNVILDTIL 720

Query: 721 FLELVPREGFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKN 780
           FLELVPREGFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKN
Sbjct: 721 FLELVPREGFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKN 780

Query: 781 GVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILENSID 840
           GVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILENSID
Sbjct: 781 GVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILENSID 840

Query: 841 NTLHFLKVFQNEKIRKWWKLNNELINLTKLASNSDDDLLRSFFNRKEKLSIEIDDKIRSI 900
           NTLHFLKVFQNEKIRKWWKLNNELINLTKLASNSDDDLLRSFFNRKEKLSIEIDDKIRSI
Sbjct: 841 NTLHFLKVFQNEKIRKWWKLNNELINLTKLASNSDDDLLRSFFNRKEKLSIEIDDKIRSI 900

Query: 901 NELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWAHRNCL 942
           NELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWAHRNCL
Sbjct: 901 NELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWAHRNCL 942

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  335 bits (859), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 276/849 (32%), Positives = 428/849 (50%), Gaps = 112/849 (13%)

Query: 178  FEARLYSSIWNKL-VHQTSEPQNIDKFYGC-YISFHELNINDYYSLPFNKFSLRDVVFIE 235
            FE  LY  IW++L +H      N +    C Y S ++L + DYYS  F  F L D+ FIE
Sbjct: 260  FELNLYEDIWSRLTIHFKGYEVNTE---NCEYFSVNQL-LTDYYSKDFESFKLSDITFIE 315

Query: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILT------SKLPQLE-------IDADNL 282
              V +A K F KL  S S+ EK  IL+ T   L+      S  P L        +DAD L
Sbjct: 316  RRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDLSNGFNNLTMDADTL 375

Query: 283  LNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDNN----- 336
            ++  ++++ R +  ++  H +YLQNF+   +   FGIL YAISTL AV+ Y +N      
Sbjct: 376  ISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAISTLEAVVCYFENFNKNNN 435

Query: 337  ---------------LDKF--KRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDT 379
                           LDK   +  T+ + D    ++ L YRNE G+S L  CI    ND 
Sbjct: 436  NVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQGQSILSLCITNNKNDI 495

Query: 380  LRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIR 439
            L ++L  SEY   FP+EDIL+D+TIDGSTLL+ ++K  N  A            T +E+ 
Sbjct: 496  LLDVL--SEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIRIMLFNCTDEELV 553

Query: 440  TYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYK 499
            TYVN  D+  R+V H++T++  +L  IG Y+NW  K+  +GQTPLF+IFRSYDQ   +Y+
Sbjct: 554  TYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS-SGQTPLFSIFRSYDQP--NYE 610

Query: 500  KMSRRSFRFAMD-----SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLG 554
            +M + +F  A       +  F    H DN  N+LLH+LKT++ ++L    L IN  N  G
Sbjct: 611  EMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTKLNINGENYKG 670

Query: 555  MTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFA 614
            +TPLMV+ KY+RL NI  +     KD   I E  Q ++ +  CF    D  +L+ +G+  
Sbjct: 671  LTPLMVYVKYKRLSNIDAIT----KDHRLILEKVQ-NSTFFTCFDYAKDRLVLSKIGERG 725

Query: 615  IKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVL 674
              N SIFG  + HSL+       H      +V    K E+ + T   N+KTI+ L+  ++
Sbjct: 726  -ANDSIFGLIYLHSLRY------HNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIV 778

Query: 675  TSNSHVSSFLPLYKVFNELNGIASMISTKSKIL-------FINNLNVILDTILFLELVPR 727
              N    +FLP   + N ++GI+ +  +   I+        ++ L    + +LFL+ VP+
Sbjct: 779  KDNPF--TFLP---IDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833

Query: 728  EGFILEARLKDYLR--NQRKIKTVATK--SKKLQIEDINMISNFLKFNLNELNAFKNGVK 783
              F  EA +  ++R    R+ +   +K   K ++ E+INMI +FL+FN +E+ +FK  + 
Sbjct: 834  NLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLN 893

Query: 784  KILRQMNSINLKLFDQRISYMDLLHCPDVVVH-----------LNNPLW-NLNYNILISN 831
             + + +  ++LK  D   +Y  LL     V +            N+ ++ +L+ + L+ +
Sbjct: 894  ILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEH 953

Query: 832  FQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTK--------------LASNSDDD 877
             Q LE       + ++    ++I  WWK   E + L K               A  S   
Sbjct: 954  VQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHI 1013

Query: 878  LLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITR 931
             L  F   K     ++LS++I    + + EL  +IF +HE LA E++N+M+F K     R
Sbjct: 1014 PLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQR 1073

Query: 932  TLVVWAHRN 940
            T+V +A +N
Sbjct: 1074 TIVAFAIKN 1082

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  329 bits (844), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 266/845 (31%), Positives = 432/845 (51%), Gaps = 104/845 (12%)

Query: 178  FEARLYSSIWNKLV-HQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIEN 236
            FE  LY  IW++LV H      + +K+   Y S ++L + D++S  F +F L D+ FIE 
Sbjct: 260  FELNLYDDIWSRLVTHFKGYEVDTEKYK--YFSVNQL-LADFFSKDFKEFKLSDITFIER 316

Query: 237  VVDLACKEFVKLRESLSFDEKIDILLSTFNILTS---------KLP----QLEIDADNLL 283
             V++A K F KL  + S+ EK  IL+ T   L+          +LP     L +DAD LL
Sbjct: 317  RVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNGLNSLTMDADTLL 376

Query: 284  NFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTLGAVLYYID----NN-- 336
            +  ++++ R +  +L  H +YLQNF N   +  FGIL YAISTL AV+ Y +    NN  
Sbjct: 377  SLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNEN 436

Query: 337  --------------LDKF--KRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTL 380
                          LDK   +  T+ I++    E+ L+YRNE G+S L  CI    N  L
Sbjct: 437  LAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQGQSILSICITNTKNCIL 496

Query: 381  RELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRT 440
             ++L  +EY   FPMEDIL+D+T+DGSTLL+ ++K  N  AA           +  E+ +
Sbjct: 497  LDVL--TEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVS 554

Query: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500
            YVN  D+  R V H++T++  +L  IG Y++W  K+  +GQTPLF+IFR+YDQ   +Y++
Sbjct: 555  YVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNS-SGQTPLFSIFRTYDQP--NYEE 611

Query: 501  MSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGM 555
            M + +F  A       +  F    H D+  N+LLHILK+++ ++L  + L IN  N  G+
Sbjct: 612  MVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSKLDINGRNYKGL 671

Query: 556  TPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAI 615
            TPLM++ KY+R+ NI  +     KD   I E  Q ++ +  CF    D  +L+ +G+   
Sbjct: 672  TPLMIYVKYKRISNIDAIT----KDSRLILEKVQ-NSTFFTCFDYAKDHSVLSKIGERGA 726

Query: 616  KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLT 675
            ++ S+FG  + HSL+       H      ++      +K + T   N+KTI+ L+  +L 
Sbjct: 727  RD-SLFGLVYLHSLRY------HNLNATTNITTASNTDKPFLTTVINMKTIQGLLRSILK 779

Query: 676  SNSHVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVILDTILFLELVPREGFI 731
             N    +FLPL    +E++ +     ++I        ++ L    + +LFL+ VP+  F 
Sbjct: 780  DNQF--TFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFT 837

Query: 732  LEARLKDYLR---NQRKIKTVATKSKK-LQIEDINMISNFLKFNLNELNAFKNGVKKILR 787
             EA +  ++R   ++R  K  +  + K ++ E+INMI +FL+FN +E+++FK  +  + +
Sbjct: 838  DEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK 897

Query: 788  QMNSINLKLFDQRISYMDLL---------HCPDVVVHL---NNPLWNLNYNILISNFQIL 835
             +  ++LK  D   +Y  L             D    +   +N   +L    L+ +   L
Sbjct: 898  ILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFL 957

Query: 836  ENSIDNTLHFLKVFQNEKIRKWWKLNNELINL-------------TKLASNSDDDL-LRS 881
            E        F++    +KI KWWK   E + L              K A+++   + L S
Sbjct: 958  EQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGS 1017

Query: 882  FFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITRTLVV 935
            F   K     ++L+++I    + + EL  +IF +HE LA E++N+M+F K     RT+V 
Sbjct: 1018 FIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVA 1077

Query: 936  WAHRN 940
            +A  N
Sbjct: 1078 FATTN 1082

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  327 bits (839), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 268/846 (31%), Positives = 430/846 (50%), Gaps = 106/846 (12%)

Query: 178  FEARLYSSIWNKLV-HQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIEN 236
            FE  LY  IW++L  H  S     +++   Y S + L + D+YS  F +F L+DV FIE 
Sbjct: 260  FELNLYDDIWSRLTSHFKSYEVGTEEYK--YFSINHL-LADFYSKDFREFKLQDVTFIEK 316

Query: 237  VVDLACKEFVKLRESLSFDEKIDILLSTFNILTS-------------KLPQLEIDADNLL 283
             V LA K F KL  + S+ EK  IL+ T   L+              +L  L +DAD L+
Sbjct: 317  RVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLI 376

Query: 284  NFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDNN------ 336
            +  +++I R +  +L  H +YLQNF+   +   FGIL YA+STL AV+ Y ++       
Sbjct: 377  SLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAVVCYFEDFKKNSDN 436

Query: 337  -------LDKFKR---------YTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTL 380
                   L K KR          T+ +++    ++ L YRN  G+S L  CI    N  L
Sbjct: 437  MAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSILSICISNNKNHIL 496

Query: 381  RELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRT 440
             ++L  SEY   FP+ED+L+D+TIDGSTLL+ ++K  N  AA           T +E+ +
Sbjct: 497  LDIL--SEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEELIS 554

Query: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500
            Y+N  D+ +R V H++T++  +L  IG Y++W  K+   GQTPLF+IFRSYDQ   +Y+ 
Sbjct: 555  YINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNS-GGQTPLFSIFRSYDQP--NYEA 611

Query: 501  MSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGM 555
            M + +F  A       +  F  + H DN  N LLH+LKT+  ++L    L IN  N  G+
Sbjct: 612  MVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGL 671

Query: 556  TPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAI 615
            TPLMV+ KY+RL NI+ ++    KD+  + E  Q  + +  CF    D  +L+ +G+   
Sbjct: 672  TPLMVYVKYKRLNNIEAII----KDQRLVLEKIQ-KSTFFTCFDYAKDHTVLSKVGERGA 726

Query: 616  KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLT 675
            K+ S+FG  + HSL+       H      ++      EK +     N+KTI+ L+  +L 
Sbjct: 727  KD-SLFGLIYFHSLRY------HNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILK 779

Query: 676  SNSHVSSFLPLYKVFNELNGIA----SMISTKSKILFINNLNVILDTILFLELVPREGFI 731
             N    +FLPL    +E++ ++    ++I     +  ++ L+   + +LFL+ VP+  F 
Sbjct: 780  DNPF--TFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFT 837

Query: 732  LEARLKDYLR---NQRKIKTVATKS-KKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787
             EA +  ++R   ++R  K  + ++ K ++ E+INMI +FL+FN +E+++FK  +  ILR
Sbjct: 838  DEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASL-SILR 896

Query: 788  QM-----------NSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNI--LISNFQI 834
            ++             +N  L +   S  +         +L N     +Y++  L+ + + 
Sbjct: 897  KILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRF 956

Query: 835  LENSIDNTLHFLKVFQNEKIRKWWKLNNELINL-----------TKLASNSDDD---LLR 880
            LE       + +++   EKI  WWK   ELI L            K  S +D      L 
Sbjct: 957  LEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLG 1016

Query: 881  SFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITRTLV 934
             F   K     ++L+++I    +S+ EL  +IFV+HE LA E++N+M+F K     R +V
Sbjct: 1017 GFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIV 1076

Query: 935  VWAHRN 940
             +A  N
Sbjct: 1077 AFAATN 1082

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
           protein of unknown function; expression induced by heat
           and by calcium shortage
          Length = 737

 Score =  311 bits (798), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 240/741 (32%), Positives = 382/741 (51%), Gaps = 87/741 (11%)

Query: 268 LTSKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTL 326
           L   L  + +DAD L++  ++++ R +  +L  H +YLQNF N   +  FGIL YA+STL
Sbjct: 8   LPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTL 67

Query: 327 GAVLYYID--------------------NNLDKF--KRYTDAIQDSKISEEKLKYRNENG 364
            AV+ Y +                    N LDK   +  T+ ++D    ++ L YRNE G
Sbjct: 68  EAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQG 127

Query: 365 ESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASX 424
           +S L  CI    N  L ++L  SEY  +FP+ED+L+D+TIDGSTLL+ ++K  N  AA  
Sbjct: 128 QSILSICITNHKNYILLDIL--SEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKV 185

Query: 425 XXXXXXXXGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPL 484
                    T +E+ +Y+N  D+  R V H++T++  +L  IG Y++W  K+  +GQTPL
Sbjct: 186 LIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNS-SGQTPL 244

Query: 485 FNIFRSYDQSIKSYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMI 539
           F+IFRSYDQ   +Y++M + +F  A       +  F    H DN  N+LLH+LKTNI ++
Sbjct: 245 FSIFRSYDQP--NYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPIL 302

Query: 540 LPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFS 599
           L    L IN  N  G+TPLMV+ KY+RL NI  +     KDR  I E  Q ++ +  CF 
Sbjct: 303 LQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAIT----KDRRLILEKVQ-NSTFFTCFD 357

Query: 600 LTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTI 659
              D  +L+ +G+  +K+ S+FG  + HSL+   + + +   N  SV      EK + T 
Sbjct: 358 YAKDHSVLSKIGERGVKD-SLFGLIYFHSLR---YHNLNATTNITSVS---NAEKPFATT 410

Query: 660 RFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVI 715
             N+KTI+ L+  +L  N    +FLPL    +E++ +     ++I        ++ L   
Sbjct: 411 VINMKTIQGLLRSILKDNPF--TFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNC 468

Query: 716 LDTILFLELVPREGFILEARLKDYLR---NQRKIKTVATKSKK-LQIEDINMISNFLKFN 771
            + +LFL+ +P   F  EA +  ++R   ++R  K    ++ K ++ E+INMI +FL+FN
Sbjct: 469 FNVLLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFN 528

Query: 772 LNELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHL------------NNP 819
            +E+++FK  +  + + +  INLK  D   +Y  L      +++             +N 
Sbjct: 529 FDEISSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNM 588

Query: 820 LWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELI-----------NLT 868
              L+   L+ N + LE        F+++   EKI  WWK   E +           N+ 
Sbjct: 589 FSELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMV 648

Query: 869 KLASNSDDD---LLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINN 920
           K  S SD      L  F   K     ++L+++I    + + EL  +IFV+HE LA E++N
Sbjct: 649 KPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSN 708

Query: 921 FMKF-KPLFITRTLVVWAHRN 940
           +M+F K     R+LV +A  N
Sbjct: 709 YMEFRKACLDQRSLVAFATTN 729

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  316 bits (810), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 260/850 (30%), Positives = 414/850 (48%), Gaps = 130/850 (15%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238
            E  L+  +W ++V+   + + ID     ++S +EL   + Y   + KF L+DV  +E  +
Sbjct: 263  ELNLFDDVWIRIVNSYRKDE-IDTEPLKFLSINELE-TELYQKKYEKFRLQDVTTMEKNI 320

Query: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQ--------LEIDADNLLNFMLIII 290
            DLA   FV L  + +  EK D L++T   L++   Q        + +DAD L++F ++++
Sbjct: 321  DLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQDMDIQTLPITMDADTLISFFVLVV 380

Query: 291  NRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN--NLDKFKRYTD-- 345
             R ++ N+  H  YL+ F+  +N   FGIL YAISTL AV++Y D      K ++  D  
Sbjct: 381  CRTQVKNIKSHLFYLKKFSKDENSIKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDS 440

Query: 346  -----------------AIQDSKISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSE 388
                             A+ D       L++R   GES L  CII   N  L ELL + E
Sbjct: 441  NKAKELYILISDKSTGQAVLDISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYE 500

Query: 389  YIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDEN 448
             I  FP+EDILDD+T+DGSTLL+ A+KC N+ AA           T  E+R YVN  D+N
Sbjct: 501  DI--FPLEDILDDETVDGSTLLIQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKN 558

Query: 449  NRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRF 508
             R V H++T++  +L  IG Y+NW  +D   G TPLF IFR YDQ  ++Y+ M   +FR 
Sbjct: 559  RRTVAHYLTHEMNILESIGKYINWKSQDS-NGHTPLFTIFRCYDQ--QNYEAMISAAFRS 615

Query: 509  AM-----DSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCK 563
            A+     +  DFQ   H DN  NTLLHI+K N+ ++L + ++ IN  N  G+TPLM++ +
Sbjct: 616  AVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSILLDYDNVDINCTNKKGLTPLMIYTR 675

Query: 564  YRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGN 623
            Y R  N++ ++    +D+  I +  Q H ++ N F    +  +L  L   AIK  + F  
Sbjct: 676  YNRFDNVKTII----RDQRIILDKLQ-HPSFLNSFDYARNPLVLKELVSQAIKT-TAFEL 729

Query: 624  CFTHSLKQ-----FLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS 678
             F H LK      F H          +VKI    +++YKT++ +IKT++ L  ++L    
Sbjct: 730  AFVHHLKYEAPSWFFH---------ITVKIGAGADEEYKTVKLHIKTLQNLFQVLL--KM 778

Query: 679  HVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVILDTIL----FLELVPREGF 730
            H +SFLPL K   +L+ +       I+    + F   L    D +L      +LV RE  
Sbjct: 779  HFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNKLVLRE-- 836

Query: 731  ILEARLKDYLRNQRKI---KTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787
               +RL  ++R+Q K         K K ++ E+I ++++FL+FN  EL+A K      L+
Sbjct: 837  ---SRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVK------LK 887

Query: 788  QMNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNI-------------------- 827
             M ++   L   ++   DL H    +      L+   YN+                    
Sbjct: 888  LM-TMKKLLIFLKLKNTDLTHSYQFL-----SLFGTEYNLAQDRLLFKDLEINCCAFGEE 941

Query: 828  ----LISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLTKL---------ASNS 874
                 +     LEN     L  ++   +  I +WWKL  +++ + K+          ++S
Sbjct: 942  ATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDS 1001

Query: 875  DDDLLRSFFNRKE-----KLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFI 929
               ++ SFF  K      KLS ++ D  + +  +   I  +HE+LA E++ +M+FK  F 
Sbjct: 1002 GTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFF 1061

Query: 930  TRTLVVWAHR 939
               ++  A R
Sbjct: 1062 INGILRRAVR 1071

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  303 bits (776), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 259/871 (29%), Positives = 419/871 (48%), Gaps = 102/871 (11%)

Query: 140  LINDWIRFVSDPQKSITDVVFGINNVIKSLPDENSV--KIFEARLYSSIWNKLVHQTSEP 197
            L +D IR      +S  D +F       S+PD + +     E  LY  IW ++ H   + 
Sbjct: 230  LFHDIIRRAYSAMRS--DALFA------SMPDLSDLIYDYVELNLYDDIWVRITHHFKDS 281

Query: 198  QNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEK 257
            + ++     Y+S H+L     Y   F +F+L+ VV +EN ++LA   F +L  + +  +K
Sbjct: 282  E-VESNGLRYLSLHQLETG-LYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADK 339

Query: 258  IDILLSTFNILT------SKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFK 311
               L+ T   L+       ++  + I AD LL+  +++I R +L NL     YLQNF   
Sbjct: 340  AMYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKN 399

Query: 312  QNK-DFGILNYAISTLGAVLYYIDN--NLDKFKRYTDAIQDS-----KISEEK------- 356
            +    FG+L YAISTL A + Y D      K  R     +++     K+S E        
Sbjct: 400  ETSITFGVLGYAISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIH 459

Query: 357  ----LKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMV 412
                L YR E GES L  CI    ND L+ELL S E  ++FP+EDIL+DQT +G TLLM 
Sbjct: 460  YQKTLSYRTEQGESLLSICIANGKNDILQELL-SDE--RSFPLEDILEDQTTEGCTLLMQ 516

Query: 413  AVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNW 472
            ++KC N  AAS          T +E+  Y N  D++ R   H++T++  +L +IG + +W
Sbjct: 517  SLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDW 576

Query: 473  NCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR-----FAMDSGDFQLKKHIDNSNNT 527
            + KD  +G T LF IFRSYDQ   +Y  M R SFR     +A     F    H D   NT
Sbjct: 577  DVKDS-SGHTALFTIFRSYDQP--NYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENT 633

Query: 528  LLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFET 587
            LLHILK +I ++L + S+ +N+ N  G+TPLMV+ KY RL N + +L+ K   RV + + 
Sbjct: 634  LLHILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDK---RVILGKI 690

Query: 588  QQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVK 647
            Q  H           +  IL+ + K +  + + FG CF H+LK           + + V 
Sbjct: 691  Q--HPLLLCSIDYAKNPLILHEIAKQSAMD-TAFGKCFVHTLKY--------ESSSWLVN 739

Query: 648  ITLKFEKK--YKTIRFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIA----SMIS 701
            IT++ ++K  ++T+ F++KT++     VL +     +FLPL    N+L  +     S I 
Sbjct: 740  ITVQADRKGNFETVEFHLKTVQNFFRTVLRTCPM--TFLPLDSTLNQLASLGKARLSSIG 797

Query: 702  TKSKILFINNLNVILDTILFLELVPREGFILEARLKDYLRNQRKI---KTVATKSKKLQI 758
                + ++ +L    + ++  + +P++    E++L  +++ Q K     T    SKK++ 
Sbjct: 798  KLETVCYLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFSKKVEP 857

Query: 759  EDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFD--QRISYM---------DLL 807
            E++++I  FL+FN  EL+  ++ +  + +    + LK  D  Q +  +         DL 
Sbjct: 858  EEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSEGMGDLY 917

Query: 808  HCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINL 867
               D          N +  +L+ +  ++          +      KI +WWKL  EL+N 
Sbjct: 918  PLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNF 977

Query: 868  TKL------------ASNSDDDLLRSFF-NRKEK----LSIEIDDKIRSINELNCDIFVS 910
             K              +++D  ++      +KEK    LS  I +  RS+N+    I   
Sbjct: 978  RKQYAQNFPHLVKNGETSTDAGIIGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHD 1037

Query: 911  HELLAVEINNFMKFKPLFITRTLV-VWAHRN 940
            HE LA +++ FM+FK  +I R ++  W   N
Sbjct: 1038 HESLAEQLSKFMEFKGAYICRGVIKRWVREN 1068

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  281 bits (718), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 244/829 (29%), Positives = 395/829 (47%), Gaps = 99/829 (11%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGC----YISFHELNINDYYSLPFNKFSLRDVVFI 234
            E  LY  IW K + Q      I+  Y      YI+  ++    +Y    +KFSL+ V   
Sbjct: 256  ELNLYDDIW-KQITQLYRDDEIEATYDYNLLKYIAISQVP-TPFYPEKQSKFSLKKVTHF 313

Query: 235  ENVVDLACKEFVKLRESLSFDEKIDILLSTFNILT--SKLPQLEI-----DADNLLNFML 287
            E  ++ A   F +L  S S  EK  I++ T   LT  S+ P  +I     DAD L+  M+
Sbjct: 314  EKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMV 373

Query: 288  IIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN----------- 335
            +++ R ++ NL  H  YLQNF+  +N   FG++ YA+STL AVL Y ++           
Sbjct: 374  LVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLE 433

Query: 336  -NLDKFKRYTDAIQDSKISEEKLK-------YRNENGESYLCHCIITKDNDTLRELLFSS 387
             N  + K++ D +    +S + LK        R   GES L  CI   +   +  LL + 
Sbjct: 434  FNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNF 493

Query: 388  EYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDE 447
            E+    P+EDILDDQTI+GSTLLM  ++  NT  A           T +E+R Y+N  + 
Sbjct: 494  EH--ELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNR 551

Query: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507
              R   H++T    +  KIG + +W  KD  +G TPLF IFRSYD     Y +M   +FR
Sbjct: 552  WKRTAAHYLTQDLQMADKIGIFFDWEAKDI-SGHTPLFAIFRSYDHP--DYAQMVTNAFR 608

Query: 508  FA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFC 562
             A     +   +F    H D   NTLLH++KTNI+++L   ++ +N  N  G+TPLMV+ 
Sbjct: 609  TASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYV 668

Query: 563  KYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFG 622
            KY RL N++ +L    +D   I E  Q  + + NCF    +  I   LG F     + FG
Sbjct: 669  KYNRLDNVKCIL----RDNRLIMEKHQ-KSLFLNCFDYVKNPVIQAELG-FHAAEKTKFG 722

Query: 623  NCFTHSLKQFLHKSKHGNKNQYSVKITLKF---EKKYKTIRFNIKTIKALINMVLTSNSH 679
                H+ +           N++ + ITLK    E  ++T++ NI+ I+ L+ + L  N  
Sbjct: 723  EVVAHTFR--------FENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNP- 773

Query: 680  VSSFLPLYKVFNELN--GIASMISTKSKIL--FINNLNVILDTILFLELVPREGFILEAR 735
              SFLP+  V  +L+  G   ++S     +  F+  L ++L  I   E   +  ++  + 
Sbjct: 774  -MSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832

Query: 736  LKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQM------ 789
            L +++R   + +T    S++++ E+IN I +FL+FNL+EL+  ++ +  IL+++      
Sbjct: 833  LVNWIRESGRKRTNV--SRRIEPEEINSIQSFLRFNLSELSLIRDKI-SILQKLSIFSEL 889

Query: 790  -----NSINLKLFDQRISYMD--LLHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNT 842
                 N     LF Q +   D  +     +         +L+  IL SN   L+   +  
Sbjct: 890  KAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKL 949

Query: 843  LHFLKVFQNEKIRKWWKLNNELI-----------NLTKLASNSDDDLLRSFFNRK----- 886
            +  +      K+ +WWKL  EL+           N  K   + +  L  ++   K     
Sbjct: 950  VGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLE 1009

Query: 887  EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLVV 935
            EKLS +I   +  +  L  ++   HE LA E++ +++FK  ++ RT ++
Sbjct: 1010 EKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYL-RTGII 1057

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  273 bits (699), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 250/837 (29%), Positives = 405/837 (48%), Gaps = 118/837 (14%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238
            E  L+  IW K++ + ++   ID      IS ++++ +++ S  ++KF L +V+  E  +
Sbjct: 289  ELNLFDDIW-KMILRMNKEVEIDLNPFGNISIYQVD-SEFLSTEYSKFFLENVITAERNI 346

Query: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILT-----------------SKLPQLEIDADN 281
              A K   K+  + ++  K +IL+ T   LT                 S  P L IDAD 
Sbjct: 347  KEASKSLQKIESASNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFP-LAIDADR 405

Query: 282  LLNFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTLGAVLYYIDNNLDK- 339
            L+N  +++  R ++ NL  H  YLQNF N   +  FGIL YA+STL AV+ Y +   +K 
Sbjct: 406  LMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKE 465

Query: 340  -FKRYTD----------------------AIQDSKISEEKLKYRNENGESYLCHCIITKD 376
             +++  D                      A+   +  E  L+YR+  G+S L  CII   
Sbjct: 466  NYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGR 525

Query: 377  NDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPD 436
            ND L  +L  +EY   FP+ED+L D++IDGSTLL+ AVK  N  +AS          T  
Sbjct: 526  NDFLYHIL--NEYETLFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEI 583

Query: 437  EIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIK 496
            E+  Y+N  D N R  GHF+TN+  +L  +G Y+NW  KD   GQTPLF IFRSYDQ   
Sbjct: 584  ELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDN-AGQTPLFTIFRSYDQD-- 640

Query: 497  SYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPN 551
            +Y +M  +S  +A     ++  +F    H+D   NTLLHILK N+ ++L    + +N+ N
Sbjct: 641  NYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATN 700

Query: 552  SLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLG 611
              G TPLM   +Y+R  NI+ LL    + RV I    Q +NA +  F  + DD+I +LLG
Sbjct: 701  RSGQTPLMTSIRYKRTENIRDLLCDP-RLRVDI---TQKNNALT-AFDFSKDDEITHLLG 755

Query: 612  KFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALIN 671
            +  + N S +   + H+LK           +++++ +T+K +   KT  F +KT++ ++ 
Sbjct: 756  EHELLN-SPWLAVYAHTLKY--------TNSRWNLSLTVKLKDAPKTTNFTLKTLRGILR 806

Query: 672  MVLTSNSHVSSFLPLYKVFNEL---NGIASMISTKSKIL-FINNLNVILDTILFLELVPR 727
            +V+ +N  V  FLP+ ++  +L   N I      + K+L  +  ++  L  ++ ++++  
Sbjct: 807  VVIKNNMTV--FLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSALVHIKVLDL 864

Query: 728  EGFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787
              F  E     +++    +     ++  +  EDI+MI NFLKFN+ E+   KN ++   +
Sbjct: 865  NVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEK 924

Query: 788  QMNSINLKLFDQRISYMDLLHCPD----VVVHLNNPLWNLNYNILISNFQIL----ENSI 839
                  L LF  R+   DLL+  +    +V  L++  +         + ++L    E ++
Sbjct: 925  ------LSLF-SRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLSVRAEKAL 977

Query: 840  DNTLHFLKV-----------FQNEKIRKWWKLNNELINLTK------------LASNSDD 876
             + + +LK+                I  WW +  EL+N  K               N D 
Sbjct: 978  LSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELANVTTENRDL 1037

Query: 877  DLLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLF 928
             L R   N K     E+LS +I D    +N +  DI   HEL A E++ F+  K  F
Sbjct: 1038 ALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKF 1094

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  263 bits (671), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 265/909 (29%), Positives = 413/909 (45%), Gaps = 163/909 (17%)

Query: 152  QKSITDVVFGINNVIKSLPDENSV--KIFEARLYSSIWNKLV---------HQTSEPQNI 200
            +K+I  +  G++N   ++P    +  +  E  +Y  +W  L+          + SE  +I
Sbjct: 237  RKTIDKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDI 296

Query: 201  DKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDI 260
             +F    IS  +L+  D+Y   F+KF L+D+V +E  +  A K F  L  + ++ EK  +
Sbjct: 297  FRF----ISLDQLD-TDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRV 351

Query: 261  LLSTFNILTSKLP-----QLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK- 314
            L+ T  IL+  +      Q+ I AD L++  +++I R K+ N+  H +YLQNF+  +N  
Sbjct: 352  LVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSI 411

Query: 315  DFGILNYAISTLGAVLYYI----------------DNNLDKFKRYTDAIQDSKISEEKL- 357
             FG+L YAISTL AV+ Y+                D NL++F   T   +   +S E L 
Sbjct: 412  KFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEF--LTLLTRSKCVSNEGLD 469

Query: 358  --------KYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTL 409
                    +YRN +G S L  CII   ND   ELL S  Y   F  ED+L+DQT +G+TL
Sbjct: 470  LSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELL-SENYESYFAFEDLLEDQTTEGTTL 528

Query: 410  LMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPY 469
            LM +++  N               T +E+  Y    D+  RN+GH+I  Q  LL KIG Y
Sbjct: 529  LMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKY 588

Query: 470  LNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD------SGDFQLKKHIDN 523
            + W+ KD  TGQTPL  IFRSYDQ+   Y  M   SF  A++      +  F  + H D+
Sbjct: 589  IKWDSKDC-TGQTPLCVIFRSYDQAF--YDVMVETSFAIAVEWYSTVKNSKFCFRDHTDS 645

Query: 524  SNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVS 583
              NTLLHI+K NI  +L    + IN  NS G++PL     Y R  N++ LL    KD   
Sbjct: 646  KGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALL----KDPRL 701

Query: 584  IFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQ 643
            IF +      + N  S         +L  + + N + F N         +        N+
Sbjct: 702  IFSSFDFLKQYPNTKSAP-------ILSHYCLDNEAPFRNIIASHFDFRI-------SNK 747

Query: 644  YSVKITLKFEKKYKTI----RFNIKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASM 699
             SV +T + ++  + +     F +K +KAL  ++L    H  +F PL ++ +EL+ +   
Sbjct: 748  RSVVLTSRSKEDAQELIGSEAFELKNLKALFRLLL--KQHPFTFFPLEELLDELSVVEKT 805

Query: 700  ISTK--------SKILFINNLNVILDTILFLELVPREGFILEARLKDYLRNQR------K 745
             S++        SK+L    L   LD+++ +EL+P       A L+ ++  ++      K
Sbjct: 806  ASSRSLMKSSFCSKVL--KKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEK 863

Query: 746  IKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRISYMD 805
            +K   +K KK+Q E I  I+ FLK+ L  L   K  + + LR+  SI  KL  + IS   
Sbjct: 864  LKR-RSKDKKMQPESIGTITTFLKYILESLLKLKGTIIE-LRKF-SILSKLKSKDISESK 920

Query: 806  LLHCP-----------DVVVHL----NNPLWNLNYNILISNFQILE-------NSIDNTL 843
             + C              +V      N  L   ++++L+      E       NSID+ L
Sbjct: 921  NIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLL 980

Query: 844  HFLKVFQNEKIRKWWKLNNELINLTK-----LASNSDD---------------------D 877
            H        KI +WWK   +L+ L+K     LA  SD                       
Sbjct: 981  HL-------KIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMG 1033

Query: 878  LLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFI-TR 931
            +L +F   K     E+    I D  R +  L+ +I  ++ L+ +E   F+ F+  FI + 
Sbjct: 1034 VLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSA 1093

Query: 932  TLVVWAHRN 940
             L  W   N
Sbjct: 1094 MLEKWVKLN 1102

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  247 bits (631), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 248/795 (31%), Positives = 391/795 (49%), Gaps = 127/795 (15%)

Query: 247  KLRESLSFDEKIDILLSTFNILTS---KLPQLE----------IDADNLLNFMLIIINRV 293
            KL    SF+EK + L++T  ILT+    + +L           IDAD L+N +++II R 
Sbjct: 339  KLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRS 398

Query: 294  KLN--NLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN--NLDKFKRYTDAIQ 348
            ++N  +L  +  YL+ FN+ +N  +FGIL+Y IST   V+Y  +N    DK K Y++ I+
Sbjct: 399  EINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIE 458

Query: 349  D-------SKIS-----EEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPME 396
                     K+      E+ L +R++ GES L  CI     +   +LL   E I  F M+
Sbjct: 459  KLIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEI--FSMD 516

Query: 397  DILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVGHFI 456
            +ILDD  ++G+TLLM A+   N   +           +  +I  Y+N +D+ NRNVGH++
Sbjct: 517  NILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYL 576

Query: 457  TNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR-----FAMD 511
             N+  +L  IG Y+NW  +D   G+TPLF IFR YDQ   +Y ++    F      +A +
Sbjct: 577  INELEILKIIGKYVNWKQRD-LVGRTPLFTIFRGYDQP--NYDEVISTVFDITLNWYAEN 633

Query: 512  SGDFQLKKHIDNSNNTLLHILKTNIQMILP-----HASLFINSPNSLGMTPLMVFCKYRR 566
               FQ+  H D  +N++LHIL++NI ++       H  + IN  N  G TPLM++ KY R
Sbjct: 634  GLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHR 693

Query: 567  LYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFT 626
            L N++++L     DR+ +F   Q    ++ CF    D  I N LGK A++N ++FG  + 
Sbjct: 694  LSNVKLILGD---DRL-LFNRYQ-RELYTTCFDYATDSTISNELGKHALQNNTVFGRIYI 748

Query: 627  HSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINM--VLTSNSHVSSFL 684
            HSL     K +      +S+   L  +K+ +T   NIK +KA+I++  V+   S + S L
Sbjct: 749  HSL-----KVRSSTNATFSLTFPLP-DKENETGTVNIK-VKAIISLLKVIRKKSQI-SLL 800

Query: 685  PLYKVFNELNGIASMISTK---SKILFINNLNVI------LDTILF-------LELVPRE 728
            PL ++   L  + S  + K    KI  + N +++      LDT+LF       L L+  E
Sbjct: 801  PLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDE 860

Query: 729  GFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQ 788
              +L     +  + +  +     + K L+ EDIN+I +FLKFN+ EL      VK + + 
Sbjct: 861  TKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKL 920

Query: 789  MNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNIL--ISNFQILENS------ID 840
            +N I+LK  D + S +  +H    +   N+ +       L  I   Q LEN       I 
Sbjct: 921  LNFIHLKSIDVKESRLAFVHLVKSIK--NDQIAQATNRSLEPIIEMQSLENQYYNNTLIR 978

Query: 841  NTLHFLKV-----------FQNEKIRKWWKLNNELINLTK--------------LASN-- 873
            + L FLK                +I  WWKL  EL+ L K              LA++  
Sbjct: 979  DELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQ 1038

Query: 874  -----SDD--------DLLRSFFNRK-EKLSIEIDDKIRSINELNCDIFVSHELLAVEIN 919
                 S+D         L+ +  N+  +KL  +ID    S+  L  +IF  HE+LA E+N
Sbjct: 1039 HSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELN 1098

Query: 920  NFMKFKPLFITRTLV 934
             +M+FK +F  + ++
Sbjct: 1099 KYMEFKGVFFKKAII 1113

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  245 bits (626), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 245/814 (30%), Positives = 386/814 (47%), Gaps = 85/814 (10%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238
            E+  Y+SIW+ +     + Q +      ++S  +L + + Y+  F KF+L +V+ +E  V
Sbjct: 278  ESSFYNSIWDHIDRNMIDNQFLHTEMMDFLSIDQLEL-ELYNQNFQKFNLVNVIKVERCV 336

Query: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTS----KLPQLEIDADNLLNFMLIIINRVK 294
              A  +F K+ +S S  EK  IL+     LTS        L +DAD L+N  L++I R K
Sbjct: 337  KDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSK 396

Query: 295  LNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN--NLDKF-KRYTDAIQD- 349
            +  L  H +YLQNF+  +N   FG+L Y IST  A L Y+ +    +KF K+  + I++ 
Sbjct: 397  VPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNK 456

Query: 350  ---SKISEEK-------------LKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNF 393
               SKIS E               K+RNE GES L  CI  K N+TL E+L + E +  F
Sbjct: 457  ELISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDM--F 514

Query: 394  PMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVG 453
            P+EDILDD+ I+G+TLLM A+K  N   A           + DE+  Y N  D N R   
Sbjct: 515  PLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAA 574

Query: 454  HFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD-- 511
            H+ITNQ  +L +IG + NW  KD + G TPL  I R+YDQ  + Y++M   +F  A    
Sbjct: 575  HYITNQIDVLKRIGLFFNWKIKDDK-GYTPLTTICRTYDQ--ECYEQMIETAFFEAQKWY 631

Query: 512  ---SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLY 568
               +     K H D+  NTLLHILK +IQ++L + ++ IN+ N   +TPLM + KY R+ 
Sbjct: 632  ENRNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVS 691

Query: 569  NIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHS 628
            NIQ ++    +D   I    Q H  + +C+    +  I   LG  +++N S+F     +S
Sbjct: 692  NIQEII----RDERLILGKYQKH-TFLDCYDFVKNTIIFEDLGVRSVRN-SMFNLFSAYS 745

Query: 629  LKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS-HVSSFLPLY 687
            L+           + + +  T K   +   I  ++ ++K L N++   N  +   F+P  
Sbjct: 746  LR--------VENSNWVLYFTFKDTNQDSYITKSV-SLKILFNIIKKYNKLYPLHFIPHK 796

Query: 688  KVFNELNGIA-----SMISTKSKILFINNLNVILDTILFLELVPREGFILEARLKDYLRN 742
            +V   L GI      + I       F+N ++    T++  +    E F     L  +++ 
Sbjct: 797  EVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLIETDDFDTELFKNPESLTKWIKA 856

Query: 743  QRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRIS 802
             ++        K++ ++DINMI +F++FN+NEL      +  + +    + LK+ D   S
Sbjct: 857  GKRKHKKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNES 916

Query: 803  YM------DLLHCPDVVVHLNNPLWNLNYNILISNFQILENSID----NTLHFLKVFQN- 851
            Y        LL   D+   +      +      S F IL + I      T+H    F + 
Sbjct: 917  YKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQISFLEICTIHMSDNFNDL 976

Query: 852  --EKIRKWWKLNNELINLTKLASNSDDD-----------LLRSFFNRKE----KLSIEID 894
                I +W  ++  L NL K       D           L R   N++E    ++S EI 
Sbjct: 977  IKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGLNENILSRYTKNKREAAEKRISEEII 1036

Query: 895  DKIRSINELNCDIFVSHELLAVEINNFMKFKPLF 928
            +     +++   I+ +HE LA E N F+ FK  F
Sbjct: 1037 ENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRF 1070

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  241 bits (614), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 193/613 (31%), Positives = 299/613 (48%), Gaps = 66/613 (10%)

Query: 179 EARLYSSIWNKLVHQTSEPQNIDKFYGC----YISFHELNINDYYSLPFNKFSLRDVVFI 234
           E  LY  IW K + Q      I+  Y      YI+  ++    +Y    +KFSL+ V   
Sbjct: 256 ELNLYDDIW-KQITQLYRDDEIEATYDYNLLKYIAISQVP-TPFYPEKQSKFSLKKVTHF 313

Query: 235 ENVVDLACKEFVKLRESLSFDEKIDILLSTFNILT--SKLPQLEI-----DADNLLNFML 287
           E  ++ A   F +L  S S  EK  I++ T   LT  S+ P  +I     DAD L+  M+
Sbjct: 314 EKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMV 373

Query: 288 IIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN----------- 335
           +++ R ++ NL  H  YLQNF+  +N   FG++ YA+STL AVL Y ++           
Sbjct: 374 LVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLE 433

Query: 336 -NLDKFKRYTDAIQDSKISEEKLK-------YRNENGESYLCHCIITKDNDTLRELLFSS 387
            N  + K++ D +    +S + LK        R   GES L  CI   +   +  LL + 
Sbjct: 434 FNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNF 493

Query: 388 EYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDE 447
           E+    P+EDILDDQTI+GSTLLM  ++  NT  A           T +E+R Y+N  + 
Sbjct: 494 EH--ELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNR 551

Query: 448 NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507
             R   H++T    +  KIG + +W  KD  +G TPLF IFRSYD     Y +M   +FR
Sbjct: 552 WKRTAAHYLTQDLQMADKIGIFFDWEAKDI-SGHTPLFAIFRSYDHP--DYAQMVTNAFR 608

Query: 508 FA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFC 562
            A     +   +F    H D   NTLLH++KTNI+++L   ++ +N  N  G+TPLMV+ 
Sbjct: 609 TASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYV 668

Query: 563 KYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFG 622
           KY RL N++ +L    +D   I E  Q  + + NCF    +  I   LG F     + FG
Sbjct: 669 KYNRLDNVKCIL----RDNRLIMEKHQ-KSLFLNCFDYVKNPVIQAELG-FHAAEKTKFG 722

Query: 623 NCFTHSLKQFLHKSKHGNKNQYSVKITLKF---EKKYKTIRFNIKTIKALINMVLTSNSH 679
               H+ +           N++ + ITLK    E  ++T++ NI+ I+ L+ + L  N  
Sbjct: 723 EVVAHTFR--------FENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNP- 773

Query: 680 VSSFLPLYKVFNELN--GIASMISTKSKIL--FINNLNVILDTILFLELVPREGFILEAR 735
             SFLP+  V  +L+  G   ++S     +  F+  L ++L  I   E   +  ++  + 
Sbjct: 774 -MSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832

Query: 736 LKDYLRNQRKIKT 748
           L +++R   + +T
Sbjct: 833 LVNWIRESGRKRT 845

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  237 bits (604), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 246/830 (29%), Positives = 384/830 (46%), Gaps = 125/830 (15%)

Query: 179  EARLYSSIWNKLVH--QTSEPQNIDKFYGCY-ISFHELNINDYYSLPFNKFSLRDVVFIE 235
            E  +Y  +W KLV     +EP  +  +Y    IS ++L+ +  Y    +KF+L  V  IE
Sbjct: 251  ELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS-IYPEELDKFNLSPVTEIE 309

Query: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLE----IDADNLLNFMLIIIN 291
              V  A + F KL  + S  EK  IL+STF  LT+K  Q      IDAD LL  M++++ 
Sbjct: 310  KRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVC 369

Query: 292  RVKLNNLNEHFHYLQNFNFKQNKD---FGILNYAISTLGAVLYYID--NNLDKFKRYTDA 346
            R ++ NL  H  YL+ F   QN D   FG+L Y++STL AV+ Y D   +  K +R    
Sbjct: 370  RAQVKNLKSHLDYLREF--AQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQ 427

Query: 347  IQDSKI---------------SEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIK 391
             Q +KI                EE L  R  + ES L  CI     D   +++  + Y  
Sbjct: 428  CQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDII--ANYQS 485

Query: 392  NFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRN 451
            +F +EDIL D      +LL+ A++  N               T  E+  Y+N  D   R 
Sbjct: 486  HFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRT 545

Query: 452  VGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD 511
            VGH++   Y ++ ++G +++W  KD     TPLF + R+YD    SY ++  + F+   D
Sbjct: 546  VGHYLPQNYEIVDRLGKFVDWKRKDLNM-HTPLFTVCRAYDHP--SYLELLSKCFQHCFD 602

Query: 512  -----SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRR 566
                    F    H D   NTLLHI+K  IQ+ L      +N  N+ GMTPLMV+ KY R
Sbjct: 603  FYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNR 662

Query: 567  LYNIQILLS------SKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSI 620
            + NI+ +L+      SK +D  S+     V N             ILNL+G    KN S+
Sbjct: 663  IENIREILNDKRLILSKLQDPQSLKAIDYVKNPI-----------ILNLIGTAMAKN-SL 710

Query: 621  FGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKK-YKTIRFNIKTIKALINMVLTSNSH 679
            +G    H++K          +N + + IT     + YKT  + +K I++L+ +   +  H
Sbjct: 711  YGCLSVHNIKY--------EENAWYLWITSSLSPESYKTSSYALKDIQSLLQIY--NKKH 760

Query: 680  VSSFLPLYKVFNELNGIASMISTKSKILFINNL--NVILDTILF-LELV-PREGF----- 730
              SFLP+      L  +      KS I+ + NL  +++L+ + F L ++  RE +     
Sbjct: 761  PMSFLPIDHHLETLKTLG-----KSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFS 815

Query: 731  ILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNG---VKK--I 785
              E+ L  +LR    +K    K  K++ E+I+ I NFLKF+L E N  +     +KK  I
Sbjct: 816  YTESELSTWLRASM-VKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLII 874

Query: 786  LRQMNSINLKLFDQRISYMDLLHCPDVVV--HLNNPLWNLNYNILISNFQILENSIDNTL 843
                 S +++   QRI Y        VV    L    ++  +N  I  F   E ++D   
Sbjct: 875  FEHYKSHDIEC-SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPF---EQAVDFMC 930

Query: 844  HFL-----KVFQ--NEKIRKWWKLNNELINLTKL------------ASNSDDDLLRSFF- 883
              L     K+ +  + K+  WW L  E+ NL K             +++S+D   + FF 
Sbjct: 931  MCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDS--KGFFV 988

Query: 884  ----NRKEKLSIEIDDKIRSINE----LNCDIFVSHELLAVEINNFMKFK 925
                ++++KL  ++  ++   +E    L+ ++   HELLA EI+ F+  K
Sbjct: 989  SYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSK 1038

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  229 bits (584), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 244/840 (29%), Positives = 386/840 (45%), Gaps = 105/840 (12%)

Query: 179  EARLYSSIWNKLVH--QTSEPQNIDKFYGC-YISFHELNINDYYSLPFNKFSLRDVVFIE 235
            E  +Y  IW KLV    + EP  +  +    YIS + +     Y    N F LR V  +E
Sbjct: 253  ELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNV-ATILYPEGTNSFDLRVVTEVE 311

Query: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLEID----ADNLLNFMLIIIN 291
              V  A   F KL  + S +EK  I++STF ILT+K+    ID    AD L+  ML+++ 
Sbjct: 312  KRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDADTLIGLMLVVLC 371

Query: 292  RVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYID--NNLDKFKRYTDAIQ 348
            R ++ NL  H  YL+ F  + +   FG+  Y++ST+ AVL Y +  +  +K K+     +
Sbjct: 372  RSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGTEKLKKLISLSE 431

Query: 349  DSKI---------------SEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNF 393
             +++                +  L  R+ N ES L  CI     D ++E+L +  Y +  
Sbjct: 432  ANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLN--YQEQI 489

Query: 394  PMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVG 453
             +ED+L D     STLL+ A++  +   A           T +E   YVN  +   R V 
Sbjct: 490  KLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVA 549

Query: 454  HFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD-- 511
            H++   + ++ KIG YL+W  KD     TPLF I R+YDQ    Y +M  RSF +  +  
Sbjct: 550  HYLPQAFSIIEKIGLYLDWRKKDVNM-HTPLFIICRAYDQ--LHYSEMLSRSFEYVFEYC 606

Query: 512  ---SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLY 568
                 DF    H D   N+LLHI+K  IQ IL   ++ +N  N  GMTPLM++ KY R+ 
Sbjct: 607  RRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIE 666

Query: 569  NIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHS 628
            NI+ +L  K +  VS  +  Q   A         +  ILNL+G    KN S++G      
Sbjct: 667  NIRDILEDK-RLIVSKIQNPQTLKA----IDYVKNPMILNLIGTHIAKN-SLYGLLSADG 720

Query: 629  LKQFLHKSKHGNKNQYSVKITLKF-EKKYKTIRFNIKTIKALINMVLTSNSHVSSFLPLY 687
            +K           N + + IT+KF +  Y T+R ++K I+ L+     +  H  +FLP+ 
Sbjct: 721  IK--------FEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFY--NKKHPMNFLPID 770

Query: 688  KVFNELNGIASMISTKSKILFINNLN----VILDTILFLELVPREGFIL-----EARLKD 738
             + + L  I      K  IL + NL     + L T L   +  R  ++      E+ L  
Sbjct: 771  HILSILKNIG-----KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLST 825

Query: 739  YLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSI-NLKLF 797
            +LR     K  A K ++++ E+++ I +FLKFNL+E +  K     ILR++    +LK  
Sbjct: 826  WLRTN-NFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKF-TILRKLVVFQSLKAQ 883

Query: 798  D----QRISYMDL-LHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFL----KV 848
            D    QRI Y  + +    V   +       N N  + +FQ     I   L  L    + 
Sbjct: 884  DIECAQRIIYQQMEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQY 943

Query: 849  FQNEKIRKWWKLNNELINLTK----------LASNSDDDLLRSFF-----NRKEKLSIEI 893
              + K+  WW+L  EL +L +           +S+   +  + FF      +++K   ++
Sbjct: 944  VLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKL 1003

Query: 894  DDKIR----SINELNCDIFVSHELLAVEINNFMKFKPL----FITRT---LVVWAHRNCL 942
              ++R     +  L+ ++   HE LA EI+ F+ FK      F+ +T   + +  HRN L
Sbjct: 1004 QARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNIL 1063

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  210 bits (534), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 228/844 (27%), Positives = 384/844 (45%), Gaps = 121/844 (14%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238
            E+ LY  IWNKL  +    + +D      +S   L+   +Y+  F  F L D+V +E  +
Sbjct: 269  ESLLYQDIWNKL-QEHYRDKILDFRLVSQLSLDMLDTT-FYNRTFKNFQLIDIVNMEACM 326

Query: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILTSK----------LPQLE-IDADNLLNFML 287
              A   F  ++ + S+ +K+D++  T NI+T K          LP+L  IDAD L++   
Sbjct: 327  VQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFA 386

Query: 288  IIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYY-------------- 332
            +++ R  + ++  H  YLQ+F   +N   FG L Y +ST+ A L Y              
Sbjct: 387  LLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQL 446

Query: 333  -----IDNNLDKFKRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSS 387
                 +++ L K +   D +      ++  +YR + GES L   I  K N+ L E L + 
Sbjct: 447  QKLSLLEDFLIKIRSQHDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNF 506

Query: 388  EYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDE 447
            E I  FP++D+L D  + GSTLL+  +K  N  AA           T  E+  Y N  D+
Sbjct: 507  EDI--FPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDK 564

Query: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507
              R + H+IT++  +L KIG Y+NW  KD + G+T LF IFRSYDQ+  S       + +
Sbjct: 565  TKRTLAHYITDEIEILEKIGKYINWTLKDLK-GRTALFTIFRSYDQTTYS------STIK 617

Query: 508  FAMDSG---------DFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPL 558
             A+D            F++  H D   ++LLHILK+ + ++L    L IN PN  GMTPL
Sbjct: 618  IALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPL 677

Query: 559  MVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNY 618
            M + KY R+ NI+ +L      R+ I + Q+  + + NC     +  + NLL     K+ 
Sbjct: 678  MTYVKYNRIDNIKTILED---GRLIIKKLQK--DKYLNCLDYGKNFTVFNLLAAKLSKD- 731

Query: 619  SIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTSNS 678
             IF N        ++  +++   + Y      K + +Y T    +K    LIN +     
Sbjct: 732  VIFENA-------YISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYYNLINAM--QKI 782

Query: 679  HVSSFLPLYKVFNELNGIAS----MISTKSKIL-FINNLNVILDTILFLELVPREGFILE 733
            + S F+P   + + L  I      +   + KI  ++N L+  L  +L+ E +     + E
Sbjct: 783  YKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKIDPLTLLDE 842

Query: 734  ARLKDYLRN--QRKIKTVATKS--KKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQM 789
              +  ++ +  Q++ K++   S  K L  EDIN I  F  F+  E+    N ++  L+  
Sbjct: 843  NLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLK-- 900

Query: 790  NSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNTLHFLKVF 849
                L +F + I   DL    D++  L +   N   +  + + Q +   + +++ + ++ 
Sbjct: 901  ----LSIFGE-IKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVHSSMVYYELS 955

Query: 850  QN--------------------EKIRKWWKLNNELINLTK------LASNSD-------D 876
            Q+                    +K+  W K N +L+   K      L SN +        
Sbjct: 956  QDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSENT 1015

Query: 877  DLLRSFFN---RKE---KLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFIT 930
             + R  +N   RKE   +L   + +  R + +L  +I V HE LA E +++++ K  F +
Sbjct: 1016 SVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKFNS 1075

Query: 931  RTLV 934
              LV
Sbjct: 1076 NLLV 1079

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  206 bits (525), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 217/827 (26%), Positives = 382/827 (46%), Gaps = 111/827 (13%)

Query: 179  EARLYSSIWNKLVHQTSEPQ---NIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIE 235
            E  LY   W +L +   + +   + D     +IS  ++    Y S P  KF LR +   E
Sbjct: 259  ELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFLYPSNP-EKFDLRLITQAE 317

Query: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKL----PQLEIDADNLLNFMLIIIN 291
              V  A + F K+  +     K  +++ T   L+  L      + IDAD L++  ++++ 
Sbjct: 318  KNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRAVTIDADTLVSLFVVVVC 377

Query: 292  RVKLNNLNEHFHYLQNFNFKQN-KDFGILNYAISTLGAVLYYIDN-----NLDKFKR--- 342
              ++ +L  H  YLQ F    N   FGIL Y +STL AVL Y ++     +L+K+ R   
Sbjct: 378  HAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFESPEKVASLEKYCRANL 437

Query: 343  -YTDAIQDSKIS---------EEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKN 392
             +  +I +  I          ++ LK R  +G+S L  C+  +  +         E IKN
Sbjct: 438  SHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTEEF-------ELIKN 490

Query: 393  -----FPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDE 447
                 FP+ED+L D+T DGS LL+  ++      A           T DE+  ++N  ++
Sbjct: 491  TREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNK 550

Query: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507
              R+ GH++ +   L+  +G  LNW  +D   G TPLF I R+YD+    Y  M   ++R
Sbjct: 551  YQRSCGHYLMHAPQLIDLVGDILNWEQRDC-NGHTPLFAIVRAYDRP--DYFDMVSAAYR 607

Query: 508  FAMDSGD-----FQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFC 562
             A+         F++  H D+  NTLLH++K+++ ++L    + +N+ N+ G+TPLMV+ 
Sbjct: 608  AAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYV 667

Query: 563  KYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFG 622
            +Y R+ N++ +L  +   R+ I + Q    A+ +CF    +  +L  LGK+A  +Y  F 
Sbjct: 668  RYNRIGNVRTILQDQ---RLIIGKHQS--GAYLSCFDYVKNPAVLKELGKYA--SYLPFE 720

Query: 623  -NCFTHSLKQ-----FLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLTS 676
             +   HS+K+      L  +  G + Q  VK+   F+   +++RF    I+A   + L S
Sbjct: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKV---FK---RSLRF----IQAF--LTLFS 768

Query: 677  NSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNV---ILDTILFLELVPREGFILE 733
            ++H  +F+P+ ++  EL  +     ++S+IL +N ++    +    + L +V +E    +
Sbjct: 769  DAHPMTFVPVDELLRELRAL-----SQSRILILNKMDTKRFLKRCSVTLSMVSQERLFAD 823

Query: 734  ARLKDYLRNQRKIKTVATKS-----KKLQIEDINMISNFLKFNLNELNAFKNG---VKK- 784
            A     L         +++S     K ++ E++  I + LKFNL+E++A K     +KK 
Sbjct: 824  AFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKL 883

Query: 785  -ILRQMNSINLK----LFDQRISYMDLLHCPDVVVHLNNPLWNL-NYNILISNFQILENS 838
             +   +   +L      F  +  Y+           LN    NL ++  + +N  + E  
Sbjct: 884  AVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELC 943

Query: 839  IDNTLHFLKVFQNEKIRKWWKLNNELINLTKLASNSDDD-----------LLRSFFNRK- 886
                   +    N+ I KWW    EL++L +    S  D           L  S+   K 
Sbjct: 944  SSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKR 1003

Query: 887  ----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFI 929
                +  +  I+     ++E++  I   +E LAVE+NNF+ FK  F+
Sbjct: 1004 TKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL 1050

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  204 bits (520), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 233/801 (29%), Positives = 368/801 (45%), Gaps = 138/801 (17%)

Query: 179  EARLYSSIWNKL-------VHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDV 231
            E  LY  IW+++       V   ++ Q        + S  E++ N Y     + F L+ V
Sbjct: 272  ERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIK-HFSIVEIDPNFY-----DIFPLKFV 325

Query: 232  VFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLE-----------IDAD 280
              +E  +  +     KL+ + S+ EK  IL+ +  I+T      E           IDAD
Sbjct: 326  PMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDAD 385

Query: 281  NLLNFMLIIINR--VKLNNLNEHFHYLQNFNFKQNKD-FGILNYAISTLGAVLYYIDN-- 335
            NLLN + ++I +  + L++L  + +YL+ F+  ++   FGILNY I+T   V + ++N  
Sbjct: 386  NLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVI 445

Query: 336  NLDKFKRYTDAIQD-----------SKISEEK---LKYRNENGESYLCHCIITKDNDTLR 381
            + D+ K  +D I++           S    +K   L YRN NGES L   II K N    
Sbjct: 446  DWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFT 505

Query: 382  ELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXG-TPDEIRT 440
            + L   E I N  M+ I +DQ++D STLL+ A++  N  AA               E+ +
Sbjct: 506  QYLIEYEDILN--MDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELIS 563

Query: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500
            Y+N VD +NRN+GH++     +L  IG ++NW  KD   G+TPLF IFRSYDQS  +Y +
Sbjct: 564  YINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKD-VNGRTPLFTIFRSYDQS--NYDE 620

Query: 501  MSRRSFR-----FAMDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHA-----SLFINSP 550
            +  + F+     +A ++  FQ+  H D++ N+LLHIL+ NI ++L +A      + +N  
Sbjct: 621  LVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKM 680

Query: 551  NSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLL 610
            N  G TPLM++ KY+R  NI++++    K+   IF   Q  N + +CF  + D  I+N +
Sbjct: 681  NCKGFTPLMMYFKYKRYDNIRMII----KEEKLIFNKFQSPN-FIDCFDYSVDSSIMNDI 735

Query: 611  GKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALI 670
            G+F + N  +FG     SLK+ +       +  Y     L  E    T+   +K    + 
Sbjct: 736  GEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVK 795

Query: 671  NMVLTSNSHVSSFLPLYKVFNE--------------LNGIASMISTKSKIL-FINNLNVI 715
             + +    +  SFLPL  + NE              L  I      K +I  F+  LN  
Sbjct: 796  FLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTC 855

Query: 716  LDTILFLE----LVPREGFILEARLKDYLRNQRKIKTVATKSKKLQIED----------- 760
            LD +L  +      P      E      +   +  ++  T S K ++E+           
Sbjct: 856  LDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKELK 915

Query: 761  ---INMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRISYMDL--LHCPDVVVH 815
               IN+I NFLKFNLNELN              S+NLK+  + + +M+L  L   D  + 
Sbjct: 916  PENINIIQNFLKFNLNELNTI------------SMNLKVLSKLVIFMNLKTLDIHDAQIR 963

Query: 816  LNNPLWNLN----YNILISNFQILENS--------IDNTLHFLKVFQNE----------- 852
             N  +  LN     +I+  +F ++++S        +  +LH    F NE           
Sbjct: 964  FNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVEN 1023

Query: 853  ----KIRKWWKLNNELINLTK 869
                KI  WWKL  EL+ L K
Sbjct: 1024 IIKIKIPNWWKLYGELLELNK 1044

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  204 bits (520), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 246/881 (27%), Positives = 392/881 (44%), Gaps = 144/881 (16%)

Query: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238
            E +L+  IW ++  + +E  + D      IS ++L +N Y +  F  F L D+V +E  +
Sbjct: 314  EIKLHDDIWGRISFKFTE-SDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKI 372

Query: 239  DLACKEFVKLRESLSFDEKIDILLSTFNILT-SKLPQLEIDADNLLNFMLIIINRVKLNN 297
              A   F K    ++F EK   L+ T  ILT +KL     DAD L+  + I+I R+K+ N
Sbjct: 373  SRAVTYFQKFINGITFQEKSTALIKTLQILTINKL----TDADTLIGLLSIVICRLKVRN 428

Query: 298  LNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN-----------NLDKFKRYTD 345
            L  H  YLQNF    N   FGIL Y+ISTL A+ YY D+             DK     D
Sbjct: 429  LKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFCDKLHNLYD 488

Query: 346  AIQDS--KISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQT 403
             I ++   +  + L YR++NGES L  CII    D   ELL + E+  +FP+EDILDD  
Sbjct: 489  TILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEH--SFPIEDILDDSD 546

Query: 404  IDGSTLLMVAVKCLNTTAASXXXXXXXXXGTPDEIRTYVNSVDENNRNVGHF--ITNQYY 461
            ++GS+LLM A K  N  A+             +E+R ++N  D+ NR+V H+  + N   
Sbjct: 547  LNGSSLLMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSIL 606

Query: 462  LLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSI-KSYKKMSRRSFR--FAMDSGDFQLK 518
            +L + G  ++W  KD +   TPL  IF+ +  +  +S+ K+  R     + + +  F LK
Sbjct: 607  ILTEFGNLIDWELKDIK-KLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLK 665

Query: 519  KHIDNSNNTLLHILKTNIQMILPHASLF----INSPNSLGMTPLMVFCKYRRLYNIQILL 574
             H+D + N LLH++K  I  ++ +  L     IN+ N+ G++P MV+ K  R  NI+I+L
Sbjct: 666  AHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIIL 725

Query: 575  SSKFKDRVSIFETQQVHNAWSNCFSLTN----DDQILNLLGKFAIKNYSIFGNCFTHSLK 630
                K+   I    Q+       F +T+    + ++ +LL    ++       C  HSL+
Sbjct: 726  ----KNPTLITSEGQL------PFLITSTNLYNSKVNHLLATHFLRTLDFAYICL-HSLR 774

Query: 631  -QFLHKSKHGNKNQYSVKITL-----KFEKKYKTI----RFNIKTIKALINMVLTSNSHV 680
                  S  G    + V I++     +F   + +I       +KTIK+L++  +    + 
Sbjct: 775  FNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYS 834

Query: 681  SSFLPLYKVF---NELNGIASMISTKSKILFIN------------NLNVILDTILFLELV 725
            S  LPL       N+L    + IS  S   F+             NL +I + + FL + 
Sbjct: 835  S--LPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFIT 892

Query: 726  PREGFIL---EARLKDYLR-NQRKIKTVATK---------------SKKLQIEDINMISN 766
                F L   E +L+ +L+ N +K+K   +                SK  Q EDIN I  
Sbjct: 893  TDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQT 952

Query: 767  FLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNN-------- 818
            F+KFNL EL  FKN +  I      I  K+ D   S         + + +NN        
Sbjct: 953  FIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQF-FFQKNTLKIGINNLSEILKYY 1011

Query: 819  ----PLWN--------LNYNILISNFQILENSIDNTLHFLKV----------FQNEKIRK 856
                PL           +YN      + L   ++N + F K+            N  I+ 
Sbjct: 1012 STQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKT 1071

Query: 857  WWKLNNELINLT----------KLASNSDDDLLRSFFNRK----------EKLSIEIDDK 896
            WW     L++            K+  N++ +   + F+++            + + I + 
Sbjct: 1072 WWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIILNIKNT 1131

Query: 897  IRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWA 937
               +   N  I   HE LA+E+NNFM FK  FI   ++ ++
Sbjct: 1132 STLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFS 1172

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  199 bits (506), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 215/791 (27%), Positives = 370/791 (46%), Gaps = 123/791 (15%)

Query: 208  ISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNI 267
            IS +++  N +Y      FSL  VV +E  V+ A +    +    +   K+++L +T  +
Sbjct: 298  ISLNQVPTN-FYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRL 356

Query: 268  LTSKLPQLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTL 326
            L+ ++  +  DAD LL+  +++I R ++  L     YL NF   +    FG+  Y +ST 
Sbjct: 357  LSREINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLSTF 416

Query: 327  GAVL-YYIDNNLDKF-------KRYTDAIQD-SKISEE----KLKYRNENGESYLCHCII 373
             A L ++  + +D         K+   +IQ  SK+  E     L+ R ++GES L  CI 
Sbjct: 417  EAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSGESLLSICIQ 476

Query: 374  TKDNDTLRELL--FSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXX 431
            + +N+ L  LL  F SE    FP+EDILDD+    STLL+ A++  N+ AA+        
Sbjct: 477  SHNNEVLTTLLANFESE----FPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEIILK 532

Query: 432  XGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSY 491
              T  E+R+Y+NS + +NR   H+I     LL  +G Y NW  KD   G TPLF +FRSY
Sbjct: 533  SCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDI-NGHTPLFAVFRSY 591

Query: 492  DQSIKSYKKMSRRSFR-----FAMDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLF 546
            D    +Y ++  +        +A ++  F  K H D   NTLLH++K+ I+ +L    + 
Sbjct: 592  DAV--NYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVN 649

Query: 547  INSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQI 606
            +N P+S G+TPLM++ +Y R+ NI+ ++    KD   + +  Q     ++    T + ++
Sbjct: 650  VNKPDSKGLTPLMIYSRYNRITNIETIM----KDERLLCDLVQQPLVMTS-LDFTKNPKV 704

Query: 607  LNLLGKFAIKNYSIFGNCFTHSLKQFLHKSK-----HGNKNQYSVKITLKFEKKYKTIRF 661
               +         +      HSL+    K K      G   +YS+ + +++  +Y  I +
Sbjct: 705  TKTILDATFNREPV----VIHSLRFEERKWKIGIFSEGIFKKYSLDL-IQYYLRYLKIMY 759

Query: 662  --NIKTIKALIN-MVLTSNSHVSSFLPL--YKVFNELNGIASMISTKSKILFINN---LN 713
              +   ++ L N + L     V   L L  Y  F +L+ + S ++T+ K+    +   L 
Sbjct: 760  PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELK 819

Query: 714  VILDTILFLELVPREGFILEARLKDYL-RNQRKIKTVATKSKKLQIEDINMISNFLKFNL 772
            V+LD       VP            YL  ++R IK        L+ E+IN I  FLK+NL
Sbjct: 820  VLLD-------VP----------TPYLSESERFIK--------LEPEEINGIQTFLKYNL 854

Query: 773  NELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPL------------ 820
             E    +N +  IL+++  +      Q+I + D++   +  + L N +            
Sbjct: 855  AEFQKLRNCL-IILKKLAIV------QQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENT 907

Query: 821  -----WNLNYNILISNFQILENSIDNTLHFLKVFQN--EKIRKWWKLNNELINLTK---- 869
                 ++L+Y     N + LE+S+   +  L  F++   K   WWK   EL+ L K    
Sbjct: 908  NCAWSYDLSYYEFTRNLEYLEHSV---VTLLNNFESLLAKTTLWWKHFGELMELKKEWKK 964

Query: 870  -------LASNSDDDLLRSFFNRKE-----KLSIEIDDKIRSINELNCDIFVSHELLAVE 917
                     S+++ + + ++   K      KLS ++     ++ ++  +I  +HE +AV 
Sbjct: 965  NFPNDKAPPSSANRNFIDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVG 1024

Query: 918  INNFMKFKPLF 928
            IN F++FK  F
Sbjct: 1025 INLFIEFKEQF 1035

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 205/786 (26%), Positives = 364/786 (46%), Gaps = 112/786 (14%)

Query: 219  YSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLP----Q 274
            Y     KF +R V  +E  +  A +   +L  + S   K  +++ T   ++  L      
Sbjct: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360

Query: 275  LEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYI 333
            + +DAD L++ +++++ + ++ +L  H  YLQ F    N   FGIL Y +STL AVL Y 
Sbjct: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420

Query: 334  DNNLDKFK----------RYTDAIQDSKI-------SEEK--LKYRNENGESYLCHCIIT 374
            ++  +K K           Y +A+ D K+       SE K  L+ R   G S L  C+  
Sbjct: 421  ESR-EKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQN 479

Query: 375  KDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASXXXXXXXXXGT 434
            +  +    L  ++++   FP+ED+L+D+T++GS LL+  +    ++ +           T
Sbjct: 480  RQPNLF--LHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCT 537

Query: 435  PDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQS 494
              E+ +++N V+   R+ GH++ +   L+ K+G ++NW  +D   G TPLF I R+YD +
Sbjct: 538  KTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDC-NGHTPLFAIIRTYDHT 596

Query: 495  IKSYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINS 549
               Y  M   +++ A     +    F+L KH DN  NTLLH++K+N+ ++L    + +NS
Sbjct: 597  --DYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNS 654

Query: 550  PNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNL 609
             N  G+TP+MV+ +Y RL NI+ +L  K   R+ I + Q  + ++  CF    +  +L  
Sbjct: 655  FNKKGLTPIMVYARYNRLDNIKSILRDK---RLIIQKCQ--NGSYLTCFDYIKNPVVLGE 709

Query: 610  LGKFAI---KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFE---KKYKTIRFNI 663
            LGK A    ++Y I      H++K           +++ + +TL         K I+ ++
Sbjct: 710  LGKHAFFLPQSYQIRA----HNIK--------FEGDEWVLWMTLVGSVPNAPAKVIQRSL 757

Query: 664  KTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNV---ILDTIL 720
            K I++   ++  S ++  +F+P   +  EL+ +A M     KI+ IN L     +    +
Sbjct: 758  KFIQSF--LISFSKTNSMTFIPAESLAEELSLLAKM-----KIISINRLETKHFLRRASV 810

Query: 721  FLELVPRE-----------GFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLK 769
             L L+ R+           G ++ A   ++++ Q    T       ++ E++  I   +K
Sbjct: 811  VLSLICRQEEFEHIFNNPSGSLVNA--AEHVQEQEANSTYGM----IEPEEVASIQKIMK 864

Query: 770  FNLNELNAFKNGVKKILRQMNSINLKLFD-QRISYMDLLH----------CPDVVVHLNN 818
            FN  E+ A K+G   + +      LK  D +R   M   H            +V   L +
Sbjct: 865  FNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSLKH 924

Query: 819  PLWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLT-KLASNSDDD 877
             L    +  L +N  +LE S    +  +    N  I  WWK   EL++L  +   N  DD
Sbjct: 925  SLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDD 984

Query: 878  L----------LRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFM 922
            +          + S+   K     + L   I+   +++   +  +  S+E LAVE+NNF+
Sbjct: 985  VRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFI 1044

Query: 923  KFKPLF 928
             FK  F
Sbjct: 1045 NFKAEF 1050

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 880 RSFFNRKEKLSIEIDDKIRSINELNCDIFVSHELLAVE----INNFMKFKP 926
           R+F  RKEK   E++DK++S+ + N D  V  E L  +    +N   K++P
Sbjct: 71  RAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRP 121

>ADR020C Chr4 complement(740413..742227) [1815 bp, 604 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 604

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 586 ETQQVHNAWSNCFSLTNDDQIL-NLLGKFAIKNYSIFGNCF 625
           +T +VHNAW N   L N+DQ   +++   A++   ++  CF
Sbjct: 86  QTYEVHNAWENRLLLRNEDQYFKDIVASLAMERLRVYDECF 126

>ZYRO0A00506g Chr1 complement(33846..35222) [1377 bp, 458 aa] {ON}
           similar to uniprot|P54787 Saccharomyces cerevisiae
           YML097C
          Length = 458

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 21/170 (12%)

Query: 207 YISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDILLSTFN 266
           +IS  EL+I +  S   NK           +V+L+ KE  K+    +  +K+  +L++  
Sbjct: 180 FISPQELDIPNLLSDKLNK-----------LVELSGKELNKVNHFKAPRDKMICVLNSCK 228

Query: 267 ILTSKLP--QLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNKDFGILNYAIS 324
           I+ + L   +LE  AD+ +  ++  I +  L++L  +  Y++ F F+       L Y  S
Sbjct: 229 IIMAMLTNNKLENGADSFIPLLIYTILKSNLSSLASNTRYIERFRFESFFRGEALYYLNS 288

Query: 325 TLGAVLYYID--------NNLDKFKRYTDAIQDSKISEEKLKYRNENGES 366
              AV + I          N ++FK+  D  Q   I E+++  R     S
Sbjct: 289 LQAAVSFIISINESTFTIENRNQFKQRYDDNQKQLIKEDEISERERENNS 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 107,925,603
Number of extensions: 5329125
Number of successful extensions: 19525
Number of sequences better than 10.0: 157
Number of HSP's gapped: 20150
Number of HSP's successfully gapped: 166
Length of query: 942
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 823
Effective length of database: 39,836,145
Effective search space: 32785147335
Effective search space used: 32785147335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)