Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003906.19ON32931214540.0
NCAS0H008106.19ON3233158971e-120
KNAG0M011506.19ON3072768781e-117
Kpol_1037.246.19ON3663028651e-114
TPHA0J003206.19ON3423148621e-114
NDAI0D007906.19ON4013418581e-113
TDEL0G045006.19ON3012658481e-113
CAGL0E02717g6.19ON3252658411e-111
KLLA0D01111g6.19ON3142678351e-111
Skud_15.1676.19ON3123058281e-110
ACR007W6.19ON3132778251e-109
Smik_15.1756.19ON3122998241e-109
Suva_15.1816.19ON3363038261e-109
YOR006C (TSR3)6.19ON3132218211e-108
Ecym_30236.19ON3492218181e-108
ZYRO0C07832g6.19ON2812258021e-106
SAKL0E01144g6.19ON4302248131e-106
KLTH0C11264g6.19ON3462988031e-105
TBLA0A072506.19ON3043057831e-103
Kwal_56.224216.19ON3373217741e-101
Ecym_41648.403ON497198750.77
Skud_10.3107.460ON95962694.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00390
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   564   0.0  
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   350   e-120
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   342   e-117
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   337   e-114
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   336   e-114
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   335   e-113
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   331   e-113
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   328   e-111
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   326   e-111
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   323   e-110
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   322   e-109
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   322   e-109
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   322   e-109
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   320   e-108
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   319   e-108
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   313   e-106
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   317   e-106
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   313   e-105
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   306   e-103
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   302   e-101
Ecym_4164 Chr4 complement(348576..350069) [1494 bp, 497 aa] {ON}...    33   0.77 
Skud_10.310 Chr10 (545082..547961) [2880 bp, 959 aa] {ON} YJR089...    31   4.6  

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/312 (89%), Positives = 278/312 (89%)

Query: 18  AIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRS 77
           AIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRS
Sbjct: 18  AIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRS 77

Query: 78  LKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLL 137
           LKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLL
Sbjct: 78  LKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLL 137

Query: 138 PYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIY 197
           PYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIY
Sbjct: 138 PYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIY 197

Query: 198 QQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXX 257
           QQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRI             
Sbjct: 198 QQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSE 257

Query: 258 XXXVTYDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXXXXXXXXVKYDSLGNVIEES 317
              VTYDNLGNIIENEPREVRYDNLGNII                  VKYDSLGNVIEES
Sbjct: 258 DEEVTYDNLGNIIENEPREVRYDNLGNIIEESSEESSGEEEEDEEEDVKYDSLGNVIEES 317

Query: 318 ESLQKKLDGLNI 329
           ESLQKKLDGLNI
Sbjct: 318 ESLQKKLDGLNI 329

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 217/315 (68%), Gaps = 36/315 (11%)

Query: 23  SNGHHSRHNNKKMEFKQHVSRETS----FPVKLAMWDFDHCDPKRCSGKKLERLNLIRSL 78
           +NGH SRHN+K ME ++H + +TS     PVKL MWDFDHCDPKRCSGKKLERL LI+SL
Sbjct: 22  ANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSL 81

Query: 79  KINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKF---STPKLDR 135
           KI Q+FQG+ +SPNGKK VSPED +++ EFG AVVECSWAR+DEIPFSK    +  K +R
Sbjct: 82  KIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNER 141

Query: 136 LLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLE 195
           LLPYLVAANQVNYGRPWKLNCVEA+AAC AI+G  D A +LLS+FSWG+NFL LN EL E
Sbjct: 142 LLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAADLLSNFSWGMNFLTLNEELFE 201

Query: 196 IYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXX 255
           +Y QCTDSD I+ AQ+AW+++I++E +ERK    AQ+ DIW+ GN NR+           
Sbjct: 202 LYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQ--AQDNDIWLMGNTNRVNDNLRDLTLSD 259

Query: 256 X-------------XXXXVTYDNLGNIIENEPREV--RYDNLGNIIXXXXXXXXXXXXXX 300
                             V YDNLGN+IE+   E+  RYDNLGN+I              
Sbjct: 260 GDEDEEEEDAEDYLTEKSVKYDNLGNVIESSEDEITLRYDNLGNVIEEEEEEK------- 312

Query: 301 XXXXVKYDSLGNVIE 315
                +YD+LGN+IE
Sbjct: 313 -----RYDALGNLIE 322

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 167/276 (60%), Positives = 207/276 (75%), Gaps = 15/276 (5%)

Query: 23  SNGHHSRHNNKKMEFKQHVS-RETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
           SNGH SR N+K+ME +QH   + T FPVK+AMWDFDHCDPKRCSGKKLERL LI SLK+ 
Sbjct: 23  SNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPKRCSGKKLERLGLITSLKVG 82

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNG+  V P+DR +V EFG +VVECSWAR+DE+PF++    K +RLLPYLV
Sbjct: 83  QKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDEVPFNRIGG-KHERLLPYLV 141

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG MDLA +LLS+FSWG+ FL+LN+ELLE+YQ+CT
Sbjct: 142 AANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLELNKELLEVYQKCT 201

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR----IXXXXXXXXXXXXX 257
           D + ++ A++ W+++IE+E Q+RK  N A++ DIWM GNVNR    +             
Sbjct: 202 DHESVKKAEEDWLNKIEEEAQQRK--NEARDGDIWMMGNVNRNMNKMTLSDEESDEEETE 259

Query: 258 XXXVTYDNLGNII-----ENEPR--EVRYDNLGNII 286
              + YDNLGN I     E EP    +RYDNLGN+I
Sbjct: 260 ASSIRYDNLGNAIIDESDEEEPEISSIRYDNLGNVI 295

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 171/302 (56%), Positives = 213/302 (70%), Gaps = 10/302 (3%)

Query: 23  SNGHHSRHNNKKMEFKQH---VSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
           SNGH S+ N+K ME K++   +S++  FPVKLAMWDFDHCDPKRCSGK+LERL LI+SL+
Sbjct: 20  SNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDPKRCSGKRLERLGLIKSLR 79

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139
           + QKFQG+ VSPNGK  + P DRE+V EFG +VVECSWAR+DE+PF+K    K +RLLPY
Sbjct: 80  VGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLDEVPFNKIGG-KHERLLPY 138

Query: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199
           LVAANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLS+FSWG+ FL++N ELL+IYQQ
Sbjct: 139 LVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSWGLGFLEINEELLKIYQQ 198

Query: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXX 259
           CTDS+ ++ A++ W+ +IE+E+QERK    A+  DIWM GN NR                
Sbjct: 199 CTDSESVKKAEEEWLAKIEQEIQERKTQ--ARESDIWMMGNTNR-NMNGDDDEEEGNSYE 255

Query: 260 XVTYDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXXXXXXXXVKYDSLGNVIEESES 319
            ++ D+     EN  +  RYDNLGNII                  VKYDSLGN+IE S+ 
Sbjct: 256 ALSGDDYEE--ENNNKSARYDNLGNII-ESEEDYDDYDDEEDRVEVKYDSLGNIIENSDY 312

Query: 320 LQ 321
            Q
Sbjct: 313 EQ 314

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  336 bits (862), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 214/314 (68%), Gaps = 34/314 (10%)

Query: 22  NSNGHHSRHNNKKMEFK------QHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLI 75
            SNGHH+R N+K+ME K         S+E  FPVKLAMWDFDHCDPKRCSGKKLERL LI
Sbjct: 19  GSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDHCDPKRCSGKKLERLGLI 78

Query: 76  RSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDR 135
           +SL++ QKFQGI VSPNGK  V P+D+E V EFG +VVECSWAR+DE+PF+K    K +R
Sbjct: 79  KSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWARLDEVPFNKIGG-KHER 137

Query: 136 LLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLE 195
           LLPYLVAANQVNYGRPW+LNCVEA+AAC AIVG +DLA ELL HFSWG+ FL+LN+ELLE
Sbjct: 138 LLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEHFSWGLGFLELNKELLE 197

Query: 196 IYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXX------ 249
           +YQ+CTDS+ ++  ++ W+++I+KEVQERK+   ++  DIW+ GN NR            
Sbjct: 198 MYQKCTDSESVKKVEEEWLEKIDKEVQERKS--QSREGDIWLQGNTNRDLQDMSDDEEFD 255

Query: 250 --XXXXXXXXXXXVTYDNLGNII-------ENEPREVRYDNLGNIIXXXXXXXXXXXXXX 300
                        + YDNLGN++         E  EVRYD LGNII              
Sbjct: 256 SEQYYSEENTERKIRYDNLGNVLISEEENESEEEEEVRYDALGNII----------ESEE 305

Query: 301 XXXXVKYDSLGNVI 314
               +KYDSLGN+I
Sbjct: 306 EAAELKYDSLGNLI 319

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/341 (51%), Positives = 213/341 (62%), Gaps = 53/341 (15%)

Query: 23  SNGHHSRHNNKKMEFKQH------------------VSRETSFPVKLAMWDFDHCDPKRC 64
           +NGH SRHN+K ME K+H                  +      PVKL MWDFDHCDPKRC
Sbjct: 66  ANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSVKKIPVKLGMWDFDHCDPKRC 125

Query: 65  SGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIP 124
           SGKKLERL LI+SLKI Q+FQG+ +SPNGKK VSP+D +++ EFG AVVECSWAR+DEIP
Sbjct: 126 SGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIKEFGAAVVECSWARLDEIP 185

Query: 125 FSKFSTP---KLDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFS 181
           FSK +     K +RLLPYLVAANQVNYGRPWKLNCVEA+AAC AI+G  D A +LLS+FS
Sbjct: 186 FSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWASDLLSNFS 245

Query: 182 WGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNV 241
           WG+NFLKLN EL E+Y +CTDSD ++AAQ+ W+D+IE+E  ERK    AQ  DIWM GN 
Sbjct: 246 WGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATERKLQ--AQETDIWMMGNT 303

Query: 242 NRIXXXXXXXXXXX-------------------XXXXXVTYDNLGNIIENEP-------- 274
           NR+                                   + YDNLGN+IE+          
Sbjct: 304 NRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRYDNLGNVIEDTDEEYLSEEE 363

Query: 275 REVRYDNLGNIIXXXXXXXXXXXXXXXXXXVKYDSLGNVIE 315
           +E+RYDNLGN                    ++YDSLGN+IE
Sbjct: 364 KEIRYDNLGN---IIESEEEEEEEKEEGIELRYDSLGNIIE 401

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  331 bits (848), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 200/265 (75%), Gaps = 8/265 (3%)

Query: 22  NSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
            SNGH SR N+K+ME K+  + +T FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ 
Sbjct: 19  GSNGHSSRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVG 77

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNG   V P+D+ +V E G +VVECSWAR+DE+PF+K    K +RLLPYLV
Sbjct: 78  QKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEVPFNKIGG-KHERLLPYLV 136

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPWKLNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLEIYQQCT
Sbjct: 137 AANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCT 196

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXXXV 261
           D+D ++AA+ AW+ +I+KEV+ERK+   A++ DIWM+GNVNR                  
Sbjct: 197 DADSVKAAESAWLVKIQKEVEERKS--QAKDEDIWMTGNVNR----KGTTFLDDNEEEES 250

Query: 262 TYDNLGNIIENEPREVRYDNLGNII 286
           +     +  E+  + +RYD LGN+I
Sbjct: 251 SEVEESDEEEDNGKTLRYDRLGNLI 275

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 194/265 (73%), Gaps = 6/265 (2%)

Query: 23  SNGHHSRHNNKKMEFKQ-HVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
           SNGHH+R N++ ME K    S+++SFPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ 
Sbjct: 22  SNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVG 81

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNGK  V P+DRE+V   G +VVECSWAR++E+PF+K    K +RLLPYLV
Sbjct: 82  QKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVPFNKIGG-KHERLLPYLV 140

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG  DLA ELLSHFSWG+ FL+LN++LLE YQQCT
Sbjct: 141 AANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQCT 200

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXXXV 261
           DS+ I+  ++ W+ QI++EVQERK    AQ  D+WM GN NR                  
Sbjct: 201 DSESIKKVEEDWLQQIDQEVQERKLK--AQTEDVWMMGNTNRGNSGLMPPSDSEEEYEEE 258

Query: 262 TYDNLGNIIENEPREVRYDNLGNII 286
             +   +      + VRYDNLGNII
Sbjct: 259 AEEEEEDTTTR--KNVRYDNLGNII 281

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  326 bits (835), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/267 (59%), Positives = 197/267 (73%), Gaps = 8/267 (2%)

Query: 20  RTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
           +  SNGH SR N+K+ME K   S  + FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL+
Sbjct: 16  QKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLR 75

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139
           + QKFQG+ VSPNGK  V P+D+ LV E G +VVECSWAR+DE+PF+K    K +RLLPY
Sbjct: 76  VGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVPFNKIGG-KNERLLPY 134

Query: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199
           LVAANQVNYGRPW+LNCVEA+AAC AIVG  DLA +LLS+FSWG  FL+LN+ELL+IYQQ
Sbjct: 135 LVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQ 194

Query: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXX 259
           CTD D ++AA++ W+ +IE+E  ERK    A+  DIWM GNVNR                
Sbjct: 195 CTDHDSVKAAEEKWLQKIEQEAIERK--QQAKTEDIWMIGNVNRASRDLPGSSGEEEEED 252

Query: 260 XVTYDNLGNIIENEPREVRYDNLGNII 286
            +  D+L ++     R+++YD+LGN+I
Sbjct: 253 YLNGDSLIDV-----RDIKYDSLGNVI 274

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  323 bits (828), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/305 (52%), Positives = 202/305 (66%), Gaps = 19/305 (6%)

Query: 20  RTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
           +  +NGH +R N+K ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LIRSL+
Sbjct: 17  QRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKRCSGKKLERLGLIRSLR 76

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139
           + QKFQG+ VSPNG+  V P D E+V + G +VVECSWAR++E+PF+K    K +RLLPY
Sbjct: 77  VGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEVPFNKIGG-KYERLLPY 135

Query: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199
           LVAANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL LN+ELLEIYQ+
Sbjct: 136 LVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGLGFLDLNKELLEIYQR 195

Query: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXX 259
           CTD+D ++ A+  W++++E E QERK+  + +  DIWM GN+NR                
Sbjct: 196 CTDADSVKKAEKEWLEKLEMETQERKS--HTKKTDIWMMGNINR------RGNGVQSDEL 247

Query: 260 XVTYDNLGNIIENEPREVRYDNLGN----------IIXXXXXXXXXXXXXXXXXXVKYDS 309
               D+  + +EN  + + YD LGN          I+                  V YDS
Sbjct: 248 ESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGENEKPVNYDS 307

Query: 310 LGNVI 314
           LGN+I
Sbjct: 308 LGNLI 312

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  322 bits (825), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 195/277 (70%), Gaps = 15/277 (5%)

Query: 22  NSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
            S+ H+ + N ++ E K   ++ET FP KLAMWDFDHCDPKRCSGKKLERL LI+SL+I 
Sbjct: 18  GSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIG 77

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNGK  V P D+E+V + G +VVECSWAR+DEIPFSK    + +RLLPYLV
Sbjct: 78  QKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIPFSKIGG-RHERLLPYLV 136

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEAIAAC AIVG  DLAEELLSHFSWG  FL+LN+ELLE YQQCT
Sbjct: 137 AANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCT 196

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXX------XXX 255
           D   I+AA++AW+ ++E+E ++R+   + +  DIWM GNVNR                  
Sbjct: 197 DHASIKAAEEAWLQKLEEEAEQRRKQTHEE--DIWMMGNVNRKAPNMRSSMLDSDDNSDS 254

Query: 256 XXXXXVTYDNLGNIIENE------PREVRYDNLGNII 286
                V +D + +  E E       R+V YD+LGN+I
Sbjct: 255 EYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  322 bits (824), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/299 (54%), Positives = 200/299 (66%), Gaps = 39/299 (13%)

Query: 22  NSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
            +NGH SR N+++ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ 
Sbjct: 19  GANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVG 78

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNGK  V P+D E+V + G +VVECSWAR++E+PF+K    K +RLLPYLV
Sbjct: 79  QKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIGG-KHERLLPYLV 137

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLEIYQQCT
Sbjct: 138 AANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCT 197

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR----------IXXXXXXX 251
           D+D ++ A++ W+ ++EKE QERK+   A+  DIWM GN+NR                  
Sbjct: 198 DADSVKRAEEEWLQKLEKETQERKS--QAKEEDIWMMGNINRRGGGWQSDESESGGSSGE 255

Query: 252 XXXXXXXXXVTYDNLGNII------------------------ENEPREVRYDNLGNII 286
                    V YD+LGN I                          EP  V YD+LGN+I
Sbjct: 256 SESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEENKEP--VSYDSLGNLI 312

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  322 bits (826), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/303 (54%), Positives = 205/303 (67%), Gaps = 19/303 (6%)

Query: 22  NSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
            +NGH SR N+K+ME K   S  T+FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ 
Sbjct: 43  GANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVG 102

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNG   V P+D E+V + G +VVECSWAR++E+PF+K    K +RLLPYLV
Sbjct: 103 QKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEVPFNKIGG-KHERLLPYLV 161

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG MD A  LLSHFSWG+ FL LNRELLEIYQ+CT
Sbjct: 162 AANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGLGFLDLNRELLEIYQKCT 221

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXXXV 261
           DS+ ++ A++ W+ ++EKE QERK+   +++ DIWM GNVNR                  
Sbjct: 222 DSNSVKKAEEEWLQKLEKETQERKSQ--SKDEDIWMMGNVNR------KDNGAQSDESES 273

Query: 262 TYDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXXXXXXXX----------VKYDSLG 311
             D+  + +E++ + + YD+LGN I                            V YDSLG
Sbjct: 274 EEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKMLSEGSEDEESEFEEDEEPVSYDSLG 333

Query: 312 NVI 314
           N+I
Sbjct: 334 NII 336

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  320 bits (821), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 148/221 (66%), Positives = 180/221 (81%), Gaps = 3/221 (1%)

Query: 23  SNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQ 82
           +NGH SR N+++ME K   S +  FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL++ Q
Sbjct: 20  ANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQ 79

Query: 83  KFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVA 142
           KFQGI VSPNGK  V P+D E+V + G +VVECSWAR++E+PF+K    K +RLLPYLVA
Sbjct: 80  KFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEVPFNKIGG-KHERLLPYLVA 138

Query: 143 ANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTD 202
           ANQVNYGRPW+LNCVEA+AAC AIVG MD A ELLSHFSWG+ FL+LN+ELLEIYQQCTD
Sbjct: 139 ANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGMGFLELNKELLEIYQQCTD 198

Query: 203 SDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243
            D ++ A++ W+ ++EKE QERK+   A+  DIWM GN+NR
Sbjct: 199 CDSVKRAEEEWLQKLEKETQERKS--RAKEEDIWMMGNINR 237

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  319 bits (818), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/221 (66%), Positives = 178/221 (80%), Gaps = 3/221 (1%)

Query: 23  SNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQ 82
           SNGH SR N++++E K +  + + FPV LAMWDFDHCDPKRCSGKKLERL LI+SL++ Q
Sbjct: 18  SNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRCSGKKLERLGLIKSLRVKQ 77

Query: 83  KFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVA 142
           KFQGI VSPNGK  V P DRE+  ++G +VVECSWAR++EIPF K    + +RLLPYLVA
Sbjct: 78  KFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPFEKIGG-RHERLLPYLVA 136

Query: 143 ANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTD 202
           ANQVNYGRPW+LNCVEA+AAC AIVG MDLAE LLSHFSWG+ FL+LN+E+LEIYQ+CTD
Sbjct: 137 ANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGFLELNKEILEIYQKCTD 196

Query: 203 SDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243
            D I+AA++AW+ QIE E  ER+     +  DIWM GNVNR
Sbjct: 197 HDSIKAAEEAWLKQIETEAMERRKQ--TKENDIWMMGNVNR 235

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  313 bits (802), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 184/225 (81%), Gaps = 6/225 (2%)

Query: 23  SNGHHSRHNNKKMEFKQHV---SRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
           +NGH+S+ N+K ME K      S +T+FPVKL MWDFDHCDPKRCSGKKLERL LIRSL+
Sbjct: 20  ANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDPKRCSGKKLERLGLIRSLR 79

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139
           + QKFQG+ V+PNG   V P D+ +V E G +VVECSWAR+DE+PF++    + +RLLPY
Sbjct: 80  VGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARLDEVPFNRIGG-RHERLLPY 138

Query: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199
           LVAANQVNYGRPWKLNCVEA+AAC AIVG MD A ELLS+FS+G +FL++N ELLEIYQQ
Sbjct: 139 LVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSYGPSFLEINAELLEIYQQ 198

Query: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRI 244
           CTD++ ++ A+ AW+++IEKE+++RKA   A+N DIWM+GNVNR+
Sbjct: 199 CTDAESVKDAESAWLEKIEKEIKDRKAQ--AKNEDIWMTGNVNRM 241

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  317 bits (813), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 149/224 (66%), Positives = 180/224 (80%), Gaps = 5/224 (2%)

Query: 22  NSNGHHSRHNNKKMEFKQ--HVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
            +NGH SR N+K+ME K+    S    FPVKLAMWDFDHCDPKRCSGKKLERL LI+SL+
Sbjct: 19  GANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLR 78

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPY 139
           + QKFQGI VSPNG+  V P DR +V E G +VVECSWAR+DE+PF +    K +RLLPY
Sbjct: 79  VGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDEVPFGRIGG-KHERLLPY 137

Query: 140 LVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQ 199
           LVAANQVNYGRPW+LNCVEA+AAC AIVG  DLA ELLS+FSWG+ FL+LN+ELLEIYQQ
Sbjct: 138 LVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWGLGFLELNKELLEIYQQ 197

Query: 200 CTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR 243
           CTD+D ++AA++AW+ +IE+E Q+RK  +  +  DIWM GNVNR
Sbjct: 198 CTDADSVKAAEEAWLKKIEEEAQQRKQQSKEE--DIWMMGNVNR 239

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  313 bits (803), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 197/298 (66%), Gaps = 22/298 (7%)

Query: 23  SNGHHSRHNNKKMEFKQHVSRE-TSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81
           S+GH S H  + +E K   ++   +FPVKLAMWDFD CDPKRCSGKKLERL +I+SL++ 
Sbjct: 22  SSGHTSTH--RHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVG 79

Query: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141
           QKFQGI VSPNGK  V P DR +V E G AVVECSWAR+DE+PF+K    + +RLLPYLV
Sbjct: 80  QKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPFNKIGG-RNERLLPYLV 138

Query: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG +DLA ELLSHFSWG+ FL+LN+ELLE+YQ+CT
Sbjct: 139 AANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCT 198

Query: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXXXXV 261
           D+D I+ A+DAW++QIEKE QERKA N     D+W++GNVN                   
Sbjct: 199 DADSIKKAEDAWLEQIEKEAQERKARNPGD--DLWLTGNVNHKKGHGVTQNENKDEAEVG 256

Query: 262 TYDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXXXXXXXXVKYDSLGNVIEESES 319
           +    G   E E  E   D                        VKYDSLGN I  SES
Sbjct: 257 STWEQGENSEYESDESAADG----------------EEAYHGPVKYDSLGNEITLSES 298

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  306 bits (783), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 196/305 (64%), Gaps = 21/305 (6%)

Query: 20  RTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLK 79
           R+N   ++SR N  K       S +T+FPVKLAMWDFDHCDPKRCSGKKLER  L +SL+
Sbjct: 12  RSNRKSNNSRRNESKHSLSIK-STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLR 70

Query: 80  INQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKF-STPKLDRLLP 138
           + Q+F G+ VSPNGK+ VSP DRE + ++G AVVECSWAR+DE+PF+K    P  + LLP
Sbjct: 71  VGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLP 130

Query: 139 YLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQ 198
           YLVAAN VNYGRPW+LNCVEA AACLAIVGF + A ++L  FSWG  FL+LN ELL+IY 
Sbjct: 131 YLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYG 190

Query: 199 QCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNRIXXXXXXXXXXXXXX 258
            CTDS  +E AQD W+++IE E +ERK   N+   D W+ GN NR               
Sbjct: 191 NCTDSISVEKAQDEWLEKIELENKERKEKMNS--ADAWLIGNTNRKNLNDFDNSSESTED 248

Query: 259 XXVT-------YDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXXXXXXXXVKYDSLG 311
              T       YD LGN+I N+   ++YD+LGN+I                   KYD LG
Sbjct: 249 NISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPP----------KYDKLG 298

Query: 312 NVIEE 316
           N+IE+
Sbjct: 299 NIIED 303

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  302 bits (774), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 206/321 (64%), Gaps = 19/321 (5%)

Query: 25  GHHSRHNNKKMEFKQHVSRET-SFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQK 83
           GH +R ++  +E K        +FPVKLAMWDFD CDPKRCSGKKLERL +I+SL++ QK
Sbjct: 17  GHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQK 76

Query: 84  FQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLVAA 143
           FQGI VSPNGK  V P D+++V E G AVVECSWAR++EIPF+K    + +RLLPYLVAA
Sbjct: 77  FQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGG-RNERLLPYLVAA 135

Query: 144 NQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTDS 203
           NQVNYGRPW+LNCVEA+AAC AIVG MDLA ELL+HFSWG+ FL+LN+EL+E+YQ+CTD+
Sbjct: 136 NQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDA 195

Query: 204 DEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR--------IXXXXXXXXXXX 255
           + ++ A+ +W+++IE+E  ER+  N++   D+WM+GNVNR                    
Sbjct: 196 ESVKEAEASWLEKIEREANERR--NHSATDDLWMTGNVNRRSPLGNDTESSQEESENSVD 253

Query: 256 XXXXXVTYDNLGNIIENEPREVRYDNLGNIIXXXXXXXXXXXX----XXXXXXVKYDSLG 311
                   +       N  R V+YDNLGN I                       K+DSLG
Sbjct: 254 TGDEEDDDNEDDYATGNRKRVVKYDNLGNEIYPSESSESSEERDDLDEQEEVKYKFDSLG 313

Query: 312 NVI---EESESLQKKLDGLNI 329
           N+I    E+ +L + L  L I
Sbjct: 314 NIIGKEHENGTLNESLSKLTI 334

>Ecym_4164 Chr4 complement(348576..350069) [1494 bp, 497 aa] {ON}
           similar to Ashbya gossypii AGL111W
          Length = 497

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 85/198 (42%), Gaps = 31/198 (15%)

Query: 21  TNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKI 80
           + SN        KK+ F +++ ++ S PVK ++   ++  P     K    ++++R  K 
Sbjct: 263 SESNDRPEEDKKKKISFSKYLKKDVSEPVKRSLSPDENAQPIVKKQKFESPVSILRDGKK 322

Query: 81  NQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKF--STPKLDRLL- 137
            +K   I       +FV  +D +LVT FG           D++P S    S  +L ++L 
Sbjct: 323 TKKRSVI-------RFV--DDCKLVTVFG-----------DDLPDSGVITSPDRLKKILN 362

Query: 138 PYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAE--------ELLSHFSWGVNFLKL 189
           PY+    +      W+   V  +   + I+   D++E              ++ +NF K 
Sbjct: 363 PYVEGEPREFLLENWRTQKVHKLIIDVGIIEDSDISEFRNGPIATSTKVPTAYRLNFTKF 422

Query: 190 NRELLEIYQQCTDSDEIE 207
           N +L   +++  D++E E
Sbjct: 423 NEDLANFHKEPVDNEEEE 440

>Skud_10.310 Chr10 (545082..547961) [2880 bp, 959 aa] {ON} YJR089W
           (REAL)
          Length = 959

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 71  RLNLIRSLKINQKFQGITVSP-NGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFS 129
           ++NL RSL  +++F G + +P N + F +  +     E+ C   E S    +E+P  +  
Sbjct: 697 KINLTRSLHTDEEFSGFSGNPANNEDFTNKRETIKTVEYPCVKNEISS---NELPIFETG 753

Query: 130 TP 131
           TP
Sbjct: 754 TP 755

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,100,716
Number of extensions: 1222235
Number of successful extensions: 3738
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3730
Number of HSP's successfully gapped: 30
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)