Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003806.17ON54054025350.0
KNAG0M011406.17ON59459614340.0
NCAS0H008706.17ON61260712541e-166
Skud_5.276.17ON61561612141e-160
TDEL0G045206.17ON67968712141e-160
Suva_5.56.17ON61962212081e-159
ZYRO0C07876g6.17ON68166811591e-151
Kpol_1045.726.17ON69569310921e-141
KLLA0D01067g6.17ON66067110751e-139
SAKL0E01100g6.17ON71054810691e-137
KLTH0C11308g6.17ON69069110491e-135
Kwal_56.224116.17ON68969210371e-133
CAGL0L13288g6.17ON64647910281e-132
Ecym_30216.17ON67467510291e-132
TBLA0G010106.17ON71052110281e-131
YEL062W (NPR2)6.17ON6153529831e-126
Smik_5.256.17ON6153529741e-124
ACR009W6.17ON6806769551e-121
NDAI0D008606.17ON6664438211e-101
TPHA0J003106.17ON6754677194e-86
Kpol_1004.325.541ON98899870.068
Ecym_21156.303ON37960689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00380
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   981   0.0  
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   556   0.0  
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   487   e-166
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   472   e-160
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   472   e-160
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    469   e-159
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   451   e-151
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   425   e-141
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   418   e-139
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   416   e-137
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   408   e-135
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   404   e-133
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   400   e-132
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   400   e-132
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   400   e-131
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   383   e-126
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   379   e-124
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   372   e-121
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   320   e-101
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   281   4e-86
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    38   0.068
Ecym_2115 Chr2 (216638..217777) [1140 bp, 379 aa] {ON} similar t...    31   9.5  

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/540 (90%), Positives = 487/540 (90%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LTLEYKNYRL            AR            YDCQTLPYEPAIERLGKMFKTLEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQILSKSQRTSAFFKDGEDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIK 180
           QSQILSKSQRTSAFFKDGEDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIK
Sbjct: 121 QSQILSKSQRTSAFFKDGEDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIK 180

Query: 181 IFPVLKPPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSD 240
           IFPVLKPPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSD
Sbjct: 181 IFPVLKPPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSD 240

Query: 241 PNLVIECIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKI 300
           PNLVIECIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKI
Sbjct: 241 PNLVIECIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKI 300

Query: 301 NDLPLASEQDDEINNSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXE 360
           NDLPLASEQDDEINNSDMTQKAL               AYARVSE              E
Sbjct: 301 NDLPLASEQDDEINNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSE 360

Query: 361 GQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINK 420
           GQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINK
Sbjct: 361 GQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINK 420

Query: 421 IIYRVHQYPIMEHKTFKSPLLSDRQNDKIVLSTSDIKFDVGDRILNSIYNKLSKVTFDRD 480
           IIYRVHQYPIMEHKTFKSPLLSDRQNDKIVLSTSDIKFDVGDRILNSIYNKLSKVTFDRD
Sbjct: 421 IIYRVHQYPIMEHKTFKSPLLSDRQNDKIVLSTSDIKFDVGDRILNSIYNKLSKVTFDRD 480

Query: 481 KKLESKIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTINS 540
           KKLESKIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTINS
Sbjct: 481 KKLESKIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/596 (48%), Positives = 376/596 (63%), Gaps = 60/596 (10%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M ++FEGF PIHT+F++IFHPTEGSKVCYQFPP NLQ Y+INFD+IKN++IPKPQLCHRL
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT++Y NYR+            AR            Y+C T PYEPAI RLGKMF+ LEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQILSKSQRTSAFFKDGEDVDFVDTK------------------------------FSI 150
           QSQ+LS+++R  + FK G+ + F +                                 S+
Sbjct: 121 QSQVLSRAERDDSLFK-GDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHLISV 179

Query: 151 QDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLDKIVD 210
           QDL+MR+YQDLNNYSECLIPIDEGN I+IKIFP++ PPTSV +SIEDVP+ +V L KI+D
Sbjct: 180 QDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIID 239

Query: 211 LNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFSNIYA 270
           LNWDPTM+SILPFI+GVNSI NI+ LSDSDP LVIECIKHLIYY CVIITDIFQFSNIYA
Sbjct: 240 LNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYA 299

Query: 271 PSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINN-----SDMTQKALXX 325
           PSSLIN FL DP +A++CQ YV LP  S++  +PL +      NN     + ++   +  
Sbjct: 300 PSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKHKKSNSLSSTGVLS 359

Query: 326 XXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQDNPRQGQVLPSKCTLFDLYRSL 385
                         Y+  ++               G+ D+       P++  LFDLYRSL
Sbjct: 360 WQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDD--HTIYYPTRMVLFDLYRSL 417

Query: 386 NYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHK--------TFK 437
           + G T+E WY  NF+TI+ N+IDVRKFI+FG I KIIYRV  YP++E +          K
Sbjct: 418 SQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGK 477

Query: 438 SPLLSDRQNDK-IVLSTSDIKFDVGDRILNSIYNKLSKVTFD------RDKKLESKIGNS 490
           S +     + K    STSDIKFD GDR+ NS+Y + SKV+F+      R++K    +G +
Sbjct: 478 SKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGT 537

Query: 491 RN-------LGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539
                    L + EK  L  AL+  ESFD+IC +LG+S+ E+ ++I++IGEY  IN
Sbjct: 538 NGADKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  487 bits (1254), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 270/607 (44%), Positives = 362/607 (59%), Gaps = 79/607 (13%)

Query: 4   QFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTL 63
            FEGF PIHTIF+SIFHPTEG+KVCY+FPP+NL  ++INFD+IKN++IPK QLC+RLLT 
Sbjct: 11  HFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLTF 70

Query: 64  EYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEEQSQ 123
           +Y+NYR+            AR            Y+C+T PYEP+I RLGKMFK LEEQSQ
Sbjct: 71  KYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQSQ 130

Query: 124 ILSKSQRTSAFFKD-----------------------------------------GEDVD 142
           ILSK++    +FK                                          GE+ D
Sbjct: 131 ILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEED 190

Query: 143 FVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSI 202
            V TKFS+QDL+MR+YQDLNNYSECLIPID+GN+INIK+FP+LKPP +  IS+EDVP+S+
Sbjct: 191 GV-TKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSL 249

Query: 203 VNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDI 262
           +NL+ ++D+NWDPTML+I+P+I+GVN I+ I+ L+ +DP LVIECIKHL+YYNCVIITDI
Sbjct: 250 INLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDI 309

Query: 263 FQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKA 322
           FQFSN+YAP+SLI +FL D  +A  CQ+YVVLP GSK++ LP       E N +      
Sbjct: 310 FQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF------ENNGNKQPSTP 363

Query: 323 LXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQDNPR-QGQVLPSKCTLFDL 381
                                S                   +NP  +   LP+K  LFDL
Sbjct: 364 KHSRTTSLSSSMSGSVNSHEHSYMDTIQKSETSLSLSSTDPNNPHFELAHLPTKACLFDL 423

Query: 382 YRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTFKSPLL 441
           YRSL+YG T+ +WY+ N + I EN++DVRKFIKFG+I  +IYR H YPI +  + +    
Sbjct: 424 YRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIPQRPSNEGIQR 483

Query: 442 SDRQND----KIVLSTSD-------------------IKFDVGDRILNSIYNKL---SKV 475
            +R ND    ++ + +S                    I  D  D +L ++Y KL   SKV
Sbjct: 484 IERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERHSKV 543

Query: 476 TFDRDKKLES----KIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISE 531
           +F   +K ES    + G    + + E+++L  ++E  E+ D+IC KLGKS+ +VE  + E
Sbjct: 544 SFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKSRQQVERWLDE 603

Query: 532 IGEYMTI 538
           +G Y  I
Sbjct: 604 LGNYKII 610

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  472 bits (1214), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 264/616 (42%), Positives = 357/616 (57%), Gaps = 77/616 (12%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++IKN++IPKP LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T +Y  YR+            AR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141
           Q+Q+LSKS++ + FF                                   KD +D+    
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 142 --------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193
                      ++ FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239

Query: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253
           S+EDVPLS VNL KI+D+NWDPTM+SI+P+IDG+NSI  IS LS SDP+LVIECI+HLIY
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299

Query: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEI 313
           Y CV ++DIFQFSNIYAPSSLI  FL D ++A +CQSYV  P  SK++ LPL+   D   
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 359

Query: 314 NNS-DMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXX-------------XXXXXXXXX 359
            +S  +  +                 +++  S+                           
Sbjct: 360 RDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSS 419

Query: 360 EGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVIN 419
              + N  + + LP++  LFDLYRSL+ G T+++WY+   + +KEN+IDVR+FI FG+  
Sbjct: 420 SNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLER 479

Query: 420 KIIYRVHQYPIM------EHKTFKSPLLSDRQNDKIVL--STSDIKFDV-----GDRILN 466
           +IIYR + +P+M      E K     +L D  ND   L     D  F V       +  N
Sbjct: 480 RIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNN 539

Query: 467 SIYNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKNE 524
               + SKV+F+  +      G +    L + E+ IL N++   ESFD IC  L KSK E
Sbjct: 540 VKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLE 599

Query: 525 VESIISEIGEYMTINS 540
           VE+ ++E+GE+  INS
Sbjct: 600 VENYLNELGEFKVINS 615

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  472 bits (1214), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/687 (40%), Positives = 370/687 (53%), Gaps = 155/687 (22%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M  QFEGF PIHTIF+++FHPTEG+KV Y+FPP NL+++NINFD+IKN++IPKPQLCH+L
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LTL+YKNYR+            AR            YDCQT PYEPAI RLGKMFK LEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFF-------KDGED-----------------------------VDFV 144
           Q+ ILSK+++   F+       KD +D                             ++  
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180

Query: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204
           D+ FS++DL++R+YQDLNNYSECLIPIDEGN ++IKIFP++ PP S  ISIEDVP+S VN
Sbjct: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNS-NISIEDVPVSTVN 239

Query: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264
           L+K++D+NWDPTML I+P+I+G+NSI+ I+ LS SDP LVIECIKHLIYYNCV++ DIFQ
Sbjct: 240 LNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQ 299

Query: 265 FSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL------ASEQ-DDEINNSD 317
           FSNIYAP+S +  FL D +++  CQSYVV    S +  LP       A+E  D E+ +S 
Sbjct: 300 FSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATESVDHELADSH 359

Query: 318 MTQKALXXXXXXXXXXXXXXXAY-----ARVSEXXXXXXXXXXXXXXEGQQDNPRQ--GQ 370
            +Q+                 +      A +SE                   NP     +
Sbjct: 360 RSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNMLAR 419

Query: 371 VLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPI 430
            LP+K  LFDLYRSL+ G ++  WY  ++ TI+ N IDVR+FI FGVIN +IYR + YPI
Sbjct: 420 YLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPI 479

Query: 431 M----------------------EHKTFKSPLLSDRQNDKIVLSTSDIKF---------- 458
           M                      +H   K+P        K + STSDIKF          
Sbjct: 480 MKNLEIFDLAKRLHREDISNHTVKHNKAKNP-------SKNIFSTSDIKFGVEYERQRNK 532

Query: 459 -------DVGDRILNSIYNKL--------------------------------------- 472
                  D+ D +L ++Y KL                                       
Sbjct: 533 HHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRL 592

Query: 473 ------SKVTFDRDKKL------------ESKIGNSRNLGESEKN-ILFNALERHESFDR 513
                 SKV+FD+ +++            + K+     L   E++ IL  ++E  +S D 
Sbjct: 593 QNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDT 652

Query: 514 ICSKLGKSKNEVESIISEIGEYMTINS 540
           IC KL  S+ +VE++I  +GEY  INS
Sbjct: 653 ICVKLEMSRYDVEALIQNLGEYKIINS 679

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  469 bits (1208), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 265/622 (42%), Positives = 356/622 (57%), Gaps = 85/622 (13%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+++ INF++IKN++IPKP LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T +Y  YR+            AR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141
           Q+Q+LSKS+R   FF                                   KD +D+    
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 142 -------------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPP 188
                           ++ FSIQDLLMR++QDLNNYSECLIPID+GN ++IKIFP+L+PP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 189 TSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECI 248
           T+  +S+EDVPLS VNL KI+D+NWDPTM+ I+P+IDG+NSI  IS  S SDP+LVIECI
Sbjct: 241 TTC-VSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECI 299

Query: 249 KHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASE 308
           +HLIYY CV ++DIFQFSNIYAPSSLI NFL DP++A +CQSYV  P  SK+++LPL   
Sbjct: 300 RHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKN 359

Query: 309 QDDEINNSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQDNPRQ 368
            D    + D+T  ++                    S                    + RQ
Sbjct: 360 FDSV--DQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQ 417

Query: 369 GQV----------------LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKF 412
            Q                 LP++  LFDLYRSL+ G T+++WY+  F+T+KEN+ID+R+F
Sbjct: 418 SQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRF 477

Query: 413 IKFGVINKIIYRVHQYPIMEH------KTFKSPLLSDRQNDKIVLSTSDIKFDV---GDR 463
           I FG+   IIYR + +P+M H      K        +  N+   L   D    +   G +
Sbjct: 478 ITFGLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSK 537

Query: 464 I---LNSIYNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKL 518
                N    + SKV+F+  +      G ++   L + EK IL  ++   E+FD+IC  L
Sbjct: 538 STTQTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLL 597

Query: 519 GKSKNEVESIISEIGEYMTINS 540
           GKSK EVE+ +SE+GE+  INS
Sbjct: 598 GKSKQEVENYLSELGEFKVINS 619

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  451 bits (1159), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 262/668 (39%), Positives = 358/668 (53%), Gaps = 129/668 (19%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M  QFEGF PIHT+F+++FHPT+G++V Y++PP NL+  NINFD+IKN++IPKPQLCH+L
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LTL+YK YR+            AR            YDC+T  YEPAI RLGKMF+ LEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQILSKSQRTSAFF----------KDG--------------------------EDVDFV 144
           Q+QILSK++    +F          +DG                          +D++  
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLESE 194

Query: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204
            + FS+QDL+MR++QDLNNYSECLIPIDEGN ++IKIFP+  PP S  ISIEDVP+S VN
Sbjct: 195 KSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPISTVN 253

Query: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264
           L  I+D+NWDPTML I+P+IDG+NSI+ I+ LSDSD +LV+EC+KHL+YYNCVI+ DIFQ
Sbjct: 254 LKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQ 313

Query: 265 FSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALX 324
           FSNIYAP+SLI  FL DP +A  CQS+V L   S ++++P    +  ++++ D ++    
Sbjct: 314 FSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQSKNQES 373

Query: 325 XXXXXXXXXXXXXXA-----YARVSEXXXXXXXXXXXXXXEGQQDNPRQGQVLPSKCTLF 379
                         +     Y+                            + LP+K  LF
Sbjct: 374 GSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQSSFSSTNTNVTHDLARHLPTKACLF 433

Query: 380 DLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIME------- 432
           DLYR+L+ G TV  WY  N+ TIK+N IDVR+FI FGVI  +IYR   +P+M+       
Sbjct: 434 DLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFPVMKKMSIFDL 493

Query: 433 -HK----------TFKSPLLSDRQNDKIVLSTSDIKF------------DVGDRILNSIY 469
            HK          T K     +    K V STSD+K             D+ D +L ++Y
Sbjct: 494 AHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLGEGSKMHQNFSVDIADEVLRNVY 553

Query: 470 NKL-------------------------------------------SKVTFDRDK----- 481
            KL                                           SKV FD +K     
Sbjct: 554 KKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVP 613

Query: 482 ------KLESKIGNSRNLGESEKN---ILFNALERHESFDRICSKLGKSKNEVESIISEI 532
                 K ++K   +  L  ++ N   IL  ++   +  D+IC KL K ++EVE ++ E+
Sbjct: 614 YSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHEL 673

Query: 533 GEYMTINS 540
           G+Y  INS
Sbjct: 674 GDYKIINS 681

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  425 bits (1092), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 265/693 (38%), Positives = 356/693 (51%), Gaps = 158/693 (22%)

Query: 5   FEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTLE 64
           F+GFEPIHTIF+S+FHPTEG KVCYQFPP NL  Y+INFDSI+++VIPKPQLC++LLTL+
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGK----------- 113
           Y NYR+            AR            Y+C+T PYE  I +LGK           
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 114 ----------------MFKTLEEQSQIL----------------------------SKSQ 129
                           +  +L++ S++                             SK  
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 130 RTSAFFKDGEDVDFV---DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLK 186
            +  F K  E  +FV   ++ FSIQD +MRLYQDLNNYSECLIPID GN ++IK+FP+L+
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 187 PPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIE 246
           PP +  ISIEDVP+S VNL +I+D+NWDPTML I+P IDGVNSI  I+ LSDSD  LVIE
Sbjct: 244 PPPAT-ISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIE 302

Query: 247 CIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLA 306
           CIKH IYY CV+I+DIFQFSNIYAP+SL+ NFL DP++A  CQ+YV +P  S ++ LPL 
Sbjct: 303 CIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLE 362

Query: 307 S----EQDDEINNSDMTQKALXXXXXXXXXXXXXXXAYAR------VSEXXXXXXXXXXX 356
           S    + D + ++S   +K+                A +        S            
Sbjct: 363 SLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRSE 422

Query: 357 XXXEGQQDNPRQGQV--LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIK 414
                Q  N   G V  LP++ TLFDLYRSL+ G T++ WYK+NF  I+ N ID+RKFI 
Sbjct: 423 SSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFII 482

Query: 415 FGVINKIIYRVHQYPIMEH--KTFKSPLLSDRQN------DKI-------VLSTSDIK-- 457
           FG+IN ++YR   +P+  +  +  K     D QN      DK+       + STSDIK  
Sbjct: 483 FGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQDIFSTSDIKVG 542

Query: 458 ---------------FDVGDRILNSIYNK------------------------------- 471
                           D+ D +L ++Y K                               
Sbjct: 543 EDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFES 602

Query: 472 -------------LSKVTFDRDKKLE-----------SKIGNSRNLGESEKNILFNALER 507
                        LSKV+F ++  ++             I N   L +  + IL  ALE 
Sbjct: 603 SNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEALES 662

Query: 508 HESFDRICSKLGKSKNEVESIISEIGEYMTINS 540
            E+ D+IC  L K ++EVE ++  + ++  INS
Sbjct: 663 TENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  418 bits (1075), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 254/671 (37%), Positives = 352/671 (52%), Gaps = 142/671 (21%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M + F+GF PIHT+F+++FHPTEGSKV +QFPP +L+   I+FD+IKN++IPKPQLC++L
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT +Y  YR+            AR            YDC T PYEPAI RLGKMFK LEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFFK-------------------------------DGEDVDFVDTKFS 149
           QSQILSKS++   +F+                               DGE    +  + +
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLEIIKELA 180

Query: 150 -------IQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSI 202
                  I+DLLM+L+ DLNNYSECLIPIDEGN I+IK+FPV  PP+S  IS+EDVP+++
Sbjct: 181 KNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS-NISVEDVPIAV 239

Query: 203 VNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDI 262
           VNL  I+D+NWDPTM+ I+P+I+G+NS+  I+  + SD  LV ECIKHL+YYNCVI++DI
Sbjct: 240 VNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDI 299

Query: 263 FQFSNIYAPSSLINNFLRDPMIAFNCQSYV------------------VLPPGSK-INDL 303
           FQFSNIYAP+S I+NFL +P +A  CQ +V                  + P G K  +  
Sbjct: 300 FQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSLKQSLLPFEGRPNNIYPTGRKQASTS 359

Query: 304 PLASEQDDEINNSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQ 363
            + S + D  + +     +                +Y R                  G+ 
Sbjct: 360 TVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLAT-------GEN 412

Query: 364 DNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIY 423
              R   +LP++  LFDLY+SL+ G TV+ WYKQNF  I++N IDVRK I FG+  ++IY
Sbjct: 413 QMKR---ILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIY 469

Query: 424 RVHQYPIMEHKTFKSPLLS----------DRQNDKIVLSTSDI-------------KFDV 460
           RV+ YPI+++      L S             + K + S +DI             K D 
Sbjct: 470 RVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDA 529

Query: 461 GDRILNSIYNKLS---------------------------------------KVTFDRDK 481
            D +L S+Y KLS                                       KV+FD   
Sbjct: 530 ADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGT 589

Query: 482 KLESK-IGNSRNLGESEKN-----------ILFNALERHESFDRICSKLGKSKNEVESII 529
             + K +    +LG+ EK            IL  +L   E+FD++C+KL KS++EVE ++
Sbjct: 590 AGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLL 649

Query: 530 SEIGEYMTINS 540
            ++G Y  +NS
Sbjct: 650 KDLGHYNIVNS 660

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  416 bits (1069), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/548 (42%), Positives = 305/548 (55%), Gaps = 89/548 (16%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M++ F+GF PIHT+F+S+FHPTEG+KV YQFPP NL+  +INFD+IKN+VIPKPQLC++L
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT +Y  YRL            AR            Y+C T PYEPA+ RLGKMF+ LEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQILSKSQRTSAFF------------------------KDGE----------------- 139
           QSQILSK++    +F                        KD E                 
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 140 ---------------DVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPV 184
                          D++    + SI+DL+ +LYQDLNNYSEC IPID GN ++IK+FP+
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 185 LKPPTSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLV 244
           L PP S  +S EDVP+S VNL K++D+NWDPTML I+PFI+GVNSI  I+  S SD +LV
Sbjct: 241 LAPPNSC-LSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLV 299

Query: 245 IECIKHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVV--------LPP 296
           IEC+KHLIYYNCV++ DIFQFSNIYA +SLI+ FL DP +A  CQ+YV         LP 
Sbjct: 300 IECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRLPF 359

Query: 297 GSKINDLPLASEQDDEINNSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXX 356
            S+ N L + S +    +++  T                   +  R +            
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRV 419

Query: 357 XXXEGQQ------DNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVR 410
               GQ       D      +LP+K  LFDLYRSL+ G TV+ WYK NF  I++NHIDVR
Sbjct: 420 RDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVR 479

Query: 411 KFIKFGVINKIIYRVHQYPIMEH-------KTFKSPLLSDRQNDKI-----------VLS 452
           +FI FG++  +IYR + YP+M++       KT KS   S     K+           V S
Sbjct: 480 RFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVFS 539

Query: 453 TSDIKFDV 460
           T+DIK D+
Sbjct: 540 TADIKVDL 547

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%)

Query: 474 KVTFDRDKKLESKIGNSRNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIG 533
           +V  D  K+   ++ N       E+ +L  +++  ++FD+IC +L K + EVE ++ E+G
Sbjct: 644 QVEEDEKKERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMG 703

Query: 534 EYMTINS 540
            Y  INS
Sbjct: 704 HYNIINS 710

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  408 bits (1049), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 246/691 (35%), Positives = 342/691 (49%), Gaps = 152/691 (21%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M+  F+GF P+H IF+S+FHPTEG+KV +QFP   L+  +I FD+IKN+VIPKPQLC++L
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT +Y  +RL            AR            YDC T PYEPAIERLGKMF  LEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQILSKSQRTSAFF--------KDG---------------------------------- 138
           QSQILSK++ +S +F        K G                                  
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 139 --EDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIE 196
             +D++    K +I DL+ ++Y+DLN+YSECLIPID GN ++IK+FP+L PP+S   SIE
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSC-FSIE 239

Query: 197 DVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNC 256
           DVP+S VNL K++D+NWDPTML I+P I+G+NSI  ++  SDSD NLV+ECIKHLIYYNC
Sbjct: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299

Query: 257 VIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL--ASEQDDEIN 314
           VI+TDIFQFSNIYA ++ ++ FL +P +A  CQ YV     + + +LP      +  + N
Sbjct: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359

Query: 315 NSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXE------------GQ 362
             D +                   ++    +                           G 
Sbjct: 360 IRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGN 419

Query: 363 QDNPRQGQVLP--SKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINK 420
            D   +G+++P  SK  LFDLYRSL  G T+  WYK +F  I+   IDVR+FI FGV++ 
Sbjct: 420 SDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHG 479

Query: 421 IIYRVHQYPIMEHKTFKSP-----------------LLSDRQNDKIVLSTSDIKF----- 458
           +IYR + YP++ +  F                    LL   Q    VLS +DI+      
Sbjct: 480 LIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENA 539

Query: 459 ---------------DVGDRILNSIYNKLS------------------------------ 473
                          D  + +L+ +Y KL+                              
Sbjct: 540 GFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDI 599

Query: 474 ---------------KVTFDRDKKLESKIGNSRNLGE---------SEKNILFNALERHE 509
                          KV FD  K L +   + R   E         +E+ IL  ++    
Sbjct: 600 STRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVH 659

Query: 510 SFDRICSKLGKSKNEVESIISEIGEYMTINS 540
           +FD+IC+ LGK +  VES++SE+G Y  ++S
Sbjct: 660 NFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  404 bits (1037), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 242/692 (34%), Positives = 346/692 (50%), Gaps = 157/692 (22%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M+  F+GF P+H I ++IFHPTEG+KV +QFPP  L+A +I FD+IKN+VIPKPQLC++L
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT +Y ++RL            AR            YDC T PYE AI RLGKMF  LEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQILSKSQRTSAFFK----------------DGE------------------------- 139
           QSQILSK++ +  +F+                D E                         
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 140 ---DVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIE 196
              D++  + + S++DL+ ++Y+DLNNYSECLIPID GN ++IK+FP+L PP+S  +S E
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSC-LSFE 239

Query: 197 DVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNC 256
           DVP+  VNL K++D+NWDPTML I+P+I+G NSI  ++ LSDSD NLV+ECI+HL+YYNC
Sbjct: 240 DVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNC 299

Query: 257 VIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL----------- 305
           VI+ DIFQF NIYAP+S ++ FL +P +A  CQ YV L   + I+DLP            
Sbjct: 300 VILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNN 359

Query: 306 ------ASEQDDEINNSDMTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXX 359
                 +S  D +    +M+ K                   +  S               
Sbjct: 360 IPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNS 419

Query: 360 EGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVIN 419
           EG  +N        SK  LFD+YRSL+ G TV+ WYK +F  I+   IDVR+FI FGVI+
Sbjct: 420 EGGFNNK---VFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIH 476

Query: 420 KIIYRVHQYPIMEHKTF----KSPLLSDRQNDKI-------------VLSTSDIKF---- 458
            ++YR + +PIM++  +    K+  LSD  +                VLS ++I+     
Sbjct: 477 GLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLES 536

Query: 459 ----------------DVGDRILNSIYNKLS----------------------------- 473
                           D  + ILN +Y KL+                             
Sbjct: 537 SSSKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSG 596

Query: 474 -----------------KVTFDRDKKLESKIGNSRNLGE---------SEKNILFNALER 507
                             V FD  + + S     R  GE          ++ +L  ++  
Sbjct: 597 ETSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRD 656

Query: 508 HESFDRICSKLGKSKNEVESIISEIGEYMTIN 539
            E+FD+IC++LG+ + EVE ++ ++G Y  ++
Sbjct: 657 VENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  400 bits (1028), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 283/479 (59%), Gaps = 49/479 (10%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M +QFEGF  IH+IF+S FHPTEGSKV + FPP +L+   INFDSIKN+VIPK  LCHRL
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T +Y NYR+            AR            ++C+T PYEPAIERLGKMF+ LE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQILSKSQRTSAFFKD------------------GEDVDFVDT---------------- 146
           Q+QILSKS+  +  F                    G+D+  + T                
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNNIISN 180

Query: 147 ------KFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPL 200
                  F+I DLLMRLYQDLN YSECLIPID+GN ++IK+FP+L PPT   ISIE VP+
Sbjct: 181 IKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPI 239

Query: 201 SIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIIT 260
           S+VNL KIVD+NWDP ML+I+P+I+G+N+I  IS LS ++ +LVIECI+HL+YY C+++T
Sbjct: 240 SLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLT 299

Query: 261 DIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEIN-NSDMT 319
           DIF+FSN+YAP+S +  FL DP +A  CQSYV+LP  SK+NDL L          N D+ 
Sbjct: 300 DIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIG 359

Query: 320 QKALXXXXXXXXXXXXXXXAYAR---VSEXXXXXXXXXXXXXXEGQQDNPRQGQ----VL 372
            +                   +R   V +                   N   GQ     L
Sbjct: 360 SRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIHKHL 419

Query: 373 PSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIM 431
           P++  LFDLYRSL+ G T++ WY QN   I++N IDVR+FI FGV+ +IIYR   Y ++
Sbjct: 420 PTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYSVI 478

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 491 RNLGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539
           + L + ++ I+  AL   E+ D+IC  L   +  V +I+ E+GE   IN
Sbjct: 597 KKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  400 bits (1029), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 244/675 (36%), Positives = 344/675 (50%), Gaps = 136/675 (20%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M+  F+GF PIH+IF+S+FHPTEG+KV +QFPP++L+   I+FD+IKN+VIPKPQLC++L
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LT +Y +YRL            AR            YD  T PYEPAI RLGKMF+ LEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQILSKSQRTSAFFK-DGEDVDFVD---------------------------------- 145
           QSQ+LSK +R   ++    +DV  VD                                  
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 146 --------TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIED 197
                    + SI+DL+ +LY+DLNNYSECLIP+D GN I+IK+FP+L PP S   S+ED
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVED 239

Query: 198 VPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCV 257
           VP++ +NL   VD+NWDPTM+ I+P+I+G+NSI  IS  SDSD  LV+EC+KHLIYY+CV
Sbjct: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299

Query: 258 IITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSD 317
           ++ D+FQFSNIYAP+S ++ FL DP IA  CQ YV+    S+++ LP     +   + + 
Sbjct: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNP 359

Query: 318 MTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXX----------XXXXXXXEGQQDNPR 367
                                +++  +E                        E   +N +
Sbjct: 360 TASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENNK 419

Query: 368 Q--GQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRV 425
               + LP++  LFDLYRSL+ G T++ WYK NF  I++N IDVR+FI FGV  K+IYR 
Sbjct: 420 GILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRC 479

Query: 426 HQYPI------------MEHKTFKSPLLSDRQNDK-IVLSTSDIKFDVG----------- 461
           + YP+             ++ +  +  +S + N+   V ST+DI  D G           
Sbjct: 480 YSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLV 539

Query: 462 ------DRILNSIYNKLS-----------------------------------------K 474
                 D +L   Y KLS                                         K
Sbjct: 540 PNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAK 599

Query: 475 VTFDRDKKLESKIGNSRNLGES---------EKNILFNALERHESFDRICSKLGKSKNEV 525
           V FD   +L +K    R+   +         ++ +L  +++  +SFD+I  KL  +K EV
Sbjct: 600 VLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEV 659

Query: 526 ESIISEIGEYMTINS 540
           E ++   GEY  INS
Sbjct: 660 EELLKATGEYNIINS 674

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  400 bits (1028), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 215/521 (41%), Positives = 299/521 (57%), Gaps = 66/521 (12%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M   FEGF PIHT+F+SIFHPTEG+KV Y+FPP NLQ YNINFD+IKN++IPKPQLCH+L
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LTL+Y +YRL            AR             +C+T PYEP I RLGKMF+ LEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQILSKSQRTSAFFKDGEDV-------------------------------------DF 143
           Q+Q+LS+++  S +F +   +                                     ++
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180

Query: 144 VD----TKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVP 199
            D    + FS+QDL+MR++QDLNNYSECLIPIDEGN ++IKIFP + PP S+ IS EDVP
Sbjct: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYEDVP 239

Query: 200 LSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVII 259
           +++V+L  ++D+NWDPTML I+PFID +NSI+ I+ LS+SD + V+ECI+HL+YY  VI+
Sbjct: 240 VAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVIL 299

Query: 260 TDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMT 319
           +DIFQF+NIYAP+S + +FL D  +A +CQ+YV LP  S    LPL    + +++    +
Sbjct: 300 SDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSINTDLDEYSNS 359

Query: 320 QKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQDNPRQGQVLPSKCTLF 379
             A+                                         N R    LP+K  LF
Sbjct: 360 GSAIYPNNEILENDDRLRWP------MYYKPRNSQSSLSSGISSGNERTSNYLPTKSCLF 413

Query: 380 DLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHKTF--- 436
           DLYRSL+ G  +  WY +++S I  N ID+R+FI FG++  ++YR +  PIM++      
Sbjct: 414 DLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPIMKNAGIFDI 473

Query: 437 ---------KSPLLSDRQNDKIVLSTSDIKFDVGDRILNSI 468
                     +P  S+  +     ST++I+F      LNSI
Sbjct: 474 LSSLTTSQSSNPYHSNGDDKNGTASTANIRF------LNSI 508

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 70/147 (47%), Gaps = 24/147 (16%)

Query: 410 RKFIKFGVINKIIYRVHQYPIMEHKTFKSPLLSDRQNDKIVLSTSDIKFDVGDRILN-SI 468
           R+ +  G+ +K++  +H+       T +SP++  R+ D          F  G  I+    
Sbjct: 570 RQILNSGIADKVLSDIHRKLAKFDDTPRSPIVK-RKEDTFR------DFSNGSNIVGYGS 622

Query: 469 YNKLSKVTFDRDKKLESKIGNSRNLG------------ESEKN----ILFNALERHESFD 512
            N  +KV+F+  +  ++   N  ++             + EKN    +L  +L   ++ D
Sbjct: 623 SNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMD 682

Query: 513 RICSKLGKSKNEVESIISEIGEYMTIN 539
           +IC KL K + EVE ++SEIG+Y+ IN
Sbjct: 683 KICIKLQKPRKEVEELLSEIGDYVIIN 709

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  383 bits (983), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 193/352 (54%), Positives = 241/352 (68%), Gaps = 48/352 (13%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++ KN++IPKP LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T +Y  YR+            AR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141
           Q+Q+LSKS+R   FF                                   KD +D+    
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 142 --DFV------DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193
             D +       + FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239

Query: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253
           S+EDVPLS VNL KI+D+NWDPTM+SI+P+IDG+NSI  IS LS+SDP LVIECI+HLIY
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299

Query: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL 305
           Y CV ++DIFQFSNIYAPSSLI NFL DP++A +CQSYV  P  SKI++LPL
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL 351

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 105/195 (53%), Gaps = 29/195 (14%)

Query: 368 QGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQ 427
           + + LP++  LFDLYRSL+ G T++ WY+  +  +KEN+ID+R+FI FG+  +IIYR + 
Sbjct: 428 RNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYS 487

Query: 428 YPIMEHKTFKSP----------------LLSDRQNDKIVLSTSDIKFDVGDRILNSIYN- 470
           +P+M +   + P                LL  R ++ ++ +T       G R      N 
Sbjct: 488 FPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSAT-------GSRNTAQSGNL 540

Query: 471 ---KLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKNEV 525
              + SKV+F+  +      G S    L + E+ IL  ++   E+FD+IC  L K K EV
Sbjct: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600

Query: 526 ESIISEIGEYMTINS 540
           ES ++E+GE+  INS
Sbjct: 601 ESYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/352 (53%), Positives = 241/352 (68%), Gaps = 48/352 (13%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++IKN++IPKP LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T +Y  YR+            AR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141
           Q+Q+LSKS++   FF                                   KD +D+    
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 142 --------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193
                   +  ++ FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239

Query: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253
           S+EDVPLS VNL+KI+D+NWDPTM++I+P+IDG+NSI  IS LS+SDP+LVIECI+HLIY
Sbjct: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299

Query: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL 305
           Y CV ++DIFQFSNIYAPSS I NFL DP++A +CQ YV  P  SKI+ LPL
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL 351

 Score =  110 bits (276), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 106/194 (54%), Gaps = 27/194 (13%)

Query: 368 QGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQ 427
           + + LP++  LFDLYRSL+ G T++AWY+  +  IK+N+ID+R+FI FG+  +IIYR + 
Sbjct: 428 RNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYS 487

Query: 428 YPIM------EHKTFKSPLLSDRQND-------------KIVLSTSDIKFDVGDRILNSI 468
           YP+M      E K     +  D  N+              I+ S + + F+      N  
Sbjct: 488 YPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFN------NIK 541

Query: 469 YNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKNEVE 526
             + SKV+FD  K      G S    L + E+ IL  ++   E+FD+IC  LGK K EVE
Sbjct: 542 SGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVE 601

Query: 527 SIISEIGEYMTINS 540
           + ++E+GE+  INS
Sbjct: 602 NYLNELGEFKIINS 615

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  372 bits (955), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 238/676 (35%), Positives = 334/676 (49%), Gaps = 139/676 (20%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           M  +F+GF PIH IF+++FHPTEG+KV +QFP ++L+   I FD+IKN+VIPK QLC++L
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           +T ++ +YRL            AR            YD  T PYEPAI RL KM + LEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQILSKSQRTSAFF--KDGE------DVDFVDTK------------------------- 147
           QSQ+LSK +R   ++  K GE        +  D+K                         
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187

Query: 148 --------FSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVP 199
                     I+DL+ +LY+DLNNYSECLIP+D GN I+IK+FP+L PP S  +S EDVP
Sbjct: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LSFEDVP 246

Query: 200 LSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVII 259
           ++ VNL  +VD+NWDPTML I+PFI+G+NSI  IS  SDS   LV+ECIKHL+YY+CV +
Sbjct: 247 IAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVAL 306

Query: 260 TDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDD--EINNSD 317
            D+FQFSNIYAP++L+ +FL D ++   CQ YVV     +I+ LP  S  +     N + 
Sbjct: 307 VDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTA 366

Query: 318 MTQKALXXXXXXXXXXXXXXXAYARVSEXXXXXXXXXXXXXXEGQQ---DNPRQ-----G 369
            T                   + A  S+                +    +  R       
Sbjct: 367 STNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCK 426

Query: 370 QVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYP 429
           + LP++  LFDLYRSL  G T++ WYK N+S I+EN IDVR+ I FGV +++IYR + YP
Sbjct: 427 RTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYP 486

Query: 430 IMEH-------KTFKS--------PLLSDRQNDKIVLSTSDIKF---------------- 458
           + +        K F          P  +   N+  V STSDI+                 
Sbjct: 487 VAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNN--VFSTSDIRVDFDGSSRSRNIPPFLN 544

Query: 459 --DVGDRILNSIYNKLS-----------------------------------------KV 475
             DV + +L   Y KLS                                         ++
Sbjct: 545 SSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRI 604

Query: 476 TFDRDKKLESKIGNSRNLGES-----------EKNILFNALERHESFDRICSKLGKSKNE 524
           TFD   +  SK    R                ++ +L  +++  +SFD+I  +L  +K+E
Sbjct: 605 TFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHE 664

Query: 525 VESIISEIGEYMTINS 540
           VE ++   GEY  +NS
Sbjct: 665 VERLLKGTGEYNIVNS 680

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/443 (41%), Positives = 257/443 (58%), Gaps = 49/443 (11%)

Query: 145 DTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVN 204
           +++ S+QDL+MR+YQDLNNYSECLIPID+GN ++IKIFP+LKPP +  +SIEDVP+S+V+
Sbjct: 224 NSRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVD 283

Query: 205 LDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQ 264
           L KI D+NWDPTML ++PFI+G+N I+ IS LS+S P LVIECIKHLIYYNCVIITDIFQ
Sbjct: 284 LTKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQ 343

Query: 265 FSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALX 324
           FSN Y+ +SLI+ FL DP +A  CQ+YVVLP GSK+  LP   E +  + +S   +    
Sbjct: 344 FSNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHN 403

Query: 325 XXXXXXXXXXXXXXAYAR--VSEXXXXXXXXXXXXXXEGQQDNPRQGQVLPSKCTLFDLY 382
                            R   S               +    N      LP+K +LF+LY
Sbjct: 404 RHEKTPSFGSSITSNNGRSSFSADDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELY 463

Query: 383 RSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIM--------EHK 434
           RSLN    ++ WYK N++TI EN+ID+RKFIKFG+I  +IYR H YPI+        E  
Sbjct: 464 RSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESA 523

Query: 435 TFKSPLL----------SDRQNDKIVLS----------TSDIKFDVGDRILNSIYNKLS- 473
              SP +          S +   K  +S          +S ++ D  D+++ S Y KL  
Sbjct: 524 KSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVR-DTRDKLMKSFYEKLEK 582

Query: 474 -----------KVTFDRDKKLESKIGNSRN------LGESEKNILFNALERHESFDRICS 516
                      K+ F  D+   S   +  +      L   ++NIL +++   ++ D+IC 
Sbjct: 583 GKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICV 642

Query: 517 KLGKSKNEVESIISEIGEYMTIN 539
           KLG+ ++++E  +SE G+Y  IN
Sbjct: 643 KLGRPRSQIEEWLSEFGDYKVIN 665

 Score =  162 bits (410), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (69%)

Query: 4   QFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRLLTL 63
            FEGF PIHTIF+SIFHPTEG+KV Y+FPP NL A +I+FD+IKN++IPK QLC++LLT 
Sbjct: 12  HFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLTF 71

Query: 64  EYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEEQSQ 123
           +Y NYR+            AR            YDC+T PYEPAI RLGKMFK LEEQ+Q
Sbjct: 72  KYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQNQ 131

Query: 124 ILSKSQRTSAFFK 136
           ILSK++    +FK
Sbjct: 132 ILSKAENDPIYFK 144

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  281 bits (719), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 191/467 (40%), Positives = 258/467 (55%), Gaps = 76/467 (16%)

Query: 147 KFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLD 206
           + S+ D+LMR++QDLN+YSEC IPID+GN I+IK+FP L PP    IS+EDVP+  VNL+
Sbjct: 210 QLSMNDILMRVFQDLNSYSECYIPIDDGNAIDIKLFPTLMPPID-SISVEDVPIPTVNLN 268

Query: 207 KIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFS 266
           KI+D+NWDPTML I+P+IDG+NSI  I++LS+SD  LVIECI+H +YY CVI++DIFQFS
Sbjct: 269 KIIDVNWDPTMLKIVPYIDGLNSIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFS 328

Query: 267 NIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALXXX 326
           NIYAP+S I +FL DP +A  CQ YV  P  S ++ LP    +   + N      A    
Sbjct: 329 NIYAPTSSITDFLTDPTLATECQIYVTSPEDSLLSALPFKKGR-KMVKNRRSASIASHFT 387

Query: 327 XXXXXXXXXXXXAYARVSEXXXXXXXXX--------------XXXXXEGQQDNPRQGQ-V 371
                       A + +S+                             G  D   Q +  
Sbjct: 388 SSSSLRQNLNSKASSFISDEGHHNDDTAYPNHDSIYENRRRSESSFSSGNNDEMHQNRNY 447

Query: 372 LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIM 431
           LP+K TLFDLYRSL+ G  +E WY+ NF++I++N ID+R+FI FG+I +IIYR H YP+ 
Sbjct: 448 LPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLP 507

Query: 432 EHKTFKSPL--LSDRQND-KIV-----------LSTSDIKF-----------------DV 460
           ++    S L  L + QN  KIV            STSDIKF                 DV
Sbjct: 508 KNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDV 567

Query: 461 GDRILNSIYNKL-----------------SKVTFDR---DKKLESKIGN--------SRN 492
            DR+LN++Y KL                 SKV F     D  L   + N        SR 
Sbjct: 568 ADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFSRE 627

Query: 493 LGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539
           +  ++K  L +AL+  E+ D ICS L  S+ EVE++++E+ EY  IN
Sbjct: 628 ININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

 Score =  160 bits (405), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 74/135 (54%), Positives = 90/135 (66%)

Query: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60
           MN  F+GF PIH IF+S+FHPTEG+KV Y+FPP NL    INFD+IKN+VIPKPQLCH+L
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTLEYKNYRLXXXXXXXXXXXXARXXXXXXXXXXXXYDCQTLPYEPAIERLGKMFKTLEE 120
           LTL+Y NYR+            AR            Y+C+T PYEP +ERLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQILSKSQRTSAFF 135
           Q Q LSK ++  A+F
Sbjct: 121 QCQFLSKCEKDMAYF 135

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 5/99 (5%)

Query: 108 IERLGKMFKTLEE----QSQILSKSQRTSAFFKDGEDVDFVDTKFSIQDLLMRLYQDLNN 163
           ++ L K+  TLE     Q++I+ K      +  D  +V F  T  SIQ +  ++ Q+L+ 
Sbjct: 715 VQLLNKLAMTLENEELFQTEIVDKLVELQKYMMDSNEVQFFVTTDSIQQV-AKVKQELDT 773

Query: 164 YSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSI 202
           +   L PI++   +NI+ +P L     V  ++ + P  +
Sbjct: 774 FVGSLSPIEKNGGVNIESYPKLAQKPGVMSTLINFPFQV 812

>Ecym_2115 Chr2 (216638..217777) [1140 bp, 379 aa] {ON} similar to
           Ashbya gossypii AFL184W
          Length = 379

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 406 HIDVRKFIKFGVINKIIYRVHQYPIMEHKT------FKSPLLSDRQNDKIVLSTSDIKFD 459
            +D++KF KFG  N++   +      +H++      ++ PL + R ND  ++S  DI++D
Sbjct: 315 RLDLQKFRKFGSHNELADTLVTDTYEKHRSRALSVPYELPLWNKRSNDSTLVSWMDIEYD 374

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,958,339
Number of extensions: 2410487
Number of successful extensions: 8056
Number of sequences better than 10.0: 43
Number of HSP's gapped: 8292
Number of HSP's successfully gapped: 90
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)