Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003706.16ON96396344660.0
NDAI0D008706.16ON106984022130.0
Suva_5.66.16ON99983622010.0
Skud_5.286.16ON99883221900.0
YEL061C (CIN8)6.16ON100082621840.0
Smik_5.266.16ON100283621790.0
NCAS0H008806.16ON100484421700.0
TDEL0G045306.16ON95880521630.0
ZYRO0C07898g6.16ON97482421390.0
Kpol_1032.66.16ON100483521310.0
SAKL0E01078g6.16ON94881321000.0
CAGL0B03641g6.16ON98882220850.0
TPHA0M002406.16ON93983320200.0
KLLA0D01045g6.16ON96598920040.0
KLTH0C11330g6.16ON94181619800.0
TBLA0A072306.16ON109789119900.0
Kwal_56.224036.16ON94381519690.0
ACR010C6.16ON94595019580.0
KNAG0M011306.16ON95098219350.0
Kpol_1045.736.16ON96283113951e-177
Ecym_30206.16ON94466612681e-158
TPHA0J003006.16ON98282211341e-138
ZYRO0B03234g7.387ON11388209501e-111
TPHA0E008907.387ON12329198961e-102
Suva_2.547.387ON11106107081e-77
Skud_2.417.387ON11106136992e-76
YBL063W (KIP1)7.387ON11116216922e-75
Smik_2.537.387ON11136006807e-74
SAKL0F12298g7.387ON11126396781e-73
KAFR0L017107.387ON11515856702e-72
NCAS0E026407.387ON11025506673e-72
Ecym_46887.387ON11345406666e-72
ACR228C7.387ON11295656561e-70
NDAI0E043007.387ON11865906562e-70
TDEL0C016007.387ON11055736134e-65
TBLA0D006407.387ON11427775967e-63
SAKL0G18920g2.633ON6493843653e-35
SAKL0G05016g5.531ON5042723577e-35
KLLA0B00759g5.531ON4563263476e-34
Kwal_56.22407singletonOFF1081083181e-33
ADR145C2.633ON6353903502e-33
KLTH0G03850g5.531ON4732003424e-33
Ecym_34152.633ON6623773476e-33
CAGL0I07029g3.528ON7054123406e-32
Kwal_47.186085.531ON4791833301e-31
KNAG0B005203.528ON7233653318e-31
Kpol_1004.255.531ON5063493222e-30
TBLA0C049603.528ON8014353256e-30
SAKL0F01760g3.528ON8093753231e-29
Ecym_40665.531ON4782663142e-29
NDAI0I029603.528ON8684193168e-29
TDEL0D059603.528ON7334553122e-28
KAFR0F042103.528ON6725523112e-28
ZYRO0D12650g5.531ON4783353052e-28
Smik_7.483.528ON8054643122e-28
Kpol_423.83.528ON8064893104e-28
Kwal_47.190933.528ON8194413104e-28
TPHA0D034803.528ON8475823104e-28
NCAS0E005503.528ON7845383078e-28
Suva_7.443.528ON8054573079e-28
Skud_7.533.528ON8052983052e-27
YGL216W (KIP3)3.528ON8055733052e-27
KAFR0H024108.678ON6583523032e-27
KLTH0G01606g3.528ON8194453042e-27
ZYRO0E08668g3.528ON7782513032e-27
Skud_16.4353.479ON7291922989e-27
CAGL0D04994g3.479ON6921972971e-26
Ecym_12003.528ON8334752981e-26
KLLA0A01606g3.528ON7694562971e-26
AER441C3.528ON8184872952e-26
KLLA0D05951g8.678ON6684092915e-26
Smik_16.3883.479ON7291922881e-25
Kwal_26.88068.678ON7154192862e-25
KNAG0A078803.479ON7641522863e-25
TBLA0C053103.479ON6761962853e-25
NCAS0F034703.479ON6981962853e-25
TBLA0C039403.479ON7391822844e-25
SAKL0H06490g8.678ON6573212834e-25
KAFR0B065903.479ON7061722827e-25
AGR253W3.479ON7091832827e-25
YPR141C (KAR3)3.479ON7291922827e-25
TPHA0D032003.479ON7241972801e-24
TDEL0B072702.633ON6443192782e-24
Suva_16.4693.479ON7311882792e-24
NDAI0B057703.479ON7632022792e-24
TDEL0F036403.479ON7041912782e-24
Kpol_1013.78.678ON6203682763e-24
TDEL0A062408.678ON6373282763e-24
Kpol_505.393.479ON6921832764e-24
ZYRO0B04290g3.479ON7311852747e-24
SAKL0F03168g3.479ON7061932721e-23
KLLA0B10956g3.479ON6901642692e-23
KNAG0J017208.678ON6253892683e-23
NCAS0C013508.678ON6552182674e-23
KLTH0F14498g3.479ON7021672658e-23
CAGL0M02189g8.678ON6724462631e-22
KLTH0D11286g8.678ON6783152631e-22
Kpol_1050.1033.479ON6971442594e-22
Ecym_44073.479ON7111662577e-22
Ecym_23958.678ON6873602569e-22
ZYRO0F07414g8.678ON6542322551e-21
TPHA0D012708.678ON6962542542e-21
Suva_16.1558.678ON7043582505e-21
Kpol_1019.112.633ON6473662496e-21
NDAI0E02090singletonON6853832471e-20
YPL155C (KIP2)8.678ON7063552434e-20
ACR145W8.678ON6853092424e-20
Skud_16.1278.678ON7062022381e-19
Smik_6.3528.678ON7153902353e-19
TPHA0D041903.479ON6721782282e-18
TPHA0N016502.633ON6823482221e-17
TBLA0C018808.678ON4681502137e-17
Skud_11.1482.633ON6563042085e-16
YKL079W (SMY1)2.633ON6563392051e-15
Smik_11.1602.633ON6563842023e-15
ZYRO0E01078g2.633ON6684121996e-15
NDAI0C004802.633ON5984141942e-14
NCAS0H031802.633ON6603931933e-14
Kwal_55.21164singletonOFF5881881881e-13
TBLA0A008202.633ON8035301891e-13
Kwal_YGOB_55.211643.479ON6571881881e-13
CAGL0L05104g2.633ON6753841872e-13
Suva_11.1452.633ON6573841835e-13
TBLA0C008002.633ON6933861692e-11
TPHA0B008304.238ON25366421651e-10
CAGL0D00924g4.238ON19803871632e-10
Suva_11.3315.702ON18985481613e-10
CAGL0I10901g8.604ON8163801542e-09
KNAG0M025402.633ON5221111504e-09
Kpol_529.202.16ON9576381497e-09
Kwal_26.93864.238ON12154941497e-09
Smik_11.3585.702ON18786311471e-08
KAFR0I002507.21ON7774321452e-08
Kpol_483.114.238ON25464831462e-08
KNAG0H003602.633ON6813661442e-08
TBLA0E017305.702ON18206251452e-08
TBLA0A044107.21ON7325061433e-08
NDAI0B055205.414ON10093431434e-08
KNAG0D043404.238ON22205241434e-08
KLLA0C02915g1.110ON12964311425e-08
KAFR0E014705.296ON8725771416e-08
CAGL0G02497g5.702ON17806361417e-08
YDL058W (USO1)4.238ON17903461417e-08
KLTH0D14102g4.238ON17124671409e-08
KAFR0F030204.46ON8244211391e-07
TPHA0H016805.414ON9894041381e-07
Kpol_1026.314.46ON10053811381e-07
Kpol_1044.137.101ON11033101381e-07
KAFR0C040202.633ON6673801372e-07
KAFR0G032004.238ON18693951382e-07
KNAG0A031708.636ON4714161362e-07
TBLA0B099704.46ON10656091353e-07
CAGL0E03454g4.46ON8675601344e-07
NDAI0E050405.702ON19735651345e-07
Smik_12.3934.46ON9104211335e-07
Suva_4.1914.238ON17824031336e-07
Suva_4.3783.393ON4253121308e-07
NCAS0A032005.702ON17885051328e-07
Skud_4.1964.238ON17924661328e-07
TBLA0A104705.267ON19994211328e-07
NCAS0F025005.296ON8313321319e-07
YLR309C (IMH1)4.46ON9114421319e-07
KAFR0E017505.267ON18913401311e-06
Skud_12.3934.46ON9134091301e-06
NCAS0A025504.268ON7124981291e-06
Suva_10.4054.46ON9165131292e-06
SAKL0H03300g4.238ON17075871292e-06
TBLA0H012408.331ON17954341292e-06
TBLA0D006508.799ON15682891282e-06
NCAS0A024504.238ON19284181282e-06
KLLA0C09691g8.704ON8214471273e-06
TPHA0O019302.16ON10813691273e-06
Kpol_1051.255.267ON19684491273e-06
Ecym_64762.16ON8502891263e-06
SAKL0H05852g8.704ON8693401263e-06
Smik_4.1764.238ON17956171264e-06
TBLA0E040608.604ON8043371254e-06
KNAG0B067804.364ON6774981245e-06
KAFR0G020908.604ON7324461221e-05
NDAI0J025504.300ON4793631211e-05
YDR285W (ZIP1)5.296ON8754991221e-05
Kwal_55.196975.702ON17604481221e-05
KAFR0D037601.110ON13016261211e-05
NDAI0C058808.604ON8463951202e-05
SAKL0G02024g5.414ON8494651202e-05
CAGL0A02596g5.414ON8723691202e-05
TDEL0E005102.16ON9365321202e-05
TBLA0A102505.296ON9503121202e-05
KAFR0G029307.186ON11703491202e-05
TPHA0C019708.450ON5425191192e-05
NDAI0F002905.702ON15544181202e-05
Suva_15.2095.267ON19293681202e-05
CAGL0H03179g6.188ON6573391192e-05
NCAS0G002805.696ON7114051192e-05
Kwal_56.22402singletonOFF93431072e-05
NDAI0J029204.364ON7594381192e-05
Smik_15.3828.604ON8293621192e-05
KAFR0E040105.414ON9053891192e-05
TBLA0E044108.259ON14223801193e-05
YHR023W (MYO1)5.267ON19283721193e-05
YBR130C (SHE3)3.393ON4252801173e-05
Ecym_55145.414ON8543951183e-05
TPHA0K019904.46ON9104761183e-05
KLTH0H09438g4.46ON9273981183e-05
NDAI0H019507.21ON8564481174e-05
Suva_2.4515.296ON8774121174e-05
NDAI0K011008.704ON8884211174e-05
Suva_8.2698.636ON4853631164e-05
KAFR0B023408.198ON3692221154e-05
KNAG0F006501.110ON13064621174e-05
YBL047C (EDE1)7.488ON13814541174e-05
Smik_8.905.267ON19273281175e-05
KLLA0B04136g4.364ON6683671165e-05
NDAI0A076403.310ON8903771165e-05
NCAS0A007701.110ON13044181166e-05
NCAS0C052002.633ON5724141156e-05
SAKL0G15818g4.268ON6473441156e-05
KLTH0H04774g6.188ON6582781156e-05
Kpol_1059.151.487ON8973031157e-05
Smik_15.4028.636ON5154221147e-05
Suva_14.921.110ON13123551157e-05
Suva_2.707.488ON13803721158e-05
Kwal_23.55345.267ON19074241158e-05
KAFR0B057708.331ON25603601158e-05
Skud_14.881.110ON13163371141e-04
Ecym_53454.238ON13663661141e-04
Skud_2.557.488ON13904671141e-04
Skud_8.785.267ON19274181141e-04
Skud_2.2583.393ON4293521121e-04
KLLA0D19580g2.16ON7543871131e-04
TDEL0E021005.414ON7613581131e-04
YGR130C3.492ON8163301131e-04
NCAS0C011608.704ON8593561131e-04
TPHA0M004103.149ON4604451121e-04
KAFR0A016101.295ON12273301131e-04
Kpol_1043.705.702ON13213771131e-04
KNAG0G020208.259ON14442561131e-04
KLLA0A03509g7.21ON7764501121e-04
SAKL0H24200g4.46ON9633831122e-04
TPHA0E002305.702ON12843361122e-04
Smik_14.851.110ON13123881122e-04
NDAI0J009608.331ON24093691122e-04
TDEL0D005204.364ON6654901112e-04
TBLA0A036205.414ON9705201112e-04
TBLA0G035308.68ON12322641112e-04
Suva_7.4183.492ON8313111103e-04
TBLA0F017503.419ON9093241103e-04
AFR286W5.702ON17584441103e-04
CAGL0M00462g4.364ON6114741093e-04
NDAI0D043004.268ON7432031093e-04
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KAFR0L00370
         (2892 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...  1724   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   857   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   852   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   848   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   845   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   843   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   840   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   837   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   828   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   825   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   813   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   807   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   782   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   776   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   767   0.0  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   771   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   763   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   758   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   749   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   541   e-177
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   493   e-158
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   441   e-138
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   370   e-111
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   349   e-102
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   277   1e-77
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   273   2e-76
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   271   2e-75
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   266   7e-74
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   265   1e-73
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   262   2e-72
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   261   3e-72
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   261   6e-72
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   257   1e-70
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   257   2e-70
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   240   4e-65
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   234   7e-63
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   145   3e-35
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   142   7e-35
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   138   6e-34
Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {O...   127   1e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   139   2e-33
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   136   4e-33
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   138   6e-33
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   135   6e-32
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   131   1e-31
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   132   8e-31
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   128   2e-30
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   129   6e-30
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   129   1e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   125   2e-29
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   126   8e-29
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   124   2e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   124   2e-28
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   122   2e-28
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   124   2e-28
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   124   4e-28
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   124   4e-28
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   124   4e-28
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   122   8e-28
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   9e-28
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   2e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   122   2e-27
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   121   2e-27
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   121   2e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   121   2e-27
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   119   9e-27
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   119   1e-26
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   119   1e-26
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   119   1e-26
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   118   2e-26
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   116   5e-26
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   115   1e-25
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   114   2e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   114   3e-25
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   114   3e-25
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   114   3e-25
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   114   4e-25
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   113   4e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   113   7e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   113   7e-25
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   113   7e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   112   1e-24
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   111   2e-24
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   112   2e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   112   2e-24
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   111   2e-24
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   110   3e-24
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   110   3e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   110   4e-24
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   110   7e-24
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   109   1e-23
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   108   2e-23
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....   107   3e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   107   4e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   106   8e-23
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   105   1e-22
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   105   1e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   104   4e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   103   7e-22
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   103   9e-22
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   102   1e-21
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   102   2e-21
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   100   5e-21
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   100   6e-21
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   100   1e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    98   4e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    98   4e-20
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    96   1e-19
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    95   3e-19
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    92   2e-18
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    90   1e-17
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    87   7e-17
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    85   5e-16
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    84   1e-15
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    82   3e-15
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    81   6e-15
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    79   2e-14
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     79   3e-14
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    77   1e-13
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    77   1e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    77   1e-13
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    77   2e-13
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    75   5e-13
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    70   2e-11
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    68   1e-10
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    67   2e-10
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    67   3e-10
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    64   2e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    62   4e-09
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    62   7e-09
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    62   7e-09
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    61   1e-08
KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}...    60   2e-08
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    61   2e-08
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    60   2e-08
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    60   2e-08
TBLA0A04410 Chr1 complement(1085213..1087411) [2199 bp, 732 aa] ...    60   3e-08
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    60   4e-08
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    60   4e-08
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    59   5e-08
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    59   6e-08
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    59   7e-08
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    59   7e-08
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    59   9e-08
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    58   1e-07
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    58   1e-07
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    58   1e-07
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    58   1e-07
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    57   2e-07
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    58   2e-07
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    57   2e-07
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    57   3e-07
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    56   4e-07
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    56   5e-07
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    56   5e-07
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    56   6e-07
Suva_4.378 Chr4 complement(664404..665681) [1278 bp, 425 aa] {ON...    55   8e-07
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    55   8e-07
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    55   8e-07
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    55   8e-07
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    55   9e-07
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    55   9e-07
KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5....    55   1e-06
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    55   1e-06
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    54   1e-06
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    54   2e-06
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    54   2e-06
TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {...    54   2e-06
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    54   2e-06
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    54   2e-06
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    54   3e-06
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    54   3e-06
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    54   3e-06
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    53   3e-06
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    53   3e-06
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    53   4e-06
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    53   4e-06
KNAG0B06780 Chr2 complement(1338912..1340945) [2034 bp, 677 aa] ...    52   5e-06
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    52   1e-05
NDAI0J02550 Chr10 (629573..631012) [1440 bp, 479 aa] {ON} Anc_4....    51   1e-05
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    52   1e-05
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...    52   1e-05
KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {...    51   1e-05
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    51   2e-05
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    51   2e-05
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    51   2e-05
TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {O...    51   2e-05
TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5...    51   2e-05
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    51   2e-05
TPHA0C01970 Chr3 complement(445831..447459) [1629 bp, 542 aa] {O...    50   2e-05
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    51   2e-05
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    51   2e-05
CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} simila...    50   2e-05
NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696...    50   2e-05
Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OF...    46   2e-05
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    50   2e-05
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    50   2e-05
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    50   2e-05
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    50   3e-05
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    50   3e-05
YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}  ...    50   3e-05
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    50   3e-05
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    50   3e-05
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    50   3e-05
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    50   4e-05
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    50   4e-05
NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {...    50   4e-05
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    49   4e-05
KAFR0B02340 Chr2 complement(456758..457867) [1110 bp, 369 aa] {O...    49   4e-05
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    50   4e-05
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    50   4e-05
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    50   5e-05
KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} simila...    49   5e-05
NDAI0A07640 Chr1 (1756757..1759429) [2673 bp, 890 aa] {ON}             49   5e-05
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    49   6e-05
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    49   6e-05
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    49   6e-05
KLTH0H04774g Chr8 complement(426645..428621) [1977 bp, 658 aa] {...    49   6e-05
Kpol_1059.15 s1059 (35836..38529) [2694 bp, 897 aa] {ON} (35836....    49   7e-05
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    49   7e-05
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    49   7e-05
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    49   8e-05
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    49   8e-05
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    49   8e-05
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    49   1e-04
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    49   1e-04
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    49   1e-04
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    49   1e-04
Skud_2.258 Chr2 complement(463205..464494) [1290 bp, 429 aa] {ON...    48   1e-04
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    48   1e-04
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    48   1e-04
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    48   1e-04
NCAS0C01160 Chr3 (214545..217124) [2580 bp, 859 aa] {ON} Anc_8.7...    48   1e-04
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    48   1e-04
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    48   1e-04
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    48   1e-04
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....    48   1e-04
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    48   1e-04
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    48   2e-04
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    48   2e-04
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    48   2e-04
NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] ...    48   2e-04
TDEL0D00520 Chr4 (94918..96915) [1998 bp, 665 aa] {ON} Anc_4.364...    47   2e-04
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    47   2e-04
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    47   2e-04
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    47   3e-04
TBLA0F01750 Chr6 (436152..438881) [2730 bp, 909 aa] {ON} Anc_3.4...    47   3e-04
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    47   3e-04
CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar...    47   3e-04
NDAI0D04300 Chr4 complement(1008897..1011128) [2232 bp, 743 aa] ...    47   3e-04
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    47   4e-04
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    47   4e-04
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    47   4e-04
YIL144W Chr9 (78074..80149) [2076 bp, 691 aa] {ON}  TID3Componen...    46   4e-04
NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.3...    46   4e-04
Smik_2.270 Chr2 complement(480391..481668) [1278 bp, 425 aa] {ON...    46   4e-04
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    46   5e-04
KLLA0F00902g Chr6 complement(83326..84729) [1404 bp, 467 aa] {ON...    46   5e-04
TBLA0J00420 Chr10 (76709..78136) [1428 bp, 475 aa] {ON} Anc_8.63...    46   5e-04
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    46   5e-04
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    46   5e-04
NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_...    46   5e-04
TPHA0A01100 Chr1 (212665..214251) [1587 bp, 528 aa] {ON} Anc_8.6...    46   5e-04
NDAI0I01220 Chr9 complement(293892..295994) [2103 bp, 700 aa] {O...    46   6e-04
YJR134C Chr10 complement(673729..675852) [2124 bp, 707 aa] {ON} ...    46   6e-04
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    46   6e-04
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    46   7e-04
Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON} (91526....    45   7e-04
KLLA0A06402g Chr1 complement(578090..580057) [1968 bp, 655 aa] {...    45   7e-04
Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)    45   7e-04
KAFR0C01110 Chr3 complement(225557..226903) [1347 bp, 448 aa] {O...    45   8e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   8e-04
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    45   8e-04
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    45   8e-04
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    45   9e-04
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    45   9e-04
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    45   0.001
NCAS0A11380 Chr1 (2255650..2258805) [3156 bp, 1051 aa] {ON} Anc_...    45   0.001
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    45   0.001
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    45   0.001
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    45   0.001
Smik_10.427 Chr10 complement(662836..664956) [2121 bp, 706 aa] {...    45   0.001
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    45   0.001
NCAS0J01800 Chr10 complement(336846..338093) [1248 bp, 415 aa] {...    44   0.001
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    45   0.001
KLLA0C08151g Chr3 (714910..716832) [1923 bp, 640 aa] {ON} weakly...    44   0.002
Kpol_1049.5 s1049 (10518..12869) [2352 bp, 783 aa] {ON} (10518.....    44   0.002
SAKL0D14454g Chr4 (1186923..1189358) [2436 bp, 811 aa] {ON} weak...    44   0.002
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    44   0.002
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    44   0.002
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    44   0.002
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    44   0.002
NDAI0G00500 Chr7 (106930..109815) [2886 bp, 961 aa] {ON} Anc_2.2...    44   0.002
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    44   0.002
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    44   0.003
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...    44   0.003
TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {O...    44   0.003
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    44   0.003
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717      44   0.003
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    44   0.003
CAGL0J07348g Chr10 (711496..713091) [1596 bp, 531 aa] {ON} weakl...    44   0.003
Suva_2.461 Chr2 complement(817421..819445) [2025 bp, 674 aa] {ON...    44   0.003
NDAI0C04900 Chr3 (1136184..1138307) [2124 bp, 707 aa] {ON} Anc_8...    44   0.003
ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syn...    44   0.003
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    44   0.003
KAFR0A05570 Chr1 (1112905..1116576) [3672 bp, 1223 aa] {ON} Anc_...    44   0.003
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...    44   0.003
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    44   0.003
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    44   0.003
KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} simi...    43   0.004
Skud_11.47 Chr11 complement(97012..99048) [2037 bp, 678 aa] {ON}...    43   0.004
TBLA0I02150 Chr9 (496050..498299) [2250 bp, 749 aa] {ON} Anc_3.3...    43   0.004
KAFR0E02010 Chr5 (397131..399647) [2517 bp, 838 aa] {ON} Anc_5.1...    43   0.004
NDAI0B01390 Chr2 (321257..324073) [2817 bp, 938 aa] {ON} Anc_2.590     43   0.004
TPHA0C03850 Chr3 complement(829920..833090) [3171 bp, 1056 aa] {...    43   0.004
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    43   0.004
NCAS0A10990 Chr1 complement(2188430..2191987) [3558 bp, 1185 aa]...    43   0.004
KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7....    43   0.004
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    43   0.004
Kpol_1018.81 s1018 (222032..223027) [996 bp, 331 aa] {ON} (22203...    42   0.004
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    43   0.005
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    43   0.005
TPHA0C03600 Chr3 (781013..783151) [2139 bp, 712 aa] {ON} Anc_2.3...    43   0.005
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    43   0.005
KAFR0H02010 Chr8 (371079..373661) [2583 bp, 860 aa] {ON} Anc_8.3...    43   0.005
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    43   0.005
TBLA0F01290 Chr6 complement(320073..322997) [2925 bp, 974 aa] {O...    43   0.005
NDAI0G02820 Chr7 (655932..657287) [1356 bp, 451 aa] {ON} Anc_3.1...    42   0.006
TPHA0H02870 Chr8 (680144..683509) [3366 bp, 1121 aa] {ON} Anc_7....    43   0.006
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    43   0.006
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    43   0.006
TBLA0H02620 Chr8 complement(619758..621266) [1509 bp, 502 aa] {O...    42   0.006
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    43   0.006
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....    43   0.006
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    43   0.006
CAGL0L00561g Chr12 (65336..66130) [795 bp, 264 aa] {ON} similar ...    42   0.006
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    42   0.007
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    42   0.007
TBLA0D00970 Chr4 (253370..255973) [2604 bp, 867 aa] {ON}               42   0.007
CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} simil...    42   0.007
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    42   0.007
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    42   0.008
CAGL0G09867g Chr7 complement(942215..944149) [1935 bp, 644 aa] {...    42   0.008
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    42   0.009
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    42   0.009
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    42   0.009
NCAS0A07500 Chr1 complement(1490789..1493320) [2532 bp, 843 aa] ...    42   0.009
Kpol_1003.20 s1003 (51990..53225) [1236 bp, 411 aa] {ON} (51990....    42   0.009
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    42   0.010
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    42   0.010
Kwal_26.8516 s26 complement(820299..821723) [1425 bp, 474 aa] {O...    42   0.010
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    42   0.010
Kpol_480.5 s480 complement(10930..12384) [1455 bp, 484 aa] {ON} ...    42   0.010
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    42   0.010
NDAI0H03760 Chr8 (920614..922122) [1509 bp, 502 aa] {ON} Anc_2.6...    42   0.010
TBLA0B00220 Chr2 complement(37191..38792) [1602 bp, 533 aa] {ON}...    42   0.010
YKR016W Chr11 (469717..471339) [1623 bp, 540 aa] {ON}  FCJ1Mitoc...    42   0.010
YDR150W Chr4 (755628..763874) [8247 bp, 2748 aa] {ON}  NUM1Prote...    42   0.010
Smik_4.162 Chr4 complement(300502..302598) [2097 bp, 698 aa] {ON...    42   0.011
TBLA0I01660 Chr9 complement(367039..369207) [2169 bp, 722 aa] {O...    42   0.011
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    42   0.013
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    42   0.013
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    42   0.013
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    42   0.013
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    41   0.013
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    42   0.013
Smik_11.273 Chr11 (457103..458722) [1620 bp, 539 aa] {ON} YKR016...    41   0.014
Skud_15.62 Chr15 (104695..106530) [1836 bp, 611 aa] {ON} YOL091W...    41   0.014
Sklu_YGOB_Anc_5.296 Chr7 (891742..892812) [1071 bp, 356 aa] {ON}...    41   0.015
KAFR0B00360 Chr2 (81284..83215) [1932 bp, 643 aa] {ON} Anc_7.535...    41   0.015
Kpol_1019.10 s1019 (19188..20411) [1224 bp, 407 aa] {ON} (19188....    41   0.016
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    41   0.016
NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.4...    41   0.016
KAFR0H01060 Chr8 (192119..195664) [3546 bp, 1181 aa] {ON} Anc_3....    41   0.017
NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {...    41   0.017
NDAI0K01010 Chr11 complement(230318..235336) [5019 bp, 1672 aa] ...    41   0.017
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    41   0.017
TBLA0I03410 Chr9 complement(821181..822974) [1794 bp, 597 aa] {O...    41   0.019
TBLA0C06180 Chr3 (1499471..1501357) [1887 bp, 628 aa] {ON} Anc_5...    41   0.019
TPHA0I03250 Chr9 complement(715976..717922) [1947 bp, 648 aa] {O...    41   0.019
Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}...    41   0.019
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    41   0.020
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    41   0.020
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    41   0.021
AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic ho...    41   0.021
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    41   0.021
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.022
CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON...    40   0.022
YOL091W Chr15 (145334..147163) [1830 bp, 609 aa] {ON}  SPO21Comp...    40   0.025
KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {...    40   0.025
CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON...    40   0.026
TPHA0L02220 Chr12 (463956..465104) [1149 bp, 382 aa] {ON} Anc_5....    40   0.027
TPHA0C00260 Chr3 complement(40434..41582) [1149 bp, 382 aa] {ON}...    40   0.027
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    40   0.027
Suva_5.26 Chr5 (46040..48943) [2904 bp, 967 aa] {ON} YEL043W (REAL)    40   0.028
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    40   0.028
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    40   0.029
TDEL0C05910 Chr3 complement(1063668..1067585) [3918 bp, 1305 aa]...    40   0.029
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    40   0.030
NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {O...    40   0.030
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    40   0.033
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    40   0.033
SAKL0A05170g Chr1 complement(466816..468768) [1953 bp, 650 aa] {...    40   0.033
CAGL0G06314g Chr7 complement(603668..605629) [1962 bp, 653 aa] {...    40   0.033
Smik_10.216 Chr10 complement(355936..356217,356218..357669,35767...    40   0.034
Ecym_3006 Chr3 complement(11788..13965) [2178 bp, 725 aa] {ON} s...    40   0.034
KAFR0H00740 Chr8 (139077..140207) [1131 bp, 376 aa] {ON} Anc_3.3...    40   0.035
TBLA0G01840 Chr7 (486912..488105) [1194 bp, 397 aa] {ON} Anc_2.5...    40   0.036
TBLA0A10610 Chr1 (2624948..2626219) [1272 bp, 423 aa] {ON} Anc_2...    40   0.037
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...    40   0.038
TBLA0D03840 Chr4 (952421..956197) [3777 bp, 1258 aa] {ON} Anc_1....    40   0.038
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    40   0.038
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    40   0.038
TBLA0E04620 Chr5 (1178465..1183159) [4695 bp, 1564 aa] {ON} Anc_...    40   0.039
Smik_12.394 Chr12 complement(690403..695169) [4767 bp, 1588 aa] ...    40   0.039
Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}...    40   0.040
YMR198W Chr13 (659745..661529) [1785 bp, 594 aa] {ON}  CIK1Kines...    40   0.042
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.043
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    40   0.044
KAFR0F02630 Chr6 complement(514042..516066) [2025 bp, 674 aa] {O...    40   0.044
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    40   0.045
KNAG0G01730 Chr7 (383744..386125) [2382 bp, 793 aa] {ON} Anc_8.2...    40   0.046
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     40   0.047
SAKL0E14212g Chr5 (1169895..1172657) [2763 bp, 920 aa] {ON} simi...    40   0.047
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    40   0.047
NCAS0A14500 Chr1 complement(2855747..2858878) [3132 bp, 1043 aa]...    40   0.048
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    40   0.049
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    40   0.049
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}              40   0.049
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    40   0.050
Kpol_2000.34 s2000 complement(63284..67201) [3918 bp, 1305 aa] {...    40   0.050
NDAI0G05870 Chr7 (1456354..1457745) [1392 bp, 463 aa] {ON} Anc_1...    39   0.051
Kpol_1072.53 s1072 (122356..123771) [1416 bp, 471 aa] {ON} (1223...    39   0.051
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    40   0.051
TBLA0H02720 Chr8 complement(641752..643857) [2106 bp, 701 aa] {O...    39   0.058
TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.36...    39   0.059
NDAI0E04660 Chr5 complement(1055590..1056693) [1104 bp, 367 aa] ...    39   0.060
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    39   0.061
KLTH0G01012g Chr7 (73388..76018) [2631 bp, 876 aa] {ON} similar ...    39   0.061
Smik_11.165 Chr11 (282628..285273) [2646 bp, 881 aa] {ON} YKL073...    39   0.061
Kwal_14.2326 s14 (707822..710593) [2772 bp, 923 aa] {ON} YLR309C...    39   0.062
Kthe_YGOB_Anc_5.296 Chr7 (520932..522119) [1188 bp, 395 aa] {ON}...    39   0.062
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    39   0.064
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    39   0.064
Kpol_1024.29 s1024 (83563..89553) [5991 bp, 1996 aa] {ON} (83563...    39   0.068
KLLA0F26180g Chr6 complement(2424326..2425789) [1464 bp, 487 aa]...    39   0.068
TBLA0B03460 Chr2 complement(801699..808766) [7068 bp, 2355 aa] {...    39   0.069
TBLA0A09700 Chr1 complement(2385365..2386963) [1599 bp, 532 aa] ...    39   0.071
KAFR0F00150 Chr6 complement(46123..47844) [1722 bp, 573 aa] {ON}...    39   0.073
YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON} ...    39   0.076
KLTH0D17688g Chr4 (1470627..1472669) [2043 bp, 680 aa] {ON} weak...    39   0.076
Kpol_1010.72 s1010 (178801..179937) [1137 bp, 378 aa] {ON} (1788...    39   0.080
TBLA0B04240 Chr2 (977985..980519) [2535 bp, 844 aa] {ON} Anc_8.6...    39   0.080
TPHA0H02000 Chr8 (471336..474155) [2820 bp, 939 aa] {ON} Anc_6.2...    39   0.082
TPHA0E00560 Chr5 (96958..100278) [3321 bp, 1106 aa] {ON} Anc_7.4...    39   0.084
SAKL0B07062g Chr2 complement(611326..614658) [3333 bp, 1110 aa] ...    39   0.084
NDAI0G00270 Chr7 (41767..45216) [3450 bp, 1149 aa] {ON} Anc_1.48...    39   0.084
TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39...    39   0.084
KNAG0H00820 Chr8 (127894..131364) [3471 bp, 1156 aa] {ON} Anc_3....    39   0.084
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.084
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    39   0.085
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    39   0.086
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    39   0.086
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    39   0.087
KAFR0G02340 Chr7 complement(487034..491935) [4902 bp, 1633 aa] {...    39   0.088
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...    39   0.088
KAFR0E00310 Chr5 complement(63266..70663) [7398 bp, 2465 aa] {ON...    39   0.090
KAFR0J00280 Chr10 (45785..47350) [1566 bp, 521 aa] {ON} Anc_3.54...    39   0.092
TPHA0M01310 Chr13 (271249..272895) [1647 bp, 548 aa] {ON} Anc_3....    39   0.094
NCAS0J01230 Chr10 (215105..216064) [960 bp, 319 aa] {ON}               38   0.095
Kpol_367.5 s367 complement(12001..13689) [1689 bp, 562 aa] {ON} ...    39   0.095
Kpol_413.5 s413 (13659..15365) [1707 bp, 568 aa] {ON} (13659..15...    39   0.095
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    37   0.096
Suva_13.380 Chr13 (640164..641963) [1800 bp, 599 aa] {ON} YMR198...    39   0.097
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    39   0.098
TPHA0G02960 Chr7 complement(635722..637701) [1980 bp, 659 aa] {O...    39   0.099
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    39   0.10 
NCAS0J01000 Chr10 (166339..168546) [2208 bp, 735 aa] {ON} Anc_4....    39   0.10 
TPHA0G01580 Chr7 complement(322799..325111) [2313 bp, 770 aa] {O...    39   0.10 
NDAI0F00330 Chr6 (77559..79946) [2388 bp, 795 aa] {ON} Anc_5.696...    39   0.10 
TPHA0D01590 Chr4 (331386..333905) [2520 bp, 839 aa] {ON} Anc_2.2...    39   0.10 
TBLA0C04640 Chr3 (1125503..1128259) [2757 bp, 918 aa] {ON} Anc_7...    39   0.11 
Smik_13.488 Chr13 complement(798674..801622) [2949 bp, 982 aa] {...    39   0.11 
KLLA0E06249g Chr5 (562140..562781) [642 bp, 213 aa] {ON} some si...    37   0.11 
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...    39   0.11 
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    38   0.12 
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    39   0.12 
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    38   0.13 
TPHA0J02260 Chr10 (502547..504697) [2151 bp, 716 aa] {ON} Anc_6....    38   0.13 
YDL239C Chr4 complement(26403..28775) [2373 bp, 790 aa] {ON}  AD...    38   0.14 
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    38   0.14 
NDAI0I01920 Chr9 complement(446203..447327) [1125 bp, 374 aa] {O...    38   0.14 
TBLA0C05460 Chr3 (1317522..1320155) [2634 bp, 877 aa] {ON} Anc_2...    38   0.14 
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    38   0.14 
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    38   0.14 
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    38   0.14 
Kwal_23.5662 s23 complement(1259373..1260641) [1269 bp, 422 aa] ...    38   0.15 
KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {...    38   0.15 
Smik_2.117 Chr2 (214839..222320) [7482 bp, 2493 aa] {ON} YBL004W...    38   0.16 
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    38   0.16 
KLLA0F11341g Chr6 complement(1045057..1046616) [1560 bp, 519 aa]...    38   0.16 
SAKL0G18898g Chr7 (1633040..1634617) [1578 bp, 525 aa] {ON} simi...    38   0.16 
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    38   0.17 
Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {...    38   0.17 
KNAG0E01670 Chr5 complement(336548..337033) [486 bp, 161 aa] {ON...    36   0.17 
NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] ...    38   0.17 
Kwal_27.11183 s27 (675668..677650) [1983 bp, 660 aa] {ON} YGL086...    38   0.17 
TPHA0O01350 Chr15 complement(265993..268545) [2553 bp, 850 aa] {...    38   0.18 
Ecym_8198 Chr8 complement(406687..409554) [2868 bp, 955 aa] {ON}...    38   0.18 
AFR456C Chr6 complement(1258669..1261716) [3048 bp, 1015 aa] {ON...    38   0.19 
TBLA0G01870 Chr7 complement(493326..496832) [3507 bp, 1168 aa] {...    38   0.19 
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    38   0.19 
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    38   0.19 
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    38   0.19 
TPHA0K00980 Chr11 complement(203232..207518) [4287 bp, 1428 aa] ...    38   0.19 
Smik_1.42 Chr1 complement(84475..88803) [4329 bp, 1442 aa] {ON} ...    38   0.19 
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    38   0.20 
TBLA0J00690 Chr10 (157822..163251) [5430 bp, 1809 aa] {ON} Anc_5...    38   0.20 
Suva_8.254 Chr8 complement(457591..459003) [1413 bp, 470 aa] {ON...    37   0.20 
KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa]...    38   0.21 
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    37   0.22 
NCAS0B08400 Chr2 (1604783..1606876) [2094 bp, 697 aa] {ON} Anc_1...    37   0.23 
NDAI0A08740 Chr1 (2011619..2013790) [2172 bp, 723 aa] {ON} Anc_7...    37   0.23 
TBLA0A01840 Chr1 (447415..449661) [2247 bp, 748 aa] {ON} Anc_6.1...    37   0.23 
TPHA0I02320 Chr9 (512963..514018) [1056 bp, 351 aa] {ON} Anc_7.1...    37   0.23 
KLLA0D09394g Chr4 (795025..797436) [2412 bp, 803 aa] {ON} simila...    37   0.24 
CAGL0K08404g Chr11 complement(846867..849335) [2469 bp, 822 aa] ...    37   0.24 
ZYRO0B06182g Chr2 complement(496610..499180) [2571 bp, 856 aa] {...    37   0.24 
TPHA0P00480 Chr16 complement(99165..101735) [2571 bp, 856 aa] {O...    37   0.24 
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...    37   0.24 
TBLA0A01860 Chr1 (452220..454826) [2607 bp, 868 aa] {ON} Anc_6.1...    37   0.24 
Kpol_1060.11 s1060 (30550..33249) [2700 bp, 899 aa] {ON} (30550....    37   0.24 
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    37   0.24 
TBLA0H01100 Chr8 (244045..246942) [2898 bp, 965 aa] {ON} Anc_8.3...    37   0.24 
NDAI0E04100 Chr5 (920291..921496) [1206 bp, 401 aa] {ON}               37   0.25 
Skud_12.394 Chr12 complement(693159..697940) [4782 bp, 1593 aa] ...    37   0.26 
Suva_2.123 Chr2 (216544..224028) [7485 bp, 2494 aa] {ON} YBL004W...    37   0.27 
Kpol_1066.5 s1066 complement(6994..8487) [1494 bp, 497 aa] {ON} ...    37   0.27 
NDAI0I03120 Chr9 complement(733184..734983) [1800 bp, 599 aa] {O...    37   0.29 
YDR460W Chr4 (1383811..1384776) [966 bp, 321 aa] {ON}  TFB3Subun...    37   0.29 
KAFR0C02150 Chr3 (428622..430691) [2070 bp, 689 aa] {ON} Anc_6.1...    37   0.30 
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    37   0.31 
YJL041W Chr10 (365784..365784,365903..368373) [2472 bp, 823 aa] ...    37   0.31 
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    37   0.31 
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    37   0.32 
CAGL0F02035g Chr6 complement(195254..196375) [1122 bp, 373 aa] {...    37   0.32 
KLTH0E15048g Chr5 (1335840..1338881) [3042 bp, 1013 aa] {ON} sim...    37   0.32 
TBLA0B02520 Chr2 complement(578498..581590) [3093 bp, 1030 aa] {...    37   0.32 
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    37   0.32 
KAFR0C00960 Chr3 (195663..196892) [1230 bp, 409 aa] {ON} Anc_3.1...    37   0.33 
Smik_6.293 Chr6 complement(461472..462701) [1230 bp, 409 aa] {ON...    37   0.33 
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    37   0.33 
Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR32...    37   0.34 
NDAI0A05380 Chr1 complement(1212670..1217562) [4893 bp, 1630 aa]...    37   0.34 
TBLA0C02250 Chr3 (528050..533305) [5256 bp, 1751 aa] {ON} Anc_3....    37   0.34 
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    37   0.34 
Skud_2.110 Chr2 (207224..214711) [7488 bp, 2495 aa] {ON} YBL004W...    37   0.35 
TBLA0G03150 Chr7 (832779..834314) [1536 bp, 511 aa] {ON} Anc_3.1...    37   0.36 
AER057W Chr5 (741957..742895) [939 bp, 312 aa] {ON} Syntenic hom...    36   0.38 
CAGL0H00638g Chr8 complement(61015..62769) [1755 bp, 584 aa] {ON...    37   0.38 
AEL136C Chr5 complement(367453..369381) [1929 bp, 642 aa] {ON} S...    37   0.39 
KNAG0I00700 Chr9 (122565..124562) [1998 bp, 665 aa] {ON} Anc_2.3...    37   0.39 
NCAS0H01070 Chr8 complement(201097..203223) [2127 bp, 708 aa] {O...    37   0.39 
TPHA0C00940 Chr3 (199183..201468) [2286 bp, 761 aa] {ON} Anc_8.3...    37   0.40 
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    37   0.41 
CAGL0M13893g Chr13 complement(1374814..1377246) [2433 bp, 810 aa...    37   0.41 
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...    37   0.41 
NDAI0C03720 Chr3 complement(849504..852158) [2655 bp, 884 aa] {O...    37   0.41 
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    37   0.41 
Suva_16.184 Chr16 (319761..322448) [2688 bp, 895 aa] {ON} YPL126...    37   0.41 
NDAI0A08440 Chr1 complement(1942824..1945532) [2709 bp, 902 aa] ...    37   0.41 
Smik_7.360 Chr7 (595093..598074) [2982 bp, 993 aa] {ON} YFR040W ...    37   0.42 
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...    37   0.42 
TBLA0E00340 Chr5 complement(57462..60764) [3303 bp, 1100 aa] {ON...    37   0.43 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    37   0.43 
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    37   0.43 
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....    37   0.44 
NDAI0E03510 Chr5 (755198..756451) [1254 bp, 417 aa] {ON} Anc_7.1...    36   0.44 
YLR310C Chr12 complement(752224..756993) [4770 bp, 1589 aa] {ON}...    37   0.44 
TBLA0I00270 Chr9 (37118..42046) [4929 bp, 1642 aa] {ON} Anc_2.49...    37   0.44 
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    37   0.45 
SAKL0H08294g Chr8 (713096..714484) [1389 bp, 462 aa] {ON} simila...    36   0.46 
KAFR0H00770 Chr8 complement(143144..144607) [1464 bp, 487 aa] {O...    36   0.47 
Kpol_1010.1 s1010 complement(1673..2632) [960 bp, 319 aa] {ON} c...    36   0.50 
Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON...    36   0.51 
TBLA0B03680 Chr2 (848989..850977) [1989 bp, 662 aa] {ON} Anc_8.7...    36   0.51 
Kpol_YGOB_1055.70 s1055 complement(184555..186555) [2001 bp, 666...    36   0.51 
Kpol_1055.70 s1055 complement(184555..186561) [2007 bp, 668 aa] ...    36   0.51 
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    36   0.51 
Suva_9.45 Chr9 (72816..74882) [2067 bp, 688 aa] {ON} YIL144W (REAL)    36   0.52 
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    36   0.52 
NCAS0A01320 Chr1 (257101..259305) [2205 bp, 734 aa] {ON} Anc_5.260     36   0.52 
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    36   0.52 
YBR128C Chr2 complement(493081..494115) [1035 bp, 344 aa] {ON}  ...    36   0.53 
TBLA0C06310 Chr3 complement(1525146..1525865) [720 bp, 239 aa] {...    35   0.53 
KNAG0E03310 Chr5 complement(663541..666024) [2484 bp, 827 aa] {O...    36   0.53 
AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,...    36   0.54 
TPHA0J02180 Chr10 (488304..490841) [2538 bp, 845 aa] {ON} Anc_6....    36   0.54 
Smik_12.228 Chr12 complement(442563..445178) [2616 bp, 871 aa] {...    36   0.54 
TPHA0N01410 Chr14 complement(310293..312917) [2625 bp, 874 aa] {...    36   0.54 
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    36   0.54 
CAGL0G02959g Chr7 (272520..275276) [2757 bp, 918 aa] {ON} simila...    36   0.54 
Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)    36   0.55 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.56 
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    36   0.57 
YPL016W Chr16 (521014..524958) [3945 bp, 1314 aa] {ON}  SWI1Subu...    36   0.57 
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    36   0.57 
NDAI0H00410 Chr8 (84579..89348) [4770 bp, 1589 aa] {ON} Anc_4.45       36   0.58 
Kpol_1018.128 s1018 complement(337264..344691) [7428 bp, 2475 aa...    36   0.60 
NDAI0G05380 Chr7 (1318467..1320248) [1782 bp, 593 aa] {ON} Anc_1...    36   0.65 
Suva_8.376 Chr8 complement(663919..665727) [1809 bp, 602 aa] {ON...    36   0.66 
TPHA0M01520 Chr13 (323315..325168) [1854 bp, 617 aa] {ON} Anc_3....    36   0.66 
TPHA0C03270 Chr3 complement(718569..720437) [1869 bp, 622 aa] {O...    36   0.66 
TBLA0I02970 Chr9 (707264..708217) [954 bp, 317 aa] {ON} Anc_4.25...    35   0.66 
KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {...    36   0.67 
KLLA0E13003g Chr5 (1151967..1153988) [2022 bp, 673 aa] {ON} simi...    36   0.67 
YOR033C Chr15 complement(392416..394524) [2109 bp, 702 aa] {ON} ...    36   0.68 
KNAG0C02120 Chr3 complement(412685..415039) [2355 bp, 784 aa] {O...    36   0.69 
KAFR0E00470 Chr5 (101871..104525) [2655 bp, 884 aa] {ON} Anc_1.4...    36   0.71 
NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {O...    36   0.72 
TBLA0I00160 Chr9 complement(18521..21808) [3288 bp, 1095 aa] {ON...    36   0.73 
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    36   0.73 
KLLA0E17931g Chr5 complement(1598775..1599242,1599482..1599499) ...    34   0.74 
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    36   0.74 
KLLA0E08031g Chr5 complement(722953..724179) [1227 bp, 408 aa] {...    35   0.76 
Kpol_534.5 s534 complement(13392..18062) [4671 bp, 1556 aa] {ON}...    36   0.76 
TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {O...    35   0.77 
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    36   0.77 
TPHA0B03360 Chr2 (774118..780630) [6513 bp, 2170 aa] {ON} Anc_8....    36   0.78 
TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON}               35   0.78 
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    36   0.80 
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    36   0.80 
KAFR0B02920 Chr2 complement(600352..615153) [14802 bp, 4933 aa] ...    36   0.80 
KNAG0F02460 Chr6 (463897..464328) [432 bp, 143 aa] {ON} Anc_6.13...    34   0.81 
NDAI0E02120 Chr5 (434474..435334) [861 bp, 286 aa] {ON} Anc_8.61...    35   0.82 
Kpol_1050.70 s1050 (154194..155735) [1542 bp, 513 aa] {ON} (1541...    35   0.82 
TBLA0I02990 Chr9 (710633..712255) [1623 bp, 540 aa] {ON} Anc_4.2...    35   0.84 
NDAI0G01160 Chr7 complement(252677..254317) [1641 bp, 546 aa] {O...    35   0.84 
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...    35   0.85 
YIL037C Chr9 complement(283029..284999) [1971 bp, 656 aa] {ON}  ...    35   0.88 
CAGL0E04972g Chr5 complement(480915..482930) [2016 bp, 671 aa] {...    35   0.88 
Kpol_359.10 s359 complement(13823..15895) [2073 bp, 690 aa] {ON}...    35   0.89 
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    35   0.89 
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    35   0.91 
KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {O...    35   0.92 
Kpol_147.3 s147 complement(1776..4352) [2577 bp, 858 aa] {ON} co...    35   0.93 
ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON...    35   0.94 
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    35   0.94 
TPHA0H01920 Chr8 (450069..453008) [2940 bp, 979 aa] {ON} Anc_6.2...    35   0.95 
NDAI0E03400 Chr5 complement(724039..727341) [3303 bp, 1100 aa] {...    35   0.96 
NCAS0B07600 Chr2 complement(1435998..1439957) [3960 bp, 1319 aa]...    35   0.98 
Smik_4.701 Chr4 (1242943..1244124) [1182 bp, 393 aa] {ON} YDR427...    35   0.98 
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    35   0.99 
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    35   0.99 
Skud_5.215 Chr5 complement(337400..341692) [4293 bp, 1430 aa] {O...    35   0.99 
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    35   1.0  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    35   1.0  
TBLA0A10740 Chr1 complement(2651999..2659555) [7557 bp, 2518 aa]...    35   1.0  
Suva_15.96 Chr15 (171608..172963) [1356 bp, 451 aa] {ON} YOL069W...    35   1.0  
ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}...    35   1.0  
NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa...    35   1.0  
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    35   1.1  
NCAS0B06080 Chr2 complement(1149292..1151241) [1950 bp, 649 aa] ...    35   1.2  
Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {O...    35   1.2  
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    35   1.2  
Smik_4.738 Chr4 (1305057..1306022) [966 bp, 321 aa] {ON} YDR460W...    35   1.2  
KAFR0C01340 Chr3 complement(279474..281588) [2115 bp, 704 aa] {O...    35   1.2  
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...    35   1.2  
Ecym_3494 Chr3 (924743..927133) [2391 bp, 796 aa] {ON} similar t...    35   1.2  
Kwal_23.5498 s23 (1188749..1191229) [2481 bp, 826 aa] {ON} YJL04...    35   1.2  
YKL073W Chr11 (296430..299075) [2646 bp, 881 aa] {ON}  LHS1Molec...    35   1.2  
TPHA0F00600 Chr6 (139959..142715) [2757 bp, 918 aa] {ON} Anc_4.9...    35   1.2  
Kpol_1018.29 s1018 complement(77819..80635) [2817 bp, 938 aa] {O...    35   1.2  
NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {O...    35   1.2  
CAGL0L01221g Chr12 (139739..142723) [2985 bp, 994 aa] {ON} simil...    35   1.2  
TPHA0F00560 Chr6 complement(130145..133351) [3207 bp, 1068 aa] {...    35   1.3  
TPHA0N01210 Chr14 (260932..264756) [3825 bp, 1274 aa] {ON} Anc_6...    35   1.3  
TBLA0B05820 Chr2 (1371604..1372767) [1164 bp, 387 aa] {ON} Anc_2...    35   1.3  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    35   1.3  
KAFR0E02650 Chr5 (538042..542328) [4287 bp, 1428 aa] {ON} Anc_8....    35   1.3  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    35   1.3  
TPHA0M02090 Chr13 (430238..436132) [5895 bp, 1964 aa] {ON} Anc_6...    35   1.3  
CAGL0E01265g Chr5 complement(113167..119454) [6288 bp, 2095 aa] ...    35   1.3  
TPHA0E02610 Chr5 complement(548973..550283) [1311 bp, 436 aa] {O...    35   1.3  
NDAI0I01250 Chr9 complement(298902..300350) [1449 bp, 482 aa] {O...    35   1.4  
ZYRO0E01100g Chr5 complement(75069..76568) [1500 bp, 499 aa] {ON...    35   1.4  
CAGL0H06919g Chr8 complement(685736..687619) [1884 bp, 627 aa] {...    35   1.5  
Suva_15.142 Chr15 (247389..249386) [1998 bp, 665 aa] {ON} YOL025...    35   1.5  
Suva_11.45 Chr11 complement(95306..97351) [2046 bp, 681 aa] {ON}...    35   1.5  
Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)    35   1.5  
TPHA0H01040 Chr8 (223391..223765) [375 bp, 124 aa] {ON} Anc_5.99...    33   1.5  
Kpol_1062.48 s1062 (101524..103968) [2445 bp, 814 aa] {ON} (1015...    35   1.6  
CAGL0G01496g Chr7 complement(140652..143150) [2499 bp, 832 aa] {...    35   1.6  
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    35   1.6  
TPHA0D00740 Chr4 complement(148677..151241) [2565 bp, 854 aa] {O...    35   1.6  
KLTH0G07326g Chr7 complement(591049..593741,593816..593816) [269...    35   1.6  
NDAI0A08880 Chr1 (2043948..2046698) [2751 bp, 916 aa] {ON} Anc_7...    35   1.6  
NDAI0B06190 Chr2 (1503529..1506372) [2844 bp, 947 aa] {ON} Anc_3...    35   1.6  
NCAS0I00630 Chr9 complement(104540..105604) [1065 bp, 354 aa] {O...    34   1.6  
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    35   1.7  
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...    35   1.7  
TBLA0B09810 Chr2 (2327773..2331594) [3822 bp, 1273 aa] {ON}            35   1.7  
TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON} Anc_...    35   1.7  
SAKL0D11088g Chr4 complement(916181..920452) [4272 bp, 1423 aa] ...    35   1.7  
KNAG0K01510 Chr11 (312794..313969) [1176 bp, 391 aa] {ON} Anc_3....    34   1.7  
KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] ...    34   1.8  
KAFR0C02310 Chr3 (453448..454233) [786 bp, 261 aa] {ON} Anc_3.47...    34   1.8  
TPHA0C02960 Chr3 complement(647899..648384) [486 bp, 161 aa] {ON...    33   1.8  
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...    34   1.8  
Kpol_269.8 s269 (14433..15854) [1422 bp, 473 aa] {ON} (14433..15...    34   1.8  
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    33   1.9  
NDAI0I03060 Chr9 (723481..725163) [1683 bp, 560 aa] {ON} Anc_3.5...    34   1.9  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...    34   1.9  
NCAS0A08860 Chr1 (1753035..1753544) [510 bp, 169 aa] {ON} Anc_1....    33   1.9  
KAFR0D03290 Chr4 (648947..649597) [651 bp, 216 aa] {ON}  YMR077C       33   2.0  
TDEL0A06490 Chr1 complement(1135618..1137783) [2166 bp, 721 aa] ...    34   2.0  
Kwal_27.10114 s27 (199684..202098) [2415 bp, 804 aa] {ON} YEL043...    34   2.1  
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...    34   2.1  
TBLA0A10580 Chr1 (2617516..2619957) [2442 bp, 813 aa] {ON} Anc_4...    34   2.1  
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    34   2.1  
KLLA0A01023g Chr1 (96383..98968) [2586 bp, 861 aa] {ON} similar ...    34   2.1  
SAKL0F01166g Chr6 (100915..103569) [2655 bp, 884 aa] {ON} simila...    34   2.1  
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    34   2.1  
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    34   2.1  
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...    34   2.1  
TPHA0M00980 Chr13 complement(189859..192741) [2883 bp, 960 aa] {...    34   2.1  
Suva_2.330 Chr2 complement(580324..583236) [2913 bp, 970 aa] {ON...    34   2.1  
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    34   2.1  
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    34   2.1  
KAFR0G01300 Chr7 (289835..290539) [705 bp, 234 aa] {ON} Anc_3.98...    33   2.1  
NDAI0I02760 Chr9 complement(646478..649687) [3210 bp, 1069 aa] {...    34   2.2  
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    34   2.2  
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    34   2.2  
Suva_11.21 Chr11 complement(47761..48159,48580..51708) [3528 bp,...    34   2.2  
TBLA0E00880 Chr5 complement(190586..194254) [3669 bp, 1222 aa] {...    34   2.2  
TBLA0B09150 Chr2 complement(2166239..2167357) [1119 bp, 372 aa] ...    34   2.2  
TPHA0D04050 Chr4 complement(863636..864763) [1128 bp, 375 aa] {O...    34   2.2  
NDAI0A07620 Chr1 complement(1745936..1749829) [3894 bp, 1297 aa]...    34   2.2  
TBLA0G02190 Chr7 complement(568903..573144) [4242 bp, 1413 aa] {...    34   2.2  
CAGL0F03971g Chr6 (386224..390591) [4368 bp, 1455 aa] {ON} weakl...    34   2.2  
Suva_1.37 Chr1 complement(64307..68722) [4416 bp, 1471 aa] {ON} ...    34   2.2  
Kpol_541.26 s541 (77916..79175) [1260 bp, 419 aa] {ON} (77916..7...    34   2.3  
NCAS0B05460 Chr2 (1024533..1032599) [8067 bp, 2688 aa] {ON} Anc_...    34   2.3  
TPHA0G01180 Chr7 (238621..240084) [1464 bp, 487 aa] {ON} Anc_8.7...    34   2.4  
Kwal_34.15898 s34 (104591..106294) [1704 bp, 567 aa] {ON} YOR308...    34   2.5  
TDEL0A04960 Chr1 (876938..877819) [882 bp, 293 aa] {ON} Anc_5.63...    33   2.5  
NDAI0F02680 Chr6 (658159..659922) [1764 bp, 587 aa] {ON} Anc_2.1...    34   2.6  
AFR636C Chr6 complement(1596821..1598614) [1794 bp, 597 aa] {ON}...    34   2.6  
TPHA0M00170 Chr13 complement(33610..35478) [1869 bp, 622 aa] {ON...    34   2.6  
NDAI0C02240 Chr3 complement(502165..504162) [1998 bp, 665 aa] {O...    34   2.6  
TBLA0B04890 Chr2 complement(1152059..1154065) [2007 bp, 668 aa] ...    34   2.6  
TBLA0C03320 Chr3 complement(803654..805771) [2118 bp, 705 aa] {O...    34   2.7  
CAGL0I07623g Chr9 complement(733766..735901) [2136 bp, 711 aa] {...    34   2.7  
TBLA0J00710 Chr10 complement(165057..165713) [657 bp, 218 aa] {O...    33   2.7  
Skud_10.176 Chr10 complement(332145..334322) [2178 bp, 726 aa] {...    34   2.7  
ZYRO0D13882g Chr4 (1173109..1174062) [954 bp, 317 aa] {ON} highl...    33   2.7  
Kpol_1010.58 s1010 (142344..142520,142522..142710) [366 bp, 121 ...    32   2.7  
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    34   2.7  
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    34   2.7  
SAKL0A02816g Chr1 complement(254792..257407) [2616 bp, 871 aa] {...    34   2.8  
NDAI0C03980 Chr3 complement(901982..904702) [2721 bp, 906 aa] {O...    34   2.8  
TDEL0A04180 Chr1 (742669..743712) [1044 bp, 347 aa] {ON} Anc_5.5...    33   2.8  
KLLA0E08977g Chr5 (794616..797819) [3204 bp, 1067 aa] {ON} simil...    34   2.8  
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...    34   2.8  
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    34   2.8  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    34   2.8  
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    34   2.9  
TPHA0J01510 Chr10 (345697..349164) [3468 bp, 1155 aa] {ON} Anc_5...    34   2.9  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...    34   2.9  
Suva_5.211 Chr5 complement(318032..322327) [4296 bp, 1431 aa] {O...    34   2.9  
NDAI0G01930 Chr7 (435402..435443,435527..436630) [1146 bp, 381 a...    33   2.9  
TPHA0L00420 Chr12 complement(65228..69559) [4332 bp, 1443 aa] {O...    34   2.9  
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    34   2.9  
NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON}              34   2.9  
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    34   2.9  
Skud_10.105 Chr10 complement(179830..185142) [5313 bp, 1770 aa] ...    34   3.0  
TBLA0B10050 Chr2 complement(2408235..2415311) [7077 bp, 2358 aa]...    34   3.0  
ZYRO0D03168g Chr4 (245353..257490) [12138 bp, 4045 aa] {ON} simi...    34   3.1  
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...    33   3.3  
KLTH0H10604g Chr8 (916591..918201) [1611 bp, 536 aa] {ON} simila...    33   3.3  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...    33   3.3  
NCAS0F03880 Chr6 complement(777549..779264) [1716 bp, 571 aa] {O...    33   3.3  
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    33   3.3  
KLTH0H08712g Chr8 complement(756097..757845) [1749 bp, 582 aa] {...    33   3.3  
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    33   3.4  
TBLA0J01940 Chr10 complement(462906..464825) [1920 bp, 639 aa] {...    33   3.4  
TDEL0E03150 Chr5 (592206..594128) [1923 bp, 640 aa] {ON} Anc_5.3...    33   3.4  
KAFR0G01680 Chr7 (367638..369731) [2094 bp, 697 aa] {ON} Anc_3.3...    33   3.5  
Smik_7.197 Chr7 (341623..343776) [2154 bp, 717 aa] {ON} YGL086W ...    33   3.5  
SAKL0E08008g Chr5 (645124..647559) [2436 bp, 811 aa] {ON} simila...    33   3.6  
YCR030C Chr3 complement(173826..176438) [2613 bp, 870 aa] {ON}  ...    33   3.6  
Kwal_47.19214 s47 complement(1136336..1138966) [2631 bp, 876 aa]...    33   3.6  
Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W ...    33   3.6  
TBLA0C04260 Chr3 complement(1023407..1026055) [2649 bp, 882 aa] ...    33   3.6  
YDR027C Chr4 complement(494649..497318) [2670 bp, 889 aa] {ON}  ...    33   3.6  
Kwal_27.11335 s27 complement(756212..758908) [2697 bp, 898 aa] {...    33   3.6  
NCAS0D00320 Chr4 complement(46844..49570) [2727 bp, 908 aa] {ON}...    33   3.6  
NDAI0A01010 Chr1 complement(213171..215909) [2739 bp, 912 aa] {O...    33   3.6  
Kpol_1073.18 s1073 (32522..33622,33624..35291) [2769 bp, 922 aa]...    33   3.6  
SAKL0G06512g Chr7 complement(543956..544978) [1023 bp, 340 aa] {...    33   3.7  
NDAI0D03650 Chr4 (866072..869002) [2931 bp, 976 aa] {ON} Anc_4.9...    33   3.7  
TPHA0L01460 Chr12 (302011..303054) [1044 bp, 347 aa] {ON} Anc_8....    33   3.7  
Kpol_387.3 s387 complement(1966..5154) [3189 bp, 1062 aa] {ON} c...    33   3.7  
TPHA0G02880 Chr7 complement(612962..616174) [3213 bp, 1070 aa] {...    33   3.7  
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    33   3.7  
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    33   3.7  
TPHA0G02430 Chr7 complement(493879..497424) [3546 bp, 1181 aa] {...    33   3.8  
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...    33   3.8  
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    33   3.8  
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    33   3.8  
CAGL0F05797g Chr6 complement(579968..584380) [4413 bp, 1470 aa] ...    33   3.8  
TBLA0B02650 Chr2 complement(605245..609885) [4641 bp, 1546 aa] {...    33   3.8  
TPHA0F01590 Chr6 complement(365642..370519) [4878 bp, 1625 aa] {...    33   3.9  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    33   3.9  
ZYRO0A04356g Chr1 (350421..357890) [7470 bp, 2489 aa] {ON} simil...    33   4.0  
KLLA0F11506g Chr6 complement(1055769..1057103) [1335 bp, 444 aa]...    33   4.1  
NDAI0J02470 Chr10 (604730..606118) [1389 bp, 462 aa] {ON} Anc_4....    33   4.1  
Smik_7.164 Chr7 (295327..296733) [1407 bp, 468 aa] {ON} YGL111W ...    33   4.1  
KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.6...    33   4.2  
TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {O...    33   4.2  
KAFR0B05140 Chr2 (1058054..1059517) [1464 bp, 487 aa] {ON} Anc_2...    33   4.2  
KLTH0H15180g Chr8 complement(1317079..1318563) [1485 bp, 494 aa]...    33   4.2  
NDAI0A01280 Chr1 complement(275674..277179) [1506 bp, 501 aa] {O...    33   4.2  
TBLA0A05960 Chr1 (1469108..1470688) [1581 bp, 526 aa] {ON}             33   4.3  
KAFR0A07940 Chr1 (1590563..1592155) [1593 bp, 530 aa] {ON} Anc_2...    33   4.3  
TBLA0D03360 Chr4 (837880..839493) [1614 bp, 537 aa] {ON} Anc_5.2...    33   4.3  
NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}...    33   4.4  
NDAI0I02950 Chr9 complement(695622..697355) [1734 bp, 577 aa] {O...    33   4.4  
ZYRO0G06886g Chr7 (550132..551004) [873 bp, 290 aa] {ON} similar...    33   4.4  
CAGL0D04070g Chr4 (403855..404727) [873 bp, 290 aa] {ON} similar...    33   4.4  
NDAI0A02350 Chr1 (524346..525233) [888 bp, 295 aa] {ON} Anc_7.27...    33   4.5  
YDR484W Chr4 (1422763..1424688) [1926 bp, 641 aa] {ON}  VPS52Com...    33   4.5  
NDAI0C02450 Chr3 complement(561281..563218) [1938 bp, 645 aa] {O...    33   4.5  
Ecym_8240 Chr8 complement(492932..495018,495139..495139) [2088 b...    33   4.6  
Suva_11.90 Chr11 complement(172636..174816) [2181 bp, 726 aa] {O...    33   4.6  
NCAS0C03860 Chr3 complement(782670..785015) [2346 bp, 781 aa] {O...    33   4.7  
TPHA0B03540 Chr2 (826895..829249) [2355 bp, 784 aa] {ON} Anc_1.3...    33   4.7  
NDAI0C03480 Chr3 (796392..798755) [2364 bp, 787 aa] {ON} Anc_5.5...    33   4.7  
TBLA0B00170 Chr2 (26717..29134) [2418 bp, 805 aa] {ON} Anc_2.10 ...    33   4.7  
Suva_2.635 Chr2 (1136014..1136979) [966 bp, 321 aa] {ON} YDR460W...    33   4.7  
Skud_4.735 Chr4 (1303900..1304865) [966 bp, 321 aa] {ON} YDR460W...    33   4.7  
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    33   4.7  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   4.7  
TDEL0E03660 Chr5 complement(689473..692003,692119..692119) [2532...    33   4.7  
Skud_13.186 Chr13 complement(318929..321460) [2532 bp, 843 aa] {...    33   4.7  
Smik_8.181 Chr8 (296818..299385) [2568 bp, 855 aa] {ON} YHR103W ...    33   4.7  
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               33   4.7  
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    32   4.8  
Skud_4.424 Chr4 complement(755616..758534) [2919 bp, 972 aa] {ON...    33   4.8  
Suva_4.376 Chr4 complement(661913..662947) [1035 bp, 344 aa] {ON...    33   4.9  
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    33   4.9  
Skud_11.123 Chr11 complement(225550..228843) [3294 bp, 1097 aa] ...    33   4.9  
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    33   4.9  
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    33   4.9  
YOL104C Chr15 complement(116396..117454) [1059 bp, 352 aa] {ON} ...    33   4.9  
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    33   4.9  
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    33   4.9  
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    33   4.9  
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    33   4.9  
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    33   5.0  
KLTH0G14102g Chr7 complement(1220886..1224641) [3756 bp, 1251 aa...    33   5.0  
KLLA0F19448g Chr6 complement(1799571..1800266) [696 bp, 231 aa] ...    32   5.0  
Kpol_1016.25 s1016 complement(62829..66941) [4113 bp, 1370 aa] {...    33   5.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...    33   5.0  
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...    33   5.1  
TPHA0H00260 Chr8 (43951..44490) [540 bp, 179 aa] {ON}  YER134C         32   5.1  
KLLA0F16060g Chr6 (1490815..1491960) [1146 bp, 381 aa] {ON} simi...    33   5.1  
Suva_11.288 Chr11 complement(519375..531656) [12282 bp, 4093 aa]...    33   5.3  
Kpol_1032.77 s1032 (170141..171439) [1299 bp, 432 aa] {ON} (1701...    33   5.3  
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...    33   5.4  
TBLA0A00360 Chr1 complement(68504..69913) [1410 bp, 469 aa] {ON}...    33   5.5  
ZYRO0D09306g Chr4 complement(798117..798908) [792 bp, 263 aa] {O...    32   5.5  
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    33   5.6  
TPHA0L01630 Chr12 (344039..344863) [825 bp, 274 aa] {ON} Anc_8.5...    32   5.7  
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...    33   5.7  
TDEL0F03300 Chr6 (612424..614190) [1767 bp, 588 aa] {ON} Anc_3.4...    33   5.8  
TBLA0G01140 Chr7 (291850..293745) [1896 bp, 631 aa] {ON}               33   5.9  
TBLA0C06870 Chr3 (1658729..1659607) [879 bp, 292 aa] {ON} Anc_5....    32   5.9  
Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {O...    33   5.9  
KAFR0E02590 Chr5 (530390..532414) [2025 bp, 674 aa] {ON} Anc_8.4...    33   6.0  
TBLA0B08900 Chr2 complement(2110882..2112963) [2082 bp, 693 aa] ...    33   6.0  
Skud_8.29 Chr8 complement(60018..62225) [2208 bp, 735 aa] {ON} Y...    33   6.1  
Suva_11.262 Chr11 complement(481053..483290) [2238 bp, 745 aa] {...    33   6.1  
TPHA0P00570 Chr16 (113762..116020) [2259 bp, 752 aa] {ON} Anc_3....    33   6.1  
Suva_12.36 Chr12 (47143..48768,48772..49443) [2298 bp, 765 aa] {...    33   6.1  
Kpol_1031.71 s1031 (183424..185823) [2400 bp, 799 aa] {ON} (1834...    33   6.1  
CAGL0H10098g Chr8 complement(984334..986919) [2586 bp, 861 aa] {...    33   6.2  
YLR166C Chr12 complement(495429..498044) [2616 bp, 871 aa] {ON} ...    33   6.2  
KAFR0H00590 Chr8 (108768..111392) [2625 bp, 874 aa] {ON} Anc_5.6...    33   6.2  
TBLA0A00310 Chr1 complement(52232..54913) [2682 bp, 893 aa] {ON}...    33   6.2  
NCAS0A07930 Chr1 complement(1572820..1573803) [984 bp, 327 aa] {...    32   6.3  
NCAS0C01420 Chr3 (259862..262606) [2745 bp, 914 aa] {ON} Anc_8.623     33   6.3  
KAFR0J02350 Chr10 complement(447670..448326) [657 bp, 218 aa] {O...    32   6.3  
KAFR0E03560 Chr5 complement(716138..719038) [2901 bp, 966 aa] {O...    33   6.3  
TBLA0C06690 Chr3 (1614873..1618070) [3198 bp, 1065 aa] {ON} Anc_...    33   6.4  
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    33   6.4  
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    33   6.4  
KAFR0F00700 Chr6 complement(135981..139382) [3402 bp, 1133 aa] {...    33   6.4  
NCAS0A00570 Chr1 (96044..99742) [3699 bp, 1232 aa] {ON} Anc_1.79...    33   6.5  
TBLA0F03630 Chr6 (895311..896384) [1074 bp, 357 aa] {ON} Anc_8.1...    32   6.5  
TBLA0H00440 Chr8 (83907..87962) [4056 bp, 1351 aa] {ON} Anc_8.46...    33   6.5  
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    33   6.6  
Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W...    33   6.6  
YDR427W Chr4 (1322205..1323386) [1182 bp, 393 aa] {ON}  RPN9Non-...    32   6.8  
Kpol_1013.73 s1013 complement(175649..177022) [1374 bp, 457 aa] ...    32   7.1  
Ecym_8292 Chr8 complement(594594..595982) [1389 bp, 462 aa] {ON}...    32   7.1  
KLTH0H00682g Chr8 complement(69803..70579) [777 bp, 258 aa] {ON}...    32   7.2  
NDAI0F01270 Chr6 (310686..312110) [1425 bp, 474 aa] {ON} Anc_6.2...    32   7.2  
Kpol_1036.75 s1036 (204132..204917) [786 bp, 261 aa] {ON} (20413...    32   7.3  
CAGL0L10626g Chr12 (1136212..1137753) [1542 bp, 513 aa] {ON} som...    32   7.4  
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    32   7.4  
TPHA0K02150 Chr11 complement(459716..460531) [816 bp, 271 aa] {O...    32   7.4  
Kwal_23.6479 s23 (1603757..1604224) [468 bp, 155 aa] {OFF} YMR17...    31   7.5  
KAFR0D01860 Chr4 (372411..374084) [1674 bp, 557 aa] {ON} Anc_5.2...    32   7.5  
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    32   7.5  
Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {...    32   7.5  
CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly...    32   7.7  
Smik_11.365 Chr11 (630446..632395) [1950 bp, 649 aa] {ON} YKR101...    32   7.8  
TBLA0H00420 Chr8 complement(79080..79973) [894 bp, 297 aa] {ON}        32   7.9  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   7.9  
NCAS0H00640 Chr8 complement(113477..115621) [2145 bp, 714 aa] {O...    32   7.9  
TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.1...    32   7.9  
TPHA0A06030 Chr1 complement(1363382..1365667) [2286 bp, 761 aa] ...    32   8.0  
Suva_6.55 Chr6 (103697..106177) [2481 bp, 826 aa] {ON} YFL004W (...    32   8.1  
Skud_4.778 Chr4 complement(1376536..1379019) [2484 bp, 827 aa] {...    32   8.1  
Skud_3.108 Chr3 complement(158356..160974) [2619 bp, 872 aa] {ON...    32   8.2  
Kpol_1061.4 s1061 complement(10652..13414) [2763 bp, 920 aa] {ON...    32   8.2  
TBLA0H03810 Chr8 (927088..929883) [2796 bp, 931 aa] {ON} Anc_8.5...    32   8.2  
NCAS0A09840 Chr1 complement(1965276..1968074) [2799 bp, 932 aa] ...    32   8.2  
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    32   8.3  
TBLA0J00960 Chr10 complement(215541..218597) [3057 bp, 1018 aa] ...    32   8.3  
Kpol_1069.15 s1069 complement(34168..37272) [3105 bp, 1034 aa] {...    32   8.3  
Skud_7.271 Chr7 (464787..468032) [3246 bp, 1081 aa] {ON} YGL016W...    32   8.4  
TBLA0E00730 Chr5 complement(147919..151203) [3285 bp, 1094 aa] {...    32   8.4  
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    32   8.4  
Smik_15.53 Chr15 complement(85400..86458) [1059 bp, 352 aa] {ON}...    32   8.5  
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    32   8.6  
NDAI0H01240 Chr8 complement(298365..299039) [675 bp, 224 aa] {ON...    32   8.6  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...    32   8.6  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    32   8.6  
CAGL0M09086g Chr13 complement(904879..909219) [4341 bp, 1446 aa]...    32   8.6  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    32   8.6  
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    32   8.7  
TBLA0D00990 Chr4 (258884..264577) [5694 bp, 1897 aa] {ON} Anc_8....    32   8.8  
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    32   8.9  
Kwal_14.987 s14 (144237..145481) [1245 bp, 414 aa] {ON} YMR067C ...    32   9.1  
YLR423C Chr12 complement(971917..973170) [1254 bp, 417 aa] {ON} ...    32   9.1  
Kpol_1070.32 s1070 complement(72051..73328) [1278 bp, 425 aa] {O...    32   9.2  
Ecym_6410 Chr6 (795710..797173) [1464 bp, 487 aa] {ON} similar t...    32   9.5  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...    32   9.6  
Kpol_1002.55 s1002 complement(153314..154111) [798 bp, 265 aa] {...    32   9.7  
Skud_12.334 Chr12 complement(590993..591565) [573 bp, 190 aa] {O...    31   9.7  
KAFR0B02540 Chr2 complement(505010..506629) [1620 bp, 539 aa] {O...    32   9.8  

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
            YEL061C
          Length = 963

 Score = 1724 bits (4466), Expect = 0.0
 Identities = 895/963 (92%), Positives = 895/963 (92%)
 Frame = +1

Query: 1    MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
            MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI
Sbjct: 1    MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60

Query: 181  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
            GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM
Sbjct: 61   GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120

Query: 361  TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 540
            TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN
Sbjct: 121  TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180

Query: 541  DNGNFKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSM 720
            DNGNFKKLRIFD                     TTFLKKKLRNEALLRSRNIASSKRSSM
Sbjct: 181  DNGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSM 240

Query: 721  QTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI 900
            QTIRN              MFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI
Sbjct: 241  QTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI 300

Query: 901  TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 1080
            TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG
Sbjct: 301  TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 360

Query: 1081 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 1260
            SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT
Sbjct: 361  SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 420

Query: 1261 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD
Sbjct: 421  KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 480

Query: 1441 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 1620
            LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE
Sbjct: 481  LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 540

Query: 1621 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 1800
            LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS
Sbjct: 541  LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 600

Query: 1801 KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 1980
            KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF
Sbjct: 601  KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 660

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
            YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY
Sbjct: 661  YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 720

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 2340
            NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM
Sbjct: 721  NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 780

Query: 2341 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXX 2520
            SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS        
Sbjct: 781  SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKI 840

Query: 2521 XEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDT 2700
             EHFKTNDIAH                        RLHEFVKEGYLVTNESMKKLNELDT
Sbjct: 841  NEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDT 900

Query: 2701 SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 2880
            SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP
Sbjct: 901  SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 960

Query: 2881 RLE 2889
            RLE
Sbjct: 961  RLE 963

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  857 bits (2213), Expect = 0.0
 Identities = 457/840 (54%), Positives = 582/840 (69%), Gaps = 24/840 (2%)
 Frame = +1

Query: 31   QPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKT 210
            + +EEELNITVAVRCRGRN+REI  KSSV+VTVPDI GS EV+INT++D+G TAQMNSKT
Sbjct: 46   EQEEEELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKT 105

Query: 211  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
            YTVDKVFGPSA Q LIFDE+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 106  YTVDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 165

Query: 391  LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGD---CNNDNGNFKK 561
            LS+SAGIIPRILFKLF+TLE   ED++VKCSF+ELYNE+LKDLL+ +    NN   N  K
Sbjct: 166  LSESAGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINK 225

Query: 562  LRIFDXXXXXXXXXXXXXXXXXXXXXTT-----------------FLKKKLRNEALLRSR 690
            LRIFD                                        +L++KL++       
Sbjct: 226  LRIFDSSTASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPE 285

Query: 691  NIASSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTI----QSDQ 858
            N      ++  +++N                S+ N +S  + +P     S++    Q D 
Sbjct: 286  NSNIFTSNASSSVKNMTKNSFLSNSKNQT--SNLNTNSNTRTNPPKLPTSSLETPPQDDN 343

Query: 859  TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGE 1038
              GIYIQNLQEFHI+ AKEG+ LLQKGLKYRQVASTKMNDFSSRSHTIFTITL+KE +G 
Sbjct: 344  NNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGT 403

Query: 1039 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRES 1218
            +FRLSKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVINSLAD+N H+PFRES
Sbjct: 404  LFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRES 463

Query: 1219 KLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDIL 1398
            KLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGS I KDIL
Sbjct: 464  KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDIL 523

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA 1578
            LKNITTEL+++KSDLLSTKSK+GIYM Q+HY++L  +L N+KTE  E KR IE L+SQNA
Sbjct: 524  LKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNA 583

Query: 1579 LLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTK 1758
            LLLKDKRT NE NELQRIK+    +S+  L  KIE Q   E  L   +     +     K
Sbjct: 584  LLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKK 643

Query: 1759 IIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEM 1938
            +I+  + ++  V SK + +L+  L  +   L       K      +F +  NL +I++E+
Sbjct: 644  MIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEV 703

Query: 1939 TNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSE 2118
              +L T ++  EK Y++ I  FL  TP  F +I +++ ++     N+++ +A+NLSD+SE
Sbjct: 704  IKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISE 763

Query: 2119 EYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKE 2298
            EYNN KQ++ +  +   + +  +L+N +IN+T   + +S++ + +T ++++N+HL +N+ 
Sbjct: 764  EYNNLKQYLNENLF---QNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820

Query: 2299 LIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKI 2478
            L++NS    T E+++ E++   P+  KWEES +LIN+ D+LNN F   V   ++    KI
Sbjct: 821  LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YEL061C
            (REAL)
          Length = 999

 Score =  852 bits (2201), Expect = 0.0
 Identities = 461/836 (55%), Positives = 586/836 (70%), Gaps = 18/836 (2%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+REI  KSSVVV VPDI GS+EV+INT+ D G TAQMN+K YTVD
Sbjct: 33   EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93   KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 564
            AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + NN + N       KKL
Sbjct: 153  AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 565  RIFDXXXXXXXXXXXXXXXXXXXXXTT--FLKKKLRNEALLRSRNIASSKRSSMQTIRNX 738
            RIFD                     ++   L       ALLR       KR   +++ N 
Sbjct: 213  RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLR-------KRLRTKSLPNT 265

Query: 739  XXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQ------SDQTAGIYIQNLQEFHI 900
                           SS N  S N   P + + +  Q      +DQ+ GIYIQNLQEFHI
Sbjct: 266  IKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHI 325

Query: 901  TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 1080
            T A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLVDLAG
Sbjct: 326  TNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAG 385

Query: 1081 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 1260
            SENINRSGALNQRAKEAGSINQSLLTLGRVIN+LADK+ H+PFRESKLTRLLQDSLGGNT
Sbjct: 386  SENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNT 445

Query: 1261 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            KTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+KNIT EL KIKSD
Sbjct: 446  KTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSD 505

Query: 1441 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 1620
            LLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IESL+S+N+LLLKDK    +  +
Sbjct: 506  LLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQ 565

Query: 1621 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI----IDEMKNREA 1788
             Q  +++++  ++ +L A++++Q   E E+ G    F     KLT+I    + + K RE 
Sbjct: 566  SQNSQMESLKLTINQLKAQLDKQHKTELEISG----FNNKLQKLTEIMQLALQDYKRREL 621

Query: 1789 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
             +N KF+T +   +  +   L  Q+   +   I+Q   +  NL +IK+E+  L+ T ++ 
Sbjct: 622  DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEK 681

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
             E  Y++C+ K L+++P  F+ I + +  ++     +Y+ IAENLSD+SEE NN KQ++ 
Sbjct: 682  AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 741

Query: 2149 DEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVT 2328
            + F+   K +  ELLN +I++T   IE  +++ +   +N LN+HL  NK+LI+ +L+N T
Sbjct: 742  NHFF---KNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 798

Query: 2329 TELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
            + +++ E+D  +PK  KWE S +LIN+ D++NNEF +N    M T   +IK T D+
Sbjct: 799  SAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNN----MATTLSQIKNTVDT 850

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
            YEL061C (REAL)
          Length = 998

 Score =  848 bits (2190), Expect = 0.0
 Identities = 446/832 (53%), Positives = 582/832 (69%), Gaps = 14/832 (1%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKEV+INT+ D G TAQMN+K YTVD
Sbjct: 35   EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGP A+Q LIF+E+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 95   KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 564
            AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N  + N       KKL
Sbjct: 155  AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 565  RIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXX 744
            RIFD                      +  +   RN +     ++        + +R    
Sbjct: 215  RIFDSSTANNTTSNS----------ASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSL 264

Query: 745  XXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTI--------QSDQTAGIYIQNLQEFHI 900
                         +S NN S+N  S A+N  S          Q+DQ+ GIYIQNLQEFHI
Sbjct: 265  PNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMTQNDQSNGIYIQNLQEFHI 324

Query: 901  TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 1080
            T A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLVDLAG
Sbjct: 325  TNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAG 384

Query: 1081 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 1260
            SENINRSGALNQRAKEAGSINQSLLTLGRVIN+L D++ H+PFRESKLTRLLQDSLGGNT
Sbjct: 385  SENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNT 444

Query: 1261 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            KTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+F+MKDIL+KNIT EL KIKSD
Sbjct: 445  KTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSD 504

Query: 1441 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 1620
            LLSTKSK+GIYM Q HYK L +DL+++K E+QECKR IESL S+N+LL+KDK    E  +
Sbjct: 505  LLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQ 564

Query: 1621 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 1800
             Q  +++++  ++  L A++++Q   E E+ G      K    +   + + K RE  +N 
Sbjct: 565  SQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNK 624

Query: 1801 KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 1980
            KF+T +   +  +   L  Q++N + + I Q   +  NL ++K+E+  L+ T ++  E  
Sbjct: 625  KFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELM 684

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
            Y++C+ K L+++P  F+ I + +  ++    N+Y  IAENLSD+SEE NN KQ++ + F+
Sbjct: 685  YKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFF 744

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 2340
               K +  ELLN +I++T   IE  +N  +   +  LN+HL  NK+LI+ +++N T+ ++
Sbjct: 745  ---KNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVI 801

Query: 2341 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
              E+D  +P+ +KWE S +LIN+ D++NNEF +N+ ++++    +IK+T D+
Sbjct: 802  DQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS----QIKKTVDT 849

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score =  845 bits (2184), Expect = 0.0
 Identities = 449/826 (54%), Positives = 577/826 (69%), Gaps = 8/826 (0%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 33   EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93   KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 564
            AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N       +G F KKL
Sbjct: 153  AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 565  RIFDXXXXXXXXXXXXXXXXXXXXXTT--FLKKKLRNEALLRSRNIASSKRSSMQTIRNX 738
            RIFD                     ++   L       ALLR R    S  ++++     
Sbjct: 213  RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQ 272

Query: 739  XXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEG 918
                           S+ NN S+N  +      S   +DQT GIYIQNLQEFHIT A EG
Sbjct: 273  QQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPNDQTNGIYIQNLQEFHITNAMEG 332

Query: 919  IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 1098
            + LLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLVDLAGSENINR
Sbjct: 333  LNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 392

Query: 1099 SGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIA 1278
            SGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 393  SGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIA 452

Query: 1279 TISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKS 1458
            TISPAKVT EETCSTLEYASKAKNIKNKPQLGSFIMKDIL+KNIT EL KIKSDLLSTKS
Sbjct: 453  TISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKS 512

Query: 1459 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
            K+GIYM Q HYK L +DL++YK E+QECKR IESLTS+NALL+KDK    E  + Q  +I
Sbjct: 513  KEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQI 572

Query: 1639 QTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 1818
            +++  ++  L A++++Q   E E+        K    +   + + K RE  +N KF+  +
Sbjct: 573  ESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHI 632

Query: 1819 DHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 1998
               +  +   L  Q+   + + I Q   +  NL +IK+E+  L+ T ++  E  Y++C+ 
Sbjct: 633  TKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVK 692

Query: 1999 KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 2178
            K L+++P  F+ + + +  ++     +Y  IAENLSD+SEE NN KQ++ + F+   K +
Sbjct: 693  KILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFF---KNN 749

Query: 2179 QHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDR 2358
              ELLN+++++T   IE  +N+ +   + +LN+HL  NK+LI+ +L+  T+ ++  E+D 
Sbjct: 750  HQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDL 809

Query: 2359 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
             +PK  KWE S +LIN  D++NNEF +++ ++++ +   +  +++S
Sbjct: 810  FEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNS 855

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score =  843 bits (2179), Expect = 0.0
 Identities = 451/836 (53%), Positives = 576/836 (68%), Gaps = 18/836 (2%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 33   EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 93   KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 564
            AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N+ + N       KKL
Sbjct: 153  AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 565  RIFDXXXXXXXXXXXXXXXXXXXXXTT------------FLKKKLRNEALLRSRNIASSK 708
            RIFD                     ++             L+++LR ++L  +      +
Sbjct: 213  RIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAALLRRRLRTKSLPNTIK-QQQQ 271

Query: 709  RSSMQTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQ 888
                QT+ +              + S  NN++  + S A ND+S        GIYIQNLQ
Sbjct: 272  HQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPNDQSN-------GIYIQNLQ 324

Query: 889  EFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLV 1068
            EFHIT A EG+KLLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLV
Sbjct: 325  EFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLV 384

Query: 1069 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSL 1248
            DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFRESKLTRLLQDSL
Sbjct: 385  DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSL 444

Query: 1249 GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTK 1428
            GGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+KNIT EL K
Sbjct: 445  GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAK 504

Query: 1429 IKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTIN 1608
            IKSDLLSTKSK+GIYM+Q HYK L +DL++YK E+QECKR IESLTS+N+LL+K+K    
Sbjct: 505  IKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKEKLKSK 564

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 1788
            E  + Q  +I+++  ++  L  ++++Q   E E+ G      K    +   + + K RE 
Sbjct: 565  ETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMALQDYKRREL 624

Query: 1789 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
             +N KF+T +   +  +   L  Q+   + + I Q   +  NL +IK+E+  L+ T ++ 
Sbjct: 625  DLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLTLMETMQEK 684

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
             E  Y++C+ K L+++P  F+ I + +  +      +Y  IAENLSD+SEE NN KQ+ T
Sbjct: 685  AELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQYFT 744

Query: 2149 DEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVT 2328
            + F+   + +  ELL+ ++++T   IE  +N  +   +  LN+HL  NK+LI+ +L+  T
Sbjct: 745  NHFF---RNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMKNLTTTT 801

Query: 2329 TELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
            + ++  E+   +PK  KWE S +LIN  D++NNEF     +SM T   +IK T D+
Sbjct: 802  SAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEF----YNSMATTLSQIKSTVDT 853

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  840 bits (2170), Expect = 0.0
 Identities = 459/844 (54%), Positives = 591/844 (70%), Gaps = 20/844 (2%)
 Frame = +1

Query: 10   PTVSSDKQPQEE-ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGF 186
            P  ++ + P+E+ ELNITVAVRCRGRN+REI++KS VVVTVPDI G++E++INT+ + G 
Sbjct: 15   PLTTTREPPEEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGI 74

Query: 187  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 366
            TAQMNSKTYTVDKVFGP+A Q LIF E+AEPLF DF+KGYNCT+LVYGMTSTGKTYTMTG
Sbjct: 75   TAQMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTG 134

Query: 367  DEKLYNEE--LSDSAGIIPRILFKLFETLEKLNE--------DHIVKCSFVELYNEELKD 516
            DEKLY     LSD+AGIIPRILFKLF+TL+            D +VKCSFVELYNE+LKD
Sbjct: 135  DEKLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKD 194

Query: 517  LLHGDCNNDNGN-----FKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALL 681
            LL+ D N++         +KLRIFD                     T        + A  
Sbjct: 195  LLNYDSNDEQQQQQQLGSRKLRIFDS--------------------TNNNNNNSNSNASS 234

Query: 682  RSRNIASSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNN-DSANKFSPADNDKSTI---Q 849
            R+ +  +S R+S                     ++S N   S+N   P  ND+ +     
Sbjct: 235  RASSRNNSPRTSSILPNANATNLAMRKKSIRYNYNSNNKAKSSNNTRPNTNDEPSSIAGP 294

Query: 850  SDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEV 1029
             + T GIYIQNLQEFHIT AKEG+ LLQKGLK+RQVASTKMNDFSSRSHTIFTITL+KE 
Sbjct: 295  DENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEH 354

Query: 1030 KGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPF 1209
            K  +FRLSKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVINSLADK+ HVPF
Sbjct: 355  KDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPF 414

Query: 1210 RESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMK 1389
            RESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGS I+K
Sbjct: 415  RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILK 474

Query: 1390 DILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTS 1569
            DILLKNIT+EL K+KSDL+STKSKDGIYM  +HY+EL  +L++ KTE+QE KR IE L+S
Sbjct: 475  DILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS 534

Query: 1570 QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK 1749
            QN++LLKDKR+ NE NELQRIK+  + +SM  L  K+E Q   E +L  +I    K+  K
Sbjct: 535  QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK 594

Query: 1750 LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK 1929
            L  ++   + +++ + ++   +L+ +L  + K LN   +  +      NF V+ NL++IK
Sbjct: 595  LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIK 652

Query: 1930 SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD 2109
             E+T++L   +   E  Y+E I +FL  TP+   +I ++V  ++ + + YY++I ENLSD
Sbjct: 653  DEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSD 712

Query: 2110 LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA 2289
            +SEEYNN KQ++ ++F+   + +  +LLN +IN T  ++  SS ++ +  + +++ HL  
Sbjct: 713  ISEEYNNLKQYLDNDFF---QNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLME 769

Query: 2290 NKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMT 2469
            NK+L+I++    T ++++ E++  KPK +KWEES ELINR D++NN F+ N    MT   
Sbjct: 770  NKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHN----MTGQV 825

Query: 2470 DKIK 2481
             KIK
Sbjct: 826  SKIK 829

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
            Anc_6.16 YEL061C
          Length = 958

 Score =  837 bits (2163), Expect = 0.0
 Identities = 448/805 (55%), Positives = 567/805 (70%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+REI AKSSVVV+VPD+ GS EV+INT+ D+G TAQ+NSKTYTVD
Sbjct: 13   EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            +VFGPSA QSL+F +IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELS+S
Sbjct: 73   EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPRILFKLFETLE   ED++VKCSFVELYNEELKDLL GD + +  + +KLRIFD  
Sbjct: 133  AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLL-GD-SQEIASSRKLRIFDS- 189

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXX 762
                                                N  S+  +SM T  +         
Sbjct: 190  ------------------------------------NTMSAATNSMSTGNSTKNSRNNSP 213

Query: 763  XXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGL 942
                 + ++       K +P+         DQ AGIYIQNLQ+FHIT AKEGIKLLQKGL
Sbjct: 214  RSSSELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGL 273

Query: 943  KYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRA 1122
            K+RQVA+TKMNDFSSRSHTIFTITL+KE  GEIFR+SKMNLVDLAGSENI+RSGA +QRA
Sbjct: 274  KHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRA 333

Query: 1123 KEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1302
            KEAGSINQSLLTLGRVINSL DK++HVPFRESKLTRLLQDSLGGNTKTALIATISPAK+ 
Sbjct: 334  KEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 393

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
             EETCSTL+YA+KAKNIKNKPQLGS IMKDIL+KNIT EL KIK+DLLSTKSK+GIYM Q
Sbjct: 394  SEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQ 453

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
             +YKELT DL++YKTE++ECKR IE+LTSQN LLLKDK+  NE N+LQRIK+Q M ++M 
Sbjct: 454  DNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMS 513

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
             LY+K E+Q   E  L         T   +  II E + RE  + SK   L ++  + V 
Sbjct: 514  DLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVK 573

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            + +   I + + Q   +N  V  N+  I+ E++ LL  A+   +  Y++C+ K L +TP 
Sbjct: 574  QTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPG 633

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
             F    + V  ++ L +  +  + ENLSD+SEE+NN +Q++ D F+   K +  E+L  +
Sbjct: 634  HFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFF---KNNHEEILVSH 690

Query: 2203 INNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKW 2382
            I+ T   I++S++D+    + +++ HL  NK+L++ SL   T +++  E+   +P+  KW
Sbjct: 691  IDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKW 750

Query: 2383 EESAELINRSDALNNEFNDNVESSM 2457
            E+S + IN+ D++N  F + V+S +
Sbjct: 751  EDSFKYINKCDSINFAFQNGVKSPL 775

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
            some similarities with uniprot|P27895 Saccharomyces
            cerevisiae YEL061C CIN8 Kinesin motor protein involved in
            mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  828 bits (2139), Expect = 0.0
 Identities = 439/824 (53%), Positives = 572/824 (69%), Gaps = 7/824 (0%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVR RGRN+REI AKSSVVV+VPD+MGS EVAINT++D+G TAQMNSKTY VD
Sbjct: 13   EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGPSA Q LIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYN+ELSDS
Sbjct: 73   KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPRILFKLFETL+  +ED++VKCSFVELYNEELKDLL  D + +N + +KLRI+D  
Sbjct: 133  AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--DDSVENSSMRKLRIYDSG 190

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXX 762
                                     KL  + ++  R + +   SS  ++           
Sbjct: 191  SGSNSNSGSRKNSRNN-------SPKLVTDPMINRRRMRTVPLSS--SLAKQQHQWQQRR 241

Query: 763  XXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGL 942
                 +      +   +    +  +   Q D  +G+YIQNLQ+FHIT+A++G++LLQKGL
Sbjct: 242  EQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGL 301

Query: 943  KYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRA 1122
            + RQVA+TKMNDFSSRSHTIFTITL++E +GE+F++SKMNLVDLAGSENI+RSGA +QRA
Sbjct: 302  RNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRA 361

Query: 1123 KEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1302
            KEAGSINQSLLTLGRVINSLADK+ HVPFRESKLTRLLQDSLGGNTKTALIATISPAK+ 
Sbjct: 362  KEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 421

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
             EETCSTL+YASKAKNIKN+PQL SFIMKDIL+KNIT EL K+KSDLLSTK ++G+YM Q
Sbjct: 422  SEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQ 481

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
             +YKE+T DL++YKTEIQE KR IE L+SQN+LLLKDK+  NE NELQRIK+Q M + M 
Sbjct: 482  DNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMS 541

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
             L  K+E Q   E EL         T S    +I E   RE  ++ + + +L        
Sbjct: 542  GLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFR 601

Query: 1843 KKLNYQIENFKDQGINQNFT-------VDENLQLIKSEMTNLLSTARDNFEKFYQECITK 2001
            + L   IE+ +      +         + +NL +++ E+  LL  A+   EK Y++ I K
Sbjct: 602  QMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEK 661

Query: 2002 FLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQ 2181
             L + P +F  I++ V  ++   + Y+ ++ ENLSD+SE YNN KQ+  D F+   K + 
Sbjct: 662  ILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFF---KNNH 718

Query: 2182 HELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRL 2361
             E+LN +I+ T   ++ S++ ++   + ++++HL+ NK L++ SL + TTE +  E+   
Sbjct: 719  EEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLF 778

Query: 2362 KPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            +P+  KWEES +LIN  D+++N FN ++ S+++ +      + D
Sbjct: 779  EPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTD 822

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score =  825 bits (2131), Expect = 0.0
 Identities = 433/835 (51%), Positives = 578/835 (69%), Gaps = 18/835 (2%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            +ELNI VAVRCRGRN+REI AKSSVVV+VPD+ GS E+AINT+ED+G   QMNSKTYTVD
Sbjct: 11   DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGPSA Q LIF+E+AEPLF+DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LYN ELSDS
Sbjct: 71   KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPR+LFKLF+ +E  N+D+I+KCSF+ELYNEELKDLL  +C   N   KKLRIFD  
Sbjct: 131  AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLD-ECQAINSTAKKLRIFDSN 189

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNE-----ALLRSRNIASSKRSSMQTI--RNXX 741
                                T       N         RS + ++S +S  Q I   N  
Sbjct: 190  ASQIRKVSEYNKTNTSTNTGTNNNNNNNNNNNNNNTNGRSTSPSNSSKSRPQPILGNNRI 249

Query: 742  XXXXXXXXXXXXMFSSGNNDSANKFSPADNDKS-----------TIQSDQTAGIYIQNLQ 888
                          SS N +++N    + +  S           T+  D+  GIYIQNL+
Sbjct: 250  RSRLSSSNNAFLKPSSSNLNTSNDTIASSSSSSSSSTSSAYTSSTVSPDKQTGIYIQNLK 309

Query: 889  EFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLV 1068
            EFHIT+AKEGI+LLQ+GL+YRQVASTKMNDFSSRSHTIFTI L+KE  G+IFR+SKMNLV
Sbjct: 310  EFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKIFRISKMNLV 369

Query: 1069 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSL 1248
            DLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN+H+PFRESKLTRLLQDSL
Sbjct: 370  DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESKLTRLLQDSL 429

Query: 1249 GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTK 1428
            GGNTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQLGS I KDIL+KNI +EL K
Sbjct: 430  GGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILVKNIASELAK 489

Query: 1429 IKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTIN 1608
            +K+DLLSTKS+DG+YM Q HYKELT DL++YKTE+QECKR I+ LT+QN LLLKDK+  N
Sbjct: 490  VKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGLLLKDKKASN 549

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 1788
            E + LQ+IK+Q+M +S+  L+  IE+Q   E  L   I      + ++   I     RE 
Sbjct: 550  EVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQATIKYHSEREQ 609

Query: 1789 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
            +  +K K + +  L  +   L   +E    + +  N  +  N++ IK E+ +++ T +  
Sbjct: 610  VTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVKSIIDTTQAE 669

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
                Y++C+ + + ++P+L   +ND+++ ++ ++  Y  Q++ ++S+L+ E+N+ KQ++ 
Sbjct: 670  ANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIEHNDLKQYLN 729

Query: 2149 DEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVT 2328
              F+   K    E+LN++I  T   I  +S  ++  ++  L  +L  ++ +II+SL N T
Sbjct: 730  GSFF---KSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIIDSLKNTT 786

Query: 2329 TELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            ++++ +E++   PK  KWE+S E+IN+ D+LNN++  ++ + ++ M   +  T+D
Sbjct: 787  SDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTSTSD 841

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 948

 Score =  813 bits (2100), Expect = 0.0
 Identities = 427/813 (52%), Positives = 562/813 (69%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            +ELNITV+VRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G TAQMNSKTYTVD
Sbjct: 15   QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGPSA QSLIF +IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELSD+
Sbjct: 75   KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPRILFKLF+TLE  +ED++VKCSF+ELYNEELKDLL+     ++G  KKLRIFD  
Sbjct: 135  AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEP--QESGVIKKLRIFD-- 190

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXX 762
                               +       RN +   S N+  +  +  +  +          
Sbjct: 191  -------------------SNTTSSNSRNNSRNNSPNLVGTSGTFKRIFKTPVPYKQQQQ 231

Query: 763  XXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGL 942
                            +     N+K    S+Q++ IYIQNLQEFHIT AK+GI LLQ+GL
Sbjct: 232  HQQHLQ------QQQQQQPRLINNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGL 285

Query: 943  KYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRA 1122
            K+RQVASTKMNDFSSRSHTIFTI L+K   GE+FR+SKMNLVDLAGSENI+RSGA NQRA
Sbjct: 286  KHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRA 345

Query: 1123 KEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1302
            KEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+ 
Sbjct: 346  KEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN 405

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
             EET STLEYA+KAKNIKNKPQLG+ +MKDIL+KNIT EL KIKSD LSTKSKDGIYM Q
Sbjct: 406  AEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQ 465

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
             HYKELT+DL+NYKTE+QECKR IE + SQN LLLKDKR  +E +ELQRIKI+ +N+ + 
Sbjct: 466  DHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIA 525

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
             LY K+++Q   E +L   I         +   +   ++ +    S+ + +L   ++   
Sbjct: 526  HLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFK 585

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            + ++ Q+   K    +++  +D N+ +I+ E++ +L +         + C+ K L   P 
Sbjct: 586  QSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPK 645

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
             F+ I  ++L++  +  +Y +++ +NL D+SEEYNNF++++ +  +   K +  E L+ +
Sbjct: 646  HFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLF---KNNHEETLSIH 702

Query: 2203 INNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKW 2382
            ++ T  +++ S+ ++ S  + +++ HL  NK L+I SL   + E+++ E+    P   KW
Sbjct: 703  VDKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKW 762

Query: 2383 EESAELINRSDALNNEFNDNVESSMTTMTDKIK 2481
            E S E IN+ D+LNN F+  V+ ++  +   I+
Sbjct: 763  ESSLENINKCDSLNNTFDSTVKDALRRLEGNIE 795

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
            Kinesin-like protein
          Length = 988

 Score =  807 bits (2085), Expect = 0.0
 Identities = 421/822 (51%), Positives = 570/822 (69%), Gaps = 4/822 (0%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNI VAVRCRGRN+REI AKSSVVV VPD   + EV+INT++D+G  A+MNSKTYTVD
Sbjct: 30   EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGPSA+Q L+++EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 90   KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPR+LF+LF+TLE   +D++VKCSFVELYNEELKDLL       N + KKLRIFD  
Sbjct: 150  AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSN 209

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXX 762
                                       R + L R     ++  +S  +  N         
Sbjct: 210  VNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRFKQ 269

Query: 763  XXXXXMFSSGNNDSANKFSPADNDKSTIQS----DQTAGIYIQNLQEFHITTAKEGIKLL 930
                   +  +N+  N   P +N  +T Q     DQ+A IYIQNL+EFHIT+A EG++LL
Sbjct: 270  TSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGLQLL 329

Query: 931  QKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGAL 1110
            QKGLK RQVASTKMNDFSSRSH+IFTITL+KE  GE+FR+SKMNLVDLAGSENI+RSGA+
Sbjct: 330  QKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSGAM 389

Query: 1111 NQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISP 1290
            NQRAKEAGSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 390  NQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATISP 449

Query: 1291 AKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGI 1470
            AK+T EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+++IT+EL KIKSDLLSTKSK+G+
Sbjct: 450  AKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSKEGV 509

Query: 1471 YMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN 1650
            YM  +HYK+L  D++ YKTE++E KR IESLT+QNA+L +++ ++ ++N   +  I ++ 
Sbjct: 510  YMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIASLK 569

Query: 1651 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
            +++  L + ++ Q + E  +   ++     N ++ K I   + ++  +     T +   +
Sbjct: 570  DNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISDEI 629

Query: 1831 SYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLS 2010
            S +   L   IE  ++ G  ++  +  NL  ++ E+  ++  A +   K Y EC+   L 
Sbjct: 630  SNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLK 689

Query: 2011 DTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHEL 2190
            +TP LF+ ++  + N+  L    +S+IAE LSD+SEEYNN KQ++T+ F+   K +  EL
Sbjct: 690  ETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFF---KNNHEEL 746

Query: 2191 LNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPK 2370
            L+ ++ NT   +E +S  +M     +L++H++ NK  ++ ++  VT E+++NEL     +
Sbjct: 747  LSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQ 806

Query: 2371 LSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
             +KWE+S+ LIN+ D++N+ F+  + S++  + D +  + D+
Sbjct: 807  RAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDN 848

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
            YEL061C
          Length = 939

 Score =  782 bits (2020), Expect = 0.0
 Identities = 414/833 (49%), Positives = 566/833 (67%), Gaps = 7/833 (0%)
 Frame = +1

Query: 16   VSSDKQPQEE---ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI-- 180
            +S+D Q  E+   E+NI VAVRCRGRN+REI +KSSV+V+VPD+MGS E++INTS+DI  
Sbjct: 1    MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 181  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
            G TAQ+NSKTYTVDKVFGPSA Q LIF+EIAEPLF+DF++GYNCT+LVYGMTSTGKTYTM
Sbjct: 61   GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 361  TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 540
            TGDEKLY  +LSDSAGIIPR+LFKLFET+E  ++++++KCSF+ELYNEELKDLL    ++
Sbjct: 121  TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---IDS 177

Query: 541  DNGNFKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSM 720
            +N   KKLRIFD                        L K   N  + R  +         
Sbjct: 178  NNTKLKKLRIFDSN----------------------LSKSSNNNNISRQNS--------- 206

Query: 721  QTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADN--DKSTIQSDQTAGIYIQNLQEF 894
                                F SG +   N  +P +N  D + IQ+   A IYIQNL+EF
Sbjct: 207  -------------------HFISGMDLRKNPINPINNSNDNTAIQNGN-ASIYIQNLEEF 246

Query: 895  HITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDL 1074
            HI  A+EGI+LLQKGLKYRQVASTKMND SSRSHTIFTI L+KE KGEIF++SKMNLVDL
Sbjct: 247  HIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNLVDL 306

Query: 1075 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGG 1254
            AGSENI+RSGA NQRAKEAGSINQSLLTLGRVINS+ADKN+H+PFRESKLTRLLQDSLGG
Sbjct: 307  AGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQDSLGG 366

Query: 1255 NTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIK 1434
            NTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQLGS IMKD+ LK++  EL KIK
Sbjct: 367  NTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELAKIK 426

Query: 1435 SDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINEN 1614
             DL STK KDG+YM Q HYK+LT DL++YKTEIQEC R ++SL  QNALLLKDK+  NE 
Sbjct: 427  RDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKKASNEV 486

Query: 1615 NELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALV 1794
            N+LQ + +  M  ++  +   +E Q   E  L  ++    + + K+  +I E   +E  +
Sbjct: 487  NKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYSEKEERI 546

Query: 1795 NSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFE 1974
             S  K++ +  L  + + L   +     + +     V +N++LIK ++ ++++ +++  +
Sbjct: 547  QSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVISIVTESQELSK 606

Query: 1975 KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDE 2154
            K + E   + + +TPL+ +  + +V   + L   Y++ + ENL  + ++Y+   ++ +++
Sbjct: 607  KLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQYSKLNEYFSND 666

Query: 2155 FYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTE 2334
            F+   K +   ++N ++N T+ +IE S +D+    Q  +      N++LI+ +L  V+++
Sbjct: 667  FF---KSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENLKTVSSD 723

Query: 2335 LMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            L+ NE++  K   S+W+ S + IN  D LNN ++D + + +  M  K++ +++
Sbjct: 724  LIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDE 776

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
            uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
            protein CIN8 and some similarites with YEL061C
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 965

 Score =  776 bits (2004), Expect = 0.0
 Identities = 438/989 (44%), Positives = 601/989 (60%), Gaps = 47/989 (4%)
 Frame = +1

Query: 19   SSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQM 198
            +++  P+ +ELNITVAVRCRGRN++EI AKSSVVV  PD++G+ EV+INTS DIG TA+M
Sbjct: 3    ATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARM 62

Query: 199  NSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 378
            NSKTYTVDKVFGPSA QSL+F EIA+P+F DFIKGYNCTMLVYGMTSTGKTYTMTGDEKL
Sbjct: 63   NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122

Query: 379  YNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFK 558
            Y+ ELS++AGIIPR+LFKLF+TLE    D++VKCSF+ELYNEELKDLL    ++   N +
Sbjct: 123  YDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSR 182

Query: 559  KLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTI--- 729
            KLRI+D                            L +   + + N  SS RS+  T+   
Sbjct: 183  KLRIYD---------------------------SLNSSNNVTNVNSRSSSRSNSPTVNLE 215

Query: 730  --RNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQS-----DQTAGIYIQNLQ 888
              R                 S  N     +       +   Q+     +Q++ IYIQ+LQ
Sbjct: 216  AKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQ 275

Query: 889  EFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLV 1068
            EFHIT AKEG++LLQKGL +RQVASTKMND SSRSHTIFT+TL+K   GE FR+SK+NLV
Sbjct: 276  EFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFRVSKINLV 335

Query: 1069 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSL 1248
            DLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSL
Sbjct: 336  DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSL 395

Query: 1249 GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTK 1428
            GGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQLGSF+MKDIL+KNI+ EL K
Sbjct: 396  GGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKNISHELAK 455

Query: 1429 IKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTIN 1608
            +KSD LSTKSK+GIYM   HY E+  D++NYKTEIQE +R IE L+SQN LL KDK++  
Sbjct: 456  LKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLHKDKKSSQ 515

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 1788
            +  E QR++I+ +  SM  LY KI+ +   E EL   I         +   +   ++ E 
Sbjct: 516  DTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQ 575

Query: 1789 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
             + S  + +L  ++    +K+  +++N K Q + Q+FT+D+++  +K  +  LL T + +
Sbjct: 576  RLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLETLLETVKKD 635

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
                 +    K + D P  F+ +   + ++ +    +  ++ E LS ++ E NN K ++ 
Sbjct: 636  AIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAENNNLKAYLD 695

Query: 2149 DEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVT 2328
              F+   + +  E+LN + + T   +  SS  +MS I N++++H+  N+ L++++L   T
Sbjct: 696  THFF---RNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMDTLKTAT 752

Query: 2329 TELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXX 2508
            TE+++ E+   +P    WE+S   IN  D+L+N+F D+   S+ ++   ++ T       
Sbjct: 753  TEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHMESTVRESSLI 812

Query: 2509 XXXXXE---HFK-TNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFV---KEGYLVTN 2667
                 +   HF+  NDIA+                        +   F+    EG+   +
Sbjct: 813  ADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAID 872

Query: 2668 ESMKK------------------LNELDTS------------IRTVLKDIDYEKDIKETN 2757
             S+K+                  +  +D+S            +R +LK    ++ + ++ 
Sbjct: 873  SSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLRPLLKSETKQRSLSKSV 932

Query: 2758 SPLKPSHKHDYNHTIPLDNDKKRSFLNNA 2844
            SP K SH    N  +   +   R F  N+
Sbjct: 933  SPAKSSHATIINSPLKRKSSDSRIFPGNS 961

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
            similar to uniprot|P27895 Saccharomyces cerevisiae
            YEL061C CIN8 Kinesin motor protein involved in mitotic
            spindle assembly and chromosome segregation
          Length = 941

 Score =  767 bits (1980), Expect = 0.0
 Identities = 411/816 (50%), Positives = 545/816 (66%)
 Frame = +1

Query: 37   QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 216
            +EEELNITVAVRCRGRN++E+ AKSSVVV VPD+ G+ EV+INT+ D G TAQ+NSKTYT
Sbjct: 3    EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 217  VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 396
            VD+VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 63   VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 397  DSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 576
            + AGIIPR+LFKLF+ L+  N+D+++KCSF+ELYNEELKDLL  D   D+   +KLRIFD
Sbjct: 123  EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL--DETPDSSMPRKLRIFD 180

Query: 577  XXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXX 756
                                            ++    +  SS R+S             
Sbjct: 181  --------------------------------SVTNPNSSRSSSRNSSPKPPEGSTSGTK 208

Query: 757  XXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQK 936
                   M+    + +          K T+ S+  + I+IQNLQEFHI  AKEGI+LLQ+
Sbjct: 209  RRIRPNTMYKPSRSPTV---------KPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQR 259

Query: 937  GLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 1116
            GL++RQVASTKMND SSRSHTIFTI L+++  GE FR+SKMNLVDLAGSENI+RSGA NQ
Sbjct: 260  GLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQ 319

Query: 1117 RAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 1296
            RAKEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSLGGNTKTALIATISPAK
Sbjct: 320  RAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 379

Query: 1297 VTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYM 1476
            +  EET STLEYA+KAKNIKNKPQ+GSFIMKD+L+KN+T EL KI+SDLL+TKSKDGIYM
Sbjct: 380  INSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYM 439

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 1656
             Q++YKELT +L+NYKTE+QECKR IE L++QN LL K+KR  NE NE QR+KI+ ++ +
Sbjct: 440  SQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNN 499

Query: 1657 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 1836
            +  LY KI+RQ   E EL   +Q   +    +   +   +++     ++ + +L  ++  
Sbjct: 500  IDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGS 559

Query: 1837 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDT 2016
                L  +IE  K       F VD N+  +  E+  +      +  +  ++ + K    T
Sbjct: 560  FKHSLLNEIEKLKGTE-EDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQT 618

Query: 2017 PLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 2196
            P    +I + V ++  +  +Y S +  +LS +SEEYN+ K ++ + F+   K +  + L+
Sbjct: 619  PTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFF---KNNFQDALD 675

Query: 2197 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 2376
             +++ T   ++ S+N +   ++ ++NE L  NKE+++ SL N  +E+++ E+  L P   
Sbjct: 676  VHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQ 735

Query: 2377 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
             WE S E IN  D LN+ F  ++ S +  + +KI +
Sbjct: 736  AWESSLENINECDKLNSGFEKDIGSVVRDVFEKINE 771

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_6.16
            YEL061C
          Length = 1097

 Score =  771 bits (1990), Expect = 0.0
 Identities = 427/891 (47%), Positives = 571/891 (64%), Gaps = 74/891 (8%)
 Frame = +1

Query: 43   EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
            EELNITVAVRCRGRN+RE+ AKSSVVV+VPDIMGS EV+INTS+++G  A MNSKTYTVD
Sbjct: 9    EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 223  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            KVFGPSA+Q L+F EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 69   KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 403  AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXX 582
            AGIIPR+LFKLFE+ E LN+D+I+KCSFVELYNE+LKDLL    +N    +KKLRIFD  
Sbjct: 129  AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN---TYKKLRIFD-- 183

Query: 583  XXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXX 762
                               +   +   RN +   SRN + +      +  N         
Sbjct: 184  ---SMSSYSNSTATSNNNTSNNTRNNSRNNSRSNSRNTSRNNSPRPSSSTNLSTIALKRR 240

Query: 763  XXXXXMFSSGNNDSANKFSPADNDKSTIQ-SDQTAG------------------IYIQNL 885
                    S  N +AN    ++N  + I+  DQ A                   I+ QN+
Sbjct: 241  TATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPANQLRLQSKLQAQQNIELQQIHSQNI 300

Query: 886  QE---------------------------------------FHITTAKEGIKLLQKGLKY 948
            Q+                                       F+I  A +GIKLLQKGL++
Sbjct: 301  QQQQSQSITSNLQSQENKEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRH 360

Query: 949  RQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKE 1128
            R+VASTKMND SSRSHTIFTITL+KE  G ++R+SKMNLVDLAGSENIN+SGA +QRAKE
Sbjct: 361  RKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKE 420

Query: 1129 AGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 1308
            AGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKT LI+TISPAK+ ++
Sbjct: 421  AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD 480

Query: 1309 ETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH 1488
            ET STLEYASKAKNIKNKP LGSFIMKD+LLKNITTEL KIKSDL+ST+ KDG+YM QQH
Sbjct: 481  ETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQH 540

Query: 1489 YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKL 1668
            YKEL  DL++YKTE+QE KR  E L SQN  LLKDK+  NE NELQRI+I+  NE +K+L
Sbjct: 541  YKELNNDLESYKTEVQESKRANERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKEL 600

Query: 1669 YAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKK 1848
            Y  ++     E+ L   I+      + +   I+  + R+  +    K +L++   ++  +
Sbjct: 601  YEILDEHYKREDILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNE 660

Query: 1849 LNY--------QIENFKDQGINQNFTVD--------ENLQLIKSEMTNLLSTARDNFEKF 1980
            L+          I+N K   I+ N +++        +N+ +I++    +L   ++  +  
Sbjct: 661  LSQILSNINGNIIDNLKSSIISNNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHI 720

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
            Y  CI + LSD P + ++    + ++    ++ +++I ENLSDLSEEYNNFK+++ + F 
Sbjct: 721  YSSCIERILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL 780

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 2340
               + +   +L  ++ + Q+ IES SN+++  I   +NE    N +L    L+N+  +++
Sbjct: 781  ---QNNYELILKNHLESGQSQIESFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIV 837

Query: 2341 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
              E + +KP   KW +S E+IN +D +NN F++++ + +  + + I Q+++
Sbjct: 838  KKETESIKPYKEKWVKSIEIINSTDKINNTFHNDMNNRILQINNLILQSHN 888

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
            (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  763 bits (1969), Expect = 0.0
 Identities = 412/815 (50%), Positives = 551/815 (67%)
 Frame = +1

Query: 40   EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 219
            +EELNITVAVRCRGRN++E+ A+SSVVV VPD+ G+ EV+INT+ D G TAQ+NSKTYTV
Sbjct: 4    DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 220  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 399
            DKVFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS+
Sbjct: 64   DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 400  SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDX 579
             AGIIPR+LFKLF+ L    +D+++KCSF+ELYNEELKDLL  D   D+   KKLRIFD 
Sbjct: 124  GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL--DETPDSSMPKKLRIFD- 180

Query: 580  XXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXX 759
                                 +       + A  R+ +   ++ SS  T R         
Sbjct: 181  ---------------------SVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAP---- 215

Query: 760  XXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKG 939
                          S ++ + +   K     + ++ I+IQNLQEFHI  AKEGI+LLQ+G
Sbjct: 216  --------------SIHRPTKSPVSKPVSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRG 261

Query: 940  LKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQR 1119
            L++RQVASTKMND SSRSHTIFTI L+K+  GE FR+SKMNLVDLAGSENI+RSGA NQR
Sbjct: 262  LRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQNQR 321

Query: 1120 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
            AKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+
Sbjct: 322  AKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 381

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD 1479
              EET STLEYA+KAKNIKNKPQ+GSFIMKD+LLK++T EL KIKSDLLSTKSKDGIYM 
Sbjct: 382  NSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMS 441

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
            Q++YKELT +L+NYKTE++ECKR +E +++QN+LL+K+KR  NE NE Q++K++ +  ++
Sbjct: 442  QENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNI 501

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
            + LY KI+RQ   E EL   +Q   +    + + +   +++    +++ + +L  ++   
Sbjct: 502  EFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSF 561

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             K L  +IE  K         V+ N+  + +E+T +      +  + ++  I K    TP
Sbjct: 562  KKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTP 621

Query: 2020 LLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
              F +I   V ++ ++ S+Y S +  +LS +SEEYNN K ++ + F+   K +  E L+ 
Sbjct: 622  AYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFF---KNNFQEALDV 678

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSK 2379
            +++ T   ++ S+N +   ++ +LNE L  NKE ++ SL +  +E+++ E+  L P    
Sbjct: 679  HVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQA 738

Query: 2380 WEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
            WE S E IN  D LNN F + +  ++  +   I Q
Sbjct: 739  WENSLENINECDKLNNVFENKIGVTVNEIFKTIDQ 773

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL061C
            (CIN8)
          Length = 945

 Score =  758 bits (1958), Expect = 0.0
 Identities = 430/950 (45%), Positives = 588/950 (61%), Gaps = 3/950 (0%)
 Frame = +1

Query: 40   EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 219
            +EELNITVAVRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G  A+MNS+TYTV
Sbjct: 18   QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 220  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 399
            DKVFGPSA QSLIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ +LSD
Sbjct: 78   DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137

Query: 400  SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDX 579
            SAGIIPRI+FKLF+ LE  + D +VKCS++ELYNEELKDLL    +  + + K+LRIFD 
Sbjct: 138  SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL----DESHDSSKRLRIFD- 192

Query: 580  XXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXX 759
                                               S ++  S R+S Q+  N        
Sbjct: 193  -----------------------------------SSSMNHSSRASSQS--NSPREPEVA 215

Query: 760  XXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKG 939
                           AN+ S      S    +  +GIY+QN+QEFHI  A+EGI +LQKG
Sbjct: 216  HNGFSRRRQRPPPVKANRMSATKQQLS----ESGSGIYVQNVQEFHIINAREGINVLQKG 271

Query: 940  LKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQR 1119
            LK+RQVASTKMNDFSSRSHTIFTI L+K   GE+FR+SKMNLVDLAGSENI+RSGA NQR
Sbjct: 272  LKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQR 331

Query: 1120 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
            AKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+
Sbjct: 332  AKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 391

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD 1479
              +ET STLEYA+KAKNIKN+PQLG+ +MKDIL+KNI++EL KIKSD LSTKSKDGIYM 
Sbjct: 392  NADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMS 451

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
             +HY+E+  DL+N +TEIQE KR IESLTSQN LLLKDK+   E  ELQ  KI+ +  ++
Sbjct: 452  HEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTI 511

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
            + LY KIERQ   E EL   I    +    +   +   +  E  + +  K +L   ++  
Sbjct: 512  EYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSY 571

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             + +N  +E  K   +++N ++ EN+  I +   + L +   N      + + K + +TP
Sbjct: 572  RESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETP 630

Query: 2020 LLF-DEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 2196
             ++  E N+ V +LK+  S+Y + +   L+++SEE N+ ++++    +   K    E+L+
Sbjct: 631  SMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLF---KNSTQEVLD 687

Query: 2197 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 2376
              + +    +++ S+ ++S + +++  H+  ++ L++NS+ +   E++ NE    +P   
Sbjct: 688  LRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRD 747

Query: 2377 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFK-TNDIAH 2553
            +W  S + IN+ DA +  F    E+  T+  DK+K+ +D+            K   D  H
Sbjct: 748  RWIASCDNINQCDASHQNF----EAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFH 803

Query: 2554 XXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDY 2733
                                     L +   +      ES K   ++D SI+ ++ ++  
Sbjct: 804  DFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSP 863

Query: 2734 E-KDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 2880
            E  DIK   + ++  +   ++   P      R  L NA  ++  ++S  P
Sbjct: 864  EVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSP 913

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
            YEL061C
          Length = 950

 Score =  749 bits (1935), Expect = 0.0
 Identities = 417/982 (42%), Positives = 611/982 (62%), Gaps = 25/982 (2%)
 Frame = +1

Query: 16   VSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQ 195
            + S    +++++NITVAVRCRGRN+REI+AKS +VVTVPD+  + EV+INTS   G  AQ
Sbjct: 14   IGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQ 73

Query: 196  MNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 375
            + +KTYTVDKV+GP ++Q L+F++ AEPLF DF++GYNCTMLVYGMTSTGKTYTMTGD +
Sbjct: 74   LQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVE 133

Query: 376  LYNE-ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL---HGDCNND 543
            +  E +++  AGI PRIL KLFE L+   +D++VKCSFVELYNE+L+DLL     D +N 
Sbjct: 134  MGAEGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNG 190

Query: 544  NGNF----------KKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRN 693
              N           KKLRIFD                     + +LKKKL+         
Sbjct: 191  TENSSKQPESLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARSDYLKKKLK--------- 241

Query: 694  IASSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIY 873
              S+++ S+  +                             +     K+ +   QT GIY
Sbjct: 242  --SNRKKSLDDM---------------------------SLNANAGGKTHVPPTQT-GIY 271

Query: 874  IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLS 1053
            IQNL++FHI+TAKEG++LLQ+GL+ RQVA+TK+ND SSRSHTIFTITL+K+ K +++RLS
Sbjct: 272  IQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLS 331

Query: 1054 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL 1233
            K+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVINSLADK+ H+PFRESKLTRL
Sbjct: 332  KINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRL 391

Query: 1234 LQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT 1413
            LQDSLGGNTKT LIATISPAK+  EETCSTLEYASKAKNIKNKPQLGSFI+KDILLK+++
Sbjct: 392  LQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVS 451

Query: 1414 TELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD 1593
             EL K+++DL  TKSK+GIY+ Q++YKE+  DL N+KTE+ E KRT +SL  +N LL K+
Sbjct: 452  QELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKE 511

Query: 1594 KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEM 1773
            K++  E  +  + ++  +   +K +  K+ +  +   +L  ++    +  ++L  +I+  
Sbjct: 512  KKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVY 571

Query: 1774 KNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLS 1953
            + +      KF+ LL   L+ ++ K+  Q +  K+   + N+ +  ++  I+ E+ NLL 
Sbjct: 572  QQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGEVMNLLE 630

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNF 2133
            T ++N E  Y+ CI   L +TP +F  I+DNV +++ +T  +Y+++A N SDLSEE+N F
Sbjct: 631  TTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTF 690

Query: 2134 KQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINS 2313
            KQ++  +F+   + +  E++  + +   + ++  S+D++ ++QN +  +L  N +++ NS
Sbjct: 691  KQYLDGQFF---QNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNS 747

Query: 2314 LSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            +++V  ++++ E+D   PK SKWEES +LIN+SD+L+N+F +N+  S+  +   I+ +N+
Sbjct: 748  INDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNE 807

Query: 2494 SXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNES 2673
            S         +H   NDI +                         LH    +  +   ES
Sbjct: 808  SMDRSISTIKKHIIENDI-NSQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQES 866

Query: 2674 MKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPL-----------DNDK 2820
            M  +  LD SIRT++    Y    K  + P +      ++  IPL           D+ K
Sbjct: 867  MDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSSNLNRLSDSTK 926

Query: 2821 KRSFLNNANDNEMQNQSKIPRL 2886
                  +    +  + SKIP+L
Sbjct: 927  SSPRKRSQGSEDETHASKIPKL 948

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] {ON}
            complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  541 bits (1395), Expect = e-177
 Identities = 306/831 (36%), Positives = 473/831 (56%), Gaps = 6/831 (0%)
 Frame = +1

Query: 22   SDKQPQEEELNITVAVRCRGR--NQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQ 195
            SD    + E NI V  R +G+  N++  D +  +++  P ++  K        + G    
Sbjct: 4    SDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFKGKDDAVKREFG---- 59

Query: 196  MNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 375
                   +D +F     Q  ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+E 
Sbjct: 60   -------MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEED 112

Query: 376  --LYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-N 546
              L++E    S G+IPR+L +LF+ L   N DH+VKCS+VE+YNEELKDLL    N+  +
Sbjct: 113  SLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLS 172

Query: 547  GNFKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRN-IASSKRSSMQ 723
             + KKLRI D                        +K    +    R  + + SSK     
Sbjct: 173  ASIKKLRIVDSGSPN-------------------VKNGANSNCNTRDNSPLTSSKSIPTA 213

Query: 724  TIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHIT 903
             IR                 S   ++S N++SP  + +     ++T   YIQNL+EFHIT
Sbjct: 214  IIRKKMGRQSLTALKQANTLSISRSNSFNEYSPQRHIQ-----EKTGAPYIQNLEEFHIT 268

Query: 904  TAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGS 1083
             AKEGI+LL +GLK RQ+AS+K   +SSR+ TIFTI L+KE +GEIFR+SK N VDLAG+
Sbjct: 269  NAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGA 328

Query: 1084 ENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 1263
            E+ ++    NQR K+   INQ +  L +++NSL +K   +PF++SKLT L++D+L GN+K
Sbjct: 329  EHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSK 388

Query: 1264 TALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL 1443
            +  I T+   K +L+E   TLE+ +K +++K  P LG  I K+ L+K+I+ EL K+KSDL
Sbjct: 389  SIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDL 448

Query: 1444 LSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL 1623
            LSTKSK+G+YM  +HY  LT DL  +K EI + K+ I+ L  Q+  L KDKR   E NE+
Sbjct: 449  LSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEV 508

Query: 1624 QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
            QRIK+Q+M +S+  +Y  IE+QQ  E++L        +T + +   I    +RE+ V ++
Sbjct: 509  QRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQ 568

Query: 1804 FKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFY 1983
             KTL +  LS +   L   +  F+   +  N  ++ NL     E+  +L  + +  +  +
Sbjct: 569  MKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLF 628

Query: 1984 QECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYN 2163
             +CI K   ++P LF     +V  L+  TS  Y+ +AE LSD+SEE+NN KQ+I ++F+ 
Sbjct: 629  LDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFF- 687

Query: 2164 QEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMS 2343
              K +  ELL  Y+N T   ++ SS+D +    +LL  +L  NK +++ ++ + T+E++ 
Sbjct: 688  --KNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIE 745

Query: 2344 NELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
            NE++   P+  KWE+S ELI +S   +NEF       +  + D +K T++S
Sbjct: 746  NEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSES 796

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
            Ashbya gossypii ACR010C
          Length = 944

 Score =  493 bits (1268), Expect = e-158
 Identities = 274/666 (41%), Positives = 409/666 (61%), Gaps = 3/666 (0%)
 Frame = +1

Query: 853  DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 1032
            +Q++ IYIQNLQEFHIT A+EGI +LQKGLK+RQVASTKMNDFSSRSHTIFTI L+K  +
Sbjct: 242  EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 1033 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 1212
            GE+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADK++H+PFR
Sbjct: 302  GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 1392
            ESKLTRLLQDSLGGNTKTALIATISPAK+  +ET STLEYA+KAKNIKN+PQLGSF+MKD
Sbjct: 362  ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 1393 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 1572
            IL+K+I++EL+K+KSD LSTK+K+GIYM  +HY+E+  DL+NY+TEIQE KR +ES +SQ
Sbjct: 422  ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 1573 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 1752
            N+LLLKDK+   + NELQ +KI  +  +++ L  KIERQ   E +L   I    +    +
Sbjct: 482  NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 1753 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 1932
               +   +  E  + +  K +L   ++   + ++  +E  K + +++N +++ N+  I++
Sbjct: 542  KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 1933 EMTNLLSTARDNFEKFYQECITKFLSDTP-LLFDEINDNVLNLKALTSNYYSQIAENLSD 2109
                 L + R          I K + D P   + +  + + +L      Y   +   L++
Sbjct: 602  IFHETLDSVRSAGSDMCTN-IVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTE 660

Query: 2110 LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA 2289
            ++EE NN K+++ + F    K +  E+L+  +       +++S+ ++S++ +++  H+  
Sbjct: 661  MTEENNNMKEYLDEHFL---KNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEE 717

Query: 2290 NKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMT 2469
            ++ L+++S+ +  +E++  EL+  +P   +W  S E IN  DA + +F    E+  T + 
Sbjct: 718  SRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQF----ENKSTKLL 773

Query: 2470 DKIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXR-LHEFVK 2646
              +K+  D+         +  + N                            + L +  +
Sbjct: 774  TNLKELADNSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFE 833

Query: 2647 EGYLVTNESMKKLNELDTSIRTVLKDIDYE-KDIKETNSPLKPSHKHDYNHTIPLDNDKK 2823
                   ES K   E+D SI+ +++++  E  DIK+  + L+  +   +           
Sbjct: 834  NNIKYFKESSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPM 893

Query: 2824 RSFLNN 2841
            R  L N
Sbjct: 894  RPELKN 899

 Score =  268 bits (685), Expect = 3e-75
 Identities = 134/179 (74%), Positives = 154/179 (86%), Gaps = 1/179 (0%)
 Frame = +1

Query: 43  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
           EELNITVAVRCRGRN+REI AKS+VVVTVPD+ GS EV+INT+ DIG   +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 223 KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
           +VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 403 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNF-KKLRIFD 576
           AGIIPR+LF+LF+TLE    DH+VKCS++ELYNEELKDLL     +D  ++ K+LRIFD
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL-----DDTPDYSKRLRIFD 192

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
            YEL061C
          Length = 982

 Score =  441 bits (1134), Expect = e-138
 Identities = 278/822 (33%), Positives = 446/822 (54%), Gaps = 23/822 (2%)
 Frame = +1

Query: 52   NITVAVRCRGRNQREIDAKSSVVVTVPDIM-GSKEVAINTSEDIGFTAQMNSKTYTVDKV 228
            NITVAVRCR     E  + S  ++++ D   G+    I   E  G       K YT+D V
Sbjct: 9    NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 229  FGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY---NEELSD 399
            +G    Q  +FDE   P +  F  GYN +++ YG   +GK YT+ G+       N   S+
Sbjct: 64   YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAESE 123

Query: 400  SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNF-------- 555
            + G++PR+L +LF+ LE    DHI+KCSFVE+YN+EL+DLL    NN NGN         
Sbjct: 124  NLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGST 183

Query: 556  -KKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRSSMQTIR 732
             KKLRI D                              N +   +  + +SK+     +R
Sbjct: 184  GKKLRIVDSASNGLRSAGSS------------------NSSTRDNSPLTNSKKIPTAMMR 225

Query: 733  NXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQS-DQTAGIYIQNLQEFHITTA 909
                             ++ NN  +   + + +D S   S ++   IYIQNLQE  IT  
Sbjct: 226  KRMGKRSLPPNNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEI 285

Query: 910  KEGIKLLQKGLKYRQVAST----KMNDFSSRSHTIFTITLFKEVK-GEIFRLSKMNLVDL 1074
            +EG+ +++KGLK R++AST      N+FS RSH+IF ITL+KE +  E+FR+SK++ V+ 
Sbjct: 286  EEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNF 345

Query: 1075 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGG 1254
            AGSE  + + + N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G
Sbjct: 346  AGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDG 399

Query: 1255 NTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIK 1434
             T+T  IA I+P K  L+ TCS L  A+K K IKN+P+ GS I K+ L+K ++ EL K K
Sbjct: 400  ITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTK 459

Query: 1435 SDLLSTKSKD-GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINE 1611
            SDLLS KS D GIYMD++HY ELT  L++YK +IQ  K +I  LT +   +  +KRT  E
Sbjct: 460  SDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEE 519

Query: 1612 NNELQRIKIQTMNESMKKLYAKIERQQSIENELDG-KIQIFTKTNSKLTKIIDEMKNREA 1788
             NE QRIK+Q + E++  L   +E+Q   E+EL+  KI++ +   + + K +++  ++E 
Sbjct: 520  INERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGN-MQKSVEKYSDKEI 578

Query: 1789 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
             + +K K L D  L  +   L     + K++  + N  ++ N+  IK+E+  + + ++  
Sbjct: 579  HLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSK 638

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
             ++       + L  +P  F++++ N+ NL+      +++ +E LSD+SEE+NN   +I 
Sbjct: 639  VKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYIN 698

Query: 2149 DEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVT 2328
            D F    K    EL++ YIN T   ++  S +     + LL+ ++  N + +  S++++T
Sbjct: 699  DNFL---KSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLT 755

Query: 2329 TELMSNELDRLKPKLSKWE-ESAELI-NRSDALNNEFNDNVE 2448
            +E++ NEL +  P+  KWE  S E+I N ++++    N N E
Sbjct: 756  SEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSE 797

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1138

 Score =  370 bits (950), Expect = e-111
 Identities = 274/820 (33%), Positives = 412/820 (50%), Gaps = 19/820 (2%)
 Frame = +1

Query: 1    MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
            +S P  S   Q  +   NI V VRCR RNQREID KSSVVV+     G   +  N S  +
Sbjct: 27   LSSPISSEPHQRHQIGSNIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPL 86

Query: 181  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
                    KTY  D+VFG  + Q  IF E+A+    + ++GYNCT+  YG T TGKTYTM
Sbjct: 87   SHP----KKTYMFDEVFGADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTM 142

Query: 361  TGDEKLYNE-------ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDL 519
            +GD  ++ +        L + AGIIPR+L  LF+ L K   +H VK SF+ELYNE LKDL
Sbjct: 143  SGDMSIWGDLDSQDKILLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDL 202

Query: 520  LHGDCNNDNGNFKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIA 699
            L  D ++D  N   +RIFD                                    + + A
Sbjct: 203  L-ADNDSDEDN---IRIFD-----------------------------------NNNSNA 223

Query: 700  SSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQ 879
                + M  ++               + SS +N             ST  S  ++ I ++
Sbjct: 224  HGASNGMSQVKMNKSKVRAPTLSGATVSSSASN------------SSTSSSSSSSSITVK 271

Query: 880  NLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF----KEVKGEIF- 1044
             ++E +I +A EG++LL KG   R+VA+TK ND SSRSHTIFTI         V GE + 
Sbjct: 272  GMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSGEQYV 331

Query: 1045 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKL 1224
            ++ K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVIN+L + + H+P+R SKL
Sbjct: 332  KIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYRGSKL 391

Query: 1225 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLK 1404
            TRLLQDSLGG TKT +IATISPA+++++ET STLEYA++AK+IKN PQ+   + KD  + 
Sbjct: 392  TRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKDSCIM 451

Query: 1405 NITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALL 1584
                E+ +++ +L +++ ++G+Y+ Q+ Y                       L   N+LL
Sbjct: 452  EYIYEIERLRQELKASRQREGMYITQEQY----------------------DLYESNSLL 489

Query: 1585 LKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKII 1764
            +++          Q++ IQ M E +K+   K   Q  +  E   + Q       +  K+ 
Sbjct: 490  VEE----------QKVVIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQ-------ESQKVC 532

Query: 1765 DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 1944
            D ++     +  KF            K+   QI    DQ  + N ++ E+L++ ++EM+ 
Sbjct: 533  DTLR-----IQKKFMLETFEKYHTTCKEHAAQI----DQIHSDNISLIESLRVERNEMS- 582

Query: 1945 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 2124
              ++A DN        I+K L+       E ++ + +LKA              DL    
Sbjct: 583  --TSALDN-----AGLISKILT----TIAERSEQLTSLKA--------------DLEVRI 617

Query: 2125 NNFKQFITDEFYNQEKG-------HQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHL 2283
            ++F++F +    + E+         + +LL+  I ++   I++  N +  T+QN + +  
Sbjct: 618  SDFERFSSSMLLDFERNALSRINHSRDDLLSLEITDSLEQIQAMHNSLNVTLQN-IRKPW 676

Query: 2284 RANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELI 2403
            +   E I  +  N+    + N  ++L   + K E S E I
Sbjct: 677  KKETEAIYYTHKNI----IENCGNQLYEYVEKLENSLETI 712

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
            YBL063W
          Length = 1232

 Score =  349 bits (896), Expect = e-102
 Identities = 279/919 (30%), Positives = 449/919 (48%), Gaps = 100/919 (10%)
 Frame = +1

Query: 19   SSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVA------------- 159
            SS      ++ NI V VRCR R QREID KSSVV++     G+K +              
Sbjct: 40   SSKSLSHTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNA 99

Query: 160  ---------INTSEDI-----GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFI 297
                      N + +I           N +TYT DKVFG  + Q  +F+ +A+    + +
Sbjct: 100  NGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEML 159

Query: 298  KGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE-------LSDSAGIIPRILFKLFETLEKL 456
            +GYNCT+  YG T TGKTYTM+GD  +           L + AGIIPR+L  LF+ L K 
Sbjct: 160  QGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKN 219

Query: 457  NEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDXXXXXXXXXXXXXXXXXXXX 636
            +           + N ++ +  + + N++N N +++ + +                    
Sbjct: 220  DT----------ITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVK-------------- 255

Query: 637  XTTFLKKKLRNEALL------RSRNIASSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNN 798
              +FL+  L NE L       ++  + S+ +   QT  N               F   NN
Sbjct: 256  -VSFLE--LYNEKLTDLLSNYKTDALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNN 312

Query: 799  -----DSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
                 D  N    ++ +KS    + ++ I ++ ++E +I +A EG++LL +G   R+VAS
Sbjct: 313  NLHDFDGKNVRIMSNQNKSASNCNGSS-ITVKGMEEIYIKSAHEGLQLLTEGSLKRKVAS 371

Query: 964  TKMNDFSSRSHTIFTI----TLFKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKE 1128
            TK+ND SSRSHTIFTI    T    V G+ F +  K+NLVDLAGSENINRSGA N+RA+E
Sbjct: 372  TKLNDLSSRSHTIFTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQE 431

Query: 1129 AGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 1308
            AG IN+SLLTLGRVIN+L D++ H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK++LE
Sbjct: 432  AGLINKSLLTLGRVINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLE 491

Query: 1309 ETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH 1488
            ET STLEYA++AK+IKN PQ+   + KD  +     E+ +++++L   ++K+GIY+ Q  
Sbjct: 492  ETVSTLEYATRAKSIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

Query: 1489 ----------YKELTTDLQNYKTEIQECK-RTIESLTSQNALLLKDKRTINENNEL-QRI 1632
                        E    + N + +I+  K + +E   S   LL K +++ + N +L ++ 
Sbjct: 552  LDLYESNSILITEQKAKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKT 611

Query: 1633 KI------------QTMNESMKKLY-AKIERQQSIENELDGKIQIFTKTNSKLTK--IID 1767
            K+            +  N ++ +++ + +E   S++N  D K+ + +K N K  K   I 
Sbjct: 612  KVIISLFKRYQENFKIFNSNINQIHSSNLEVFDSLQNHKD-KLDLCSKKNIKTLKEIYIA 670

Query: 1768 EMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDEN---------LQ 1920
            E K  E L        L  SLS  S +      +  D+  N +   + N         L 
Sbjct: 671  EEKYTEQL------NTLKASLSSYSDRFMLVFSSVFDEMENNSIEFERNVKSKLSSLDLT 724

Query: 1921 LIKSEMTNLLST----------ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALT 2070
            ++  E+ N+  T          A D ++  Y+E     L      F+ +     N+  L 
Sbjct: 725  MVVEEIKNMKETVEMICNNILIASDTWDSSYKEVYNSHLMTLKNCFNMVEHKCANINQLM 784

Query: 2071 SNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVM 2250
               +S+     +D+    +N+K   +D   + +     + L       + +IE  ++   
Sbjct: 785  DENFSKFQ---NDIKSGVHNYKNVSSDHTNDMKHTIYEQSLEIEKLKEKIIIEQQNS--- 838

Query: 2251 STIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDA---- 2418
             ++++ LN+ +   ++ I+ S   +TT+L+       K  L   E   +++NR+ +    
Sbjct: 839  KSVESRLNKVIDYFEDEILKSRRKITTDLIDTLKQSEKDHL---ELDKQILNRTLSGLRN 895

Query: 2419 LNNEFNDNVESSMTTMTDK 2475
              NE   +++ S+  +T K
Sbjct: 896  FENEKQSDLQKSINALTSK 914

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  277 bits (708), Expect = 1e-77
 Identities = 197/610 (32%), Positives = 321/610 (52%), Gaps = 46/610 (7%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            NDS  +    DN+ +       + I ++ +QE  I +A EG+ LL +G   R+VA+TK N
Sbjct: 223  NDSKKQIRIFDNNNNN------SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCN 276

Query: 976  DFSSRSHTIFTIT--LFKEVKGE------IFRLSKMNLVDLAGSENINRSGALNQRAKEA 1131
            D SSRSHT+FTIT  + ++   E        ++ K+NLVDLAGSENINRSGA N+RA+EA
Sbjct: 277  DLSSRSHTVFTITTNIIEQDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEA 336

Query: 1132 GSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 1311
            G IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EE
Sbjct: 337  GLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEE 396

Query: 1312 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH- 1488
            T STLEYA++AK+IKN PQ+   + KD  LK+   E+ K+++DL ++++K GI++ Q   
Sbjct: 397  TASTLEYATRAKSIKNSPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL 456

Query: 1489 ---------YKELTTDLQNYKTEIQECK-RTIESLTSQNALLLKDKRTINENNELQ---- 1626
                       E    + N + +I++ K + +  L   N L  + ++ IN          
Sbjct: 457  DLYESNSILIDEQNLKIHNLREQIKKFKEKYLNQLDINNFLQSEKEKLINIIRNFHVDFS 516

Query: 1627 --RIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTN------SKLTKIIDEMKNR 1782
               ++IQ ++ S  ++  +I +Q+ + ++++ + Q  T  N      +++ + +D ++N 
Sbjct: 517  NFNLEIQKIHRSNLEVMTEITQQRDL-SQVNSRRQYTTNQNLQLEISNQVLQTLDTLQNS 575

Query: 1783 EALVNSKFKTLLDHSLSYVSKKLNYQIENFK---DQGINQNFTVDENLQLIKSEMTNLLS 1953
                NSKF  +++     V+++L+  + + K   D  +   F    NL  IK  M  L+S
Sbjct: 576  LMNYNSKFSQVING----VTEELSLNVNSHKVKHDSTLESLFNTTANLLTIK--MNELVS 629

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNF 2133
            +   +      + ++ +  D   L +    +   L  L ++  S +    S +    N  
Sbjct: 630  SISQSLANIRNDSLSHYNKD---LNEIYQSHQRFLSKLQNDIKSCLDSIGSSILNSINEI 686

Query: 2134 KQFITDEF--YNQEKGHQHELLNKYINNTQTVIESSSNDVMS--TIQNLLNEHLRANKEL 2301
             Q  T      N    H   +  + I      IE   N++++   + N  ++     KE 
Sbjct: 687  SQTCTTNLNSMNDLTSHHQSVATEMIEKQHLQIEKLKNELLNERKVSNQFHKQSTRLKEY 746

Query: 2302 IINSLSNVTTEL---MSNELDRLKPKLSK-----WEESAELINRSDALNNEFNDNVESSM 2457
              N +S   TEL    +  + +LK K SK     W+E+  + N +    N  + +  S++
Sbjct: 747  FQNHVSRTRTELDDEFNEFISKLKEKQSKLDQEIWQETESIFNETGKEVNAIHSSSISTL 806

Query: 2458 TTMTDKIKQT 2487
            T   + I QT
Sbjct: 807  TENAETILQT 816

 Score =  149 bits (377), Expect = 6e-36
 Identities = 84/187 (44%), Positives = 117/187 (62%), Gaps = 10/187 (5%)
 Frame = +1

Query: 46  ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDK 225
           E NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQ 106

Query: 226 VFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD-------EKLYN 384
           VFG  + Q ++F   A+    + + GYNCT+  YG T TGKTYTM+GD       +   N
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDN 166

Query: 385 EELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNF 555
             L + AGIIPR+L  LF+ L  LN+++ VK SF+ELYNE LKDLL  + ++D   N + 
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDSK 226

Query: 556 KKLRIFD 576
           K++RIFD
Sbjct: 227 KQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  273 bits (699), Expect = 2e-76
 Identities = 202/613 (32%), Positives = 325/613 (53%), Gaps = 49/613 (7%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            NDS  +    DN+ +       + I ++ +QE  I +A EG+ LL +G   R+VA+TK N
Sbjct: 222  NDSKRQIRIFDNNNNN------SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCN 275

Query: 976  DFSSRSHTIFTIT---LFKEVKGE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEA 1131
            D SSRSHT+FTIT   + ++ K         ++ K+NLVDLAGSENINRSGA N+RA+EA
Sbjct: 276  DLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEA 335

Query: 1132 GSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 1311
            G IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EE
Sbjct: 336  GLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEE 395

Query: 1312 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH- 1488
            T STLEYA++AK+IKN PQ+   + KD  LK+   E+ K+++DL ++++K GI++ Q   
Sbjct: 396  TASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL 455

Query: 1489 ---------YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI------------ 1605
                       E    + N + +I++ K    +    N  L  +K  +            
Sbjct: 456  DLYESNSILIDEQNLKIHNLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFS 515

Query: 1606 NENNELQRI---KIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMK 1776
            N N+E+Q+I    ++ MNE   +   +   Q++ + +     ++ TK   ++ + +  ++
Sbjct: 516  NFNSEIQKIHHTNLELMNEITLQ---RDLSQETSQEQYTTSQELQTKITQQVLQTLSTLQ 572

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK-SEMTNLLS 1953
            +     NSKF  +++     +S+ +N+  +   D  +   F    N   IK +E+ N +S
Sbjct: 573  SSLMNYNSKFSQVINGVTEELSRNVNFH-KLKHDSALESLFDTSANQLTIKLNELVNGIS 631

Query: 1954 TA----RDNFEKFYQECITK-FLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSE 2118
             +    RD+    Y + + + +LS    L D  ND    +K    +  S I  +++++S+
Sbjct: 632  HSLKHFRDDSVSHYNKDLNEVYLSHKQFLKDLEND----IKNCLDSIGSLIVASINEISQ 687

Query: 2119 EYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMS--TIQNLLNEHLRAN 2292
                      D   +    HQ  ++ + +      I+    D+++   I N  ++ L   
Sbjct: 688  TCTT----SLDSVNSLTSNHQF-VVTELVEKQDLEIKKLKKDLITERRISNQFSQQLTRL 742

Query: 2293 KELIINSLSNVTTELMS--NE-LDRLKPKLSK-----WEESAELINRSDALNNEFNDNVE 2448
            K+     +S    EL    NE ++ LK K SK     W ++A + N +D   NE N+   
Sbjct: 743  KKYFQEHVSKTRVELYDEFNEFINNLKEKQSKLDQDIWHKTAAIFNETD---NEVNEIYT 799

Query: 2449 SSMTTMTDKIKQT 2487
             S+T++T   K T
Sbjct: 800  DSITSLTQSAKAT 812

 Score =  145 bits (367), Expect = 9e-35
 Identities = 81/185 (43%), Positives = 116/185 (62%), Gaps = 10/185 (5%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 107

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD-------EKLYNEE 390
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNFKK 561
           L + AGIIPR+L  LF+ L  LN+++ VK +F+ELYNE LKDLL  + ++D   N + ++
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKRQ 227

Query: 562 LRIFD 576
           +RIFD
Sbjct: 228 IRIFD 232

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
            KIP1Kinesin-related motor protein required for mitotic
            spindle assembly, chromosome segregation, and 2 micron
            plasmid partitioning; functionally redundant with Cin8p
            for chromosomal but not plasmid functions
          Length = 1111

 Score =  271 bits (692), Expect = 2e-75
 Identities = 198/621 (31%), Positives = 327/621 (52%), Gaps = 62/621 (9%)
 Frame = +1

Query: 820  PADND-KSTIQ----SDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFS 984
            PA ND K  I+    ++  + I ++ +QE  I +A EG+ LL +G   R+VA+TK ND S
Sbjct: 220  PAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLS 279

Query: 985  SRSHTIFTIT---LFKEVKGE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSI 1140
            SRSHT+FTIT   + ++ K         ++ K+NLVDLAGSENINRSGA N+RA+EAG I
Sbjct: 280  SRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLI 339

Query: 1141 NQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
            N+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET S
Sbjct: 340  NKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETAS 399

Query: 1321 TLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH---- 1488
            TLEYA++AK+IKN PQ+   + KD  LK+   E+ K+++DL ++++K GI++ Q      
Sbjct: 400  TLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLY 459

Query: 1489 ------YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI------------NEN 1614
                    E    + N + +I++ K    +    N LL  +K  +            N  
Sbjct: 460  ESNSILIDEQNLKIHNLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFY 519

Query: 1615 NELQRI---KIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL---TKIIDEMK 1776
            +E+Q+I    ++ MNE ++      +R  S+EN    + Q  T  N +L    +++  + 
Sbjct: 520  SEIQKIHHTNLELMNEVIQ------QRDFSLEN---SQKQYNTNQNMQLKISQQVLQTLN 570

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFK---DQGINQNFTVDENLQLIKSEMTNL 1947
              +  +N+ + +     +  V+++L   +   K   D  +     +  N  L+ ++M  L
Sbjct: 571  TLQGSLNN-YNSKCSEVIKGVTEELTRNVNTHKAKHDSTLKSLLNITTN--LLMNQMNEL 627

Query: 1948 LSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNL----KALTSNYYSQIAENLSDLS 2115
            + +   + E F  +  + +  D   ++      + NL    K+   +  S I  +++++S
Sbjct: 628  VRSISTSLEIFQSDSTSHYRKDLNEIYQSHQQFLKNLQNDIKSCLDSIGSSILTSINEIS 687

Query: 2116 EEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMS--TIQNLLNEHLRA 2289
            +        +     NQ+ G      +K I      I+   ND+++   I N  N+ L  
Sbjct: 688  QNCTTNLNSMNVLIENQQSGS-----SKLIKEQDLEIKKLKNDLINERRISNQFNQQLAE 742

Query: 2290 NKELIINSLSNVTTEL---MSNELDRLKPKLSK-----WEESAELINRSDALNNEFNDNV 2445
             K    + +S   +E    ++  +D LK K SK     W+++A + N +D + N+ + + 
Sbjct: 743  MKRYFQDHVSRTRSEFHDELNKCIDNLKDKQSKLDQDIWQKTASIFNETDIVVNKIHSDS 802

Query: 2446 ESSMTTMTDK----IKQTNDS 2496
             +S+    +     + Q N+S
Sbjct: 803  IASLAHNAENTLKTVSQNNES 823

 Score =  144 bits (363), Expect = 3e-34
 Identities = 81/185 (43%), Positives = 114/185 (61%), Gaps = 10/185 (5%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V VRCR RN+REI+ KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD-------EKLYNEE 390
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNFKK 561
           L + AGIIPR+L  LF+ L  LN+++ VK SF+ELYNE LKDLL    ++D   N   ++
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQ 228

Query: 562 LRIFD 576
           +RIFD
Sbjct: 229 IRIFD 233

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (REAL)
          Length = 1113

 Score =  266 bits (680), Expect = 7e-74
 Identities = 192/600 (32%), Positives = 316/600 (52%), Gaps = 48/600 (8%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            ND+  +    DN+ +       + I ++ +QE  I +A EG+ LL +G   R+VA+TK N
Sbjct: 223  NDTKRQIRIFDNNNNN------SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCN 276

Query: 976  DFSSRSHTIFTIT---LFKEVKGE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEA 1131
            D SSRSHT+FTIT   + ++ K         ++ K+NLVDLAGSENINRSGA N+RA+EA
Sbjct: 277  DLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEA 336

Query: 1132 GSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 1311
            G IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EE
Sbjct: 337  GLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEE 396

Query: 1312 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH- 1488
            T STLEYA++AK+IKN PQ+   + KD  LK+   E+ K+K+DL ++++K GI++ Q   
Sbjct: 397  TASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQL 456

Query: 1489 ---------YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKR---TINENNELQ-- 1626
                       E    + N + +I++ K    +    N LL  +K    T+  + ++   
Sbjct: 457  DLYESNSILIDEQNLKIHNLREQIKKFKEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYS 516

Query: 1627 --RIKIQTMNESMKKLYAKIERQ-----QSIENELDGKIQIFTKTNSKLTKIIDEMKNRE 1785
                KIQ ++ +  +L  ++ +Q     ++ + +      +  K + ++ + ++ ++N  
Sbjct: 517  HFYSKIQQIHYTNLELINQVTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSL 576

Query: 1786 ALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARD 1965
               NSKF  +++     ++  +N    N  D           NL +IK  M  L+ +  +
Sbjct: 577  RNYNSKFSQVINGVTEELTNSVNSHKVN-HDSTFKSLMNTTANLLMIK--MNELVLSISN 633

Query: 1966 NFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFI 2145
            +F+ F  +  +    D       +ND   + K L  N  S I + L  +          I
Sbjct: 634  SFKDFQSDFASHCNKD-------LNDIYQSHKLLLRNLQSDIKKCLDSIGRSVLASINEI 686

Query: 2146 TDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN---------KE 2298
            +D   +      + L+NK+ +    VIE   +++     +L+NE   +N         K 
Sbjct: 687  SDS-CSTNLNSMNVLINKHESEVLKVIEKKDSEIKKLKNDLVNERKISNEFSEQLTQLKW 745

Query: 2299 LIINSLSNVTTEL---MSNELDRLKPKLSK-----WEESAELINRSD-ALNNEFNDNVES 2451
               N +S    EL   +   +++LK K  K     W ++  + N++D A+N  +++++ S
Sbjct: 746  YFQNHVSRTRNELHDELDGFINKLKDKQLKLDQDIWHKTTSVFNQTDIAVNKIYSESILS 805

 Score =  145 bits (367), Expect = 9e-35
 Identities = 81/185 (43%), Positives = 113/185 (61%), Gaps = 10/185 (5%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE------- 390
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +  +        
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNFKK 561
           L + AGIIPR+L  LF+ L  LN ++ VK SF+ELYNE LKDLL    ++D   N   ++
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQ 228

Query: 562 LRIFD 576
           +RIFD
Sbjct: 229 IRIFD 233

 Score = 33.1 bits (74), Expect = 4.9
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 20/135 (14%)
 Frame = +1

Query: 1582 LLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI 1761
            L K+  T+N    ++   ++  NE++K L +  +    + N+   +I+IF   N+  + +
Sbjct: 183  LFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQIRIFDNNNNNSSIM 242

Query: 1762 IDEMKNREALVNS--------------------KFKTLLDHSLSYVSKKLNYQIENFKDQ 1881
            +  M  +E  +NS                    K   L   S +  +   N   ++ KD 
Sbjct: 243  VKGM--QEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDH 300

Query: 1882 GINQNFTVDENLQLI 1926
            G N+NF     L L+
Sbjct: 301  GQNKNFVKIGKLNLV 315

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1112

 Score =  265 bits (678), Expect = 1e-73
 Identities = 213/639 (33%), Positives = 331/639 (51%), Gaps = 77/639 (12%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            ++++A      DN K    +  +  I ++ ++E +I +A+EG+KLL +G   RQVASTK 
Sbjct: 227  DDNNAESIRIFDNIKPEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKC 286

Query: 973  NDFSSRSHTIFTITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGS 1137
            ND SSRSHT+FTIT        + GE + +  K+NLVDLAGSENINRSGA N+RA+EAG 
Sbjct: 287  NDLSSRSHTVFTITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGL 346

Query: 1138 INQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EET 
Sbjct: 347  INKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETV 406

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            STLEYA++AK+IKN PQ+   + KD  +     E+ +++ +L +T++KDGIY+ Q+ Y  
Sbjct: 407  STLEYATRAKSIKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY-- 464

Query: 1498 LTTDL-QNYKTEIQECKRTIESLTSQ-NALLLKDKRTINENNELQRIKIQTMNESMKKLY 1671
               DL ++    + E K  I++L  Q      K  + +N   E ++ K+Q ++ S ++++
Sbjct: 465  ---DLYESNCILVGEQKARIDNLEEQIKRFKEKYVQQVNITKETEQ-KLQKIDLSYQQVW 520

Query: 1672 AKIERQQSIENELDGKIQIF----TKTNSKLTKIIDEMKNREALVNS------KFKTLLD 1821
             K +  +S  + L  K   F    T+ + K  KI+D + +    ++       ++ T  D
Sbjct: 521  EKKQLLESSLDYLQQKCNSFEHEITEIHHKNLKILDSIVDERDTISEDLVQKYRYITETD 580

Query: 1822 H-------SLSYVSKKLNYQIENFK-----------DQGINQNFTVDENLQLIKSEMTNL 1947
            H       +L  V K LN   ++FK           D+ IN +   +E ++++ +E   +
Sbjct: 581  HCITKELTTLKNVKKTLNNYNKSFKGVLKSVFQELQDKVINLSAVTEEQVRVVDTE--GI 638

Query: 1948 LSTARDNFEKFYQECITKF---LSDTPLLFDE--------INDNVLNLKALTSNYYSQIA 2094
            +++  D       +CI K    +    LL DE        I+D     +AL  N    I 
Sbjct: 639  INSFED-LNTSITKCIGKLKVKIDFKDLLLDETSEAVQSWISDLTKQHEALQDNLVRSIG 697

Query: 2095 E----------------------NLSDLSEEYNNFKQFITD-EFYNQEKGHQHELLNKYI 2205
            E                      NL  L  E    K    + +    +K +   LL    
Sbjct: 698  ELQREISARFEFTETTSKKSAELNLEVLEAEKIKVKNLENNLQRARIDKENSDNLLQTLQ 757

Query: 2206 NNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELD-RLK-----P 2367
               Q  +  +  ++   I N +N      KEL +N L N T  +  ++ D  LK      
Sbjct: 758  TYFQDEVTRTRREIFKDITNAVNFGEDRLKELELNILQNSTKLVSDSQKDSNLKHENSLS 817

Query: 2368 KLSKWEESA--ELINRSDALNNEFNDNVESSMTTMTDKI 2478
            +L K   SA  E+   ++  N E+ DN++   T++ + I
Sbjct: 818  QLGKTASSAFEEVCKATEKSNAEYVDNLKILQTSVINSI 856

 Score =  157 bits (396), Expect = 3e-38
 Identities = 84/191 (43%), Positives = 114/191 (59%), Gaps = 10/191 (5%)
 Frame = +1

Query: 34  PQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTY 213
           P     NI V VRCR RN+REI  KSSVV++     G   +  N S     +     KTY
Sbjct: 48  PDSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTY 107

Query: 214 TVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL----- 378
           T D+VFG  + Q ++F+ +A+   S+ ++GYNCT+  YG T TGKTYTM+GD  +     
Sbjct: 108 TFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTT 167

Query: 379 YNEE-----LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 543
           +N +     LS+ AGIIPR+L  LF+ L+  + D+ VK SF+ELYNE LKDLL      D
Sbjct: 168 HNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKED 227

Query: 544 NGNFKKLRIFD 576
           + N + +RIFD
Sbjct: 228 DNNAESIRIFD 238

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] {ON}
            Anc_7.387 YBL063W
          Length = 1151

 Score =  262 bits (670), Expect = 2e-72
 Identities = 181/585 (30%), Positives = 308/585 (52%), Gaps = 32/585 (5%)
 Frame = +1

Query: 820  PADNDK--STIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRS 993
            P+ N K   + +++  + I ++ ++E +I +A EG++LL +G   R+VASTK ND SSRS
Sbjct: 236  PSGNSKIQKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRS 295

Query: 994  HTIFTITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLT 1158
            HTIFTIT        V GE + ++ K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLT
Sbjct: 296  HTIFTITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLT 355

Query: 1159 LGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 1338
            LGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EET STLEYA+
Sbjct: 356  LGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYAT 415

Query: 1339 KAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQN 1518
            +AK+IKN PQ+   + KD+ +     E+ +++ +L +++ KDG+Y+ Q+ +         
Sbjct: 416  RAKSIKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF--------- 466

Query: 1519 YKTEIQECKRTIESLTSQNALLLKDKRT--INENNELQRIKIQTMNESM--KKLYAKIER 1686
                          L   N +L+ +++   +N   ++++ K + +N++   K+L   ++ 
Sbjct: 467  -------------DLYESNGILVDEQKAKIVNMEEQIKKFKEKYVNQTAINKELETSLKN 513

Query: 1687 QQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS------KK 1848
             Q + N+L  K        + L  I  E ++   L  ++  T+ +++L+ +         
Sbjct: 514  SQELSNDLLDK-------QASLISIFGEYQSNFKLFETEINTIHENNLNLIDLISTERND 566

Query: 1849 LNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLF 2028
            L    + + D  +    T++  ++ I    T L S               KF      +F
Sbjct: 567  LQLSSQKYYDFLVETFRTIENQMKFILQSQTTLSSYN------------IKFKEVIGGVF 614

Query: 2029 DEINDNVLNL--KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
            +E+ DN +N   K LT       +  +  + EE +N  Q         +K    ++ + +
Sbjct: 615  EELEDNTINFRKKILTETQELDFSSTILSI-EELDNCLQENIRVLTTPQKEQMEKIYSSH 673

Query: 2203 INNTQTVIES---SSNDVMSTIQNLLNE-HLRANKELIINSLS--------NVTTELMSN 2346
             +  + + +S   SS+D+  +++  L + +L+ N  L++                +    
Sbjct: 674  TDIIKGLYKSTIGSSDDIRHSMEQFLQDLNLKTNDALVLAKTQYLKKIEELKTLVDTQKE 733

Query: 2347 ELDRLKPKLS-KWEESAELINRSDALNNEFNDNVESSMTTMTDKI 2478
            ++  L+ KL+ + E+S +   +   L   F + VE    ++ D I
Sbjct: 734  QILSLEGKLTEEREKSIKTDEKIFELEQYFKNYVEKEKESVFDSI 778

 Score =  140 bits (354), Expect = 3e-33
 Identities = 82/193 (42%), Positives = 112/193 (58%), Gaps = 9/193 (4%)
 Frame = +1

Query: 25  DKQPQEEEL--NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQM 198
           D    E EL  NI V VRCR RNQREI+ KSSVV++     G + V  + S  +  T   
Sbjct: 48  DSPDFESELGSNIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVVLSDPSSVLSHT--- 104

Query: 199 NSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 378
             KTY  D+VFG  + Q ++F+  A+    + ++GYNCT+  YG T TGKTYTM+GD  +
Sbjct: 105 -KKTYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINI 163

Query: 379 YNE-------ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCN 537
             +        L + AGIIPR+L  LF+ L + + ++ VK SF+ELYNE LKDLL    +
Sbjct: 164 LGDLESQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL----S 219

Query: 538 NDNGNFKKLRIFD 576
                 + +RIFD
Sbjct: 220 QSKETEESIRIFD 232

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  261 bits (667), Expect = 3e-72
 Identities = 186/550 (33%), Positives = 291/550 (52%), Gaps = 16/550 (2%)
 Frame = +1

Query: 805  ANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFS 984
            A++ S  +N +       ++ I ++ ++E +I +A +G++LL  G   R+VA+TK ND S
Sbjct: 221  ASEQSEEENIRIFDNVSASSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLS 280

Query: 985  SRSHTIFTITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1149
            SRSHT+FTIT        V GE + +  K+NLVDLAGSENINRSGA N+RA+EAG IN+S
Sbjct: 281  SRSHTVFTITTNITKLDPVSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKS 340

Query: 1150 LLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLE 1329
            LLTLGRVIN+L D   H+P+RESKLTRLLQDSLGG TKT +IATISPAK++++ET STLE
Sbjct: 341  LLTLGRVINALVDHTQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLE 400

Query: 1330 YASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY------ 1491
            YA++AK+IKN PQ+   + KD  +     E+ +++ +L +++ KDGI + Q  +      
Sbjct: 401  YATRAKSIKNTPQVNQSMSKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESN 460

Query: 1492 ----KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
                 E  T +QN + +IQ  K      T  N    K+  +  + NELQ I++++    +
Sbjct: 461  GILVDEQKTKIQNMEEQIQRFKDKYVKQTELN----KNLESRLKQNELQTIQLKSQRTQL 516

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
              L   +E  QS  N     I+  TK +   T +I ++  + +        L + S++YV
Sbjct: 517  LSL---LENFQSNSNHY---IERVTKIHDSNTHLIQQLAQQRS-------ELHNGSITYV 563

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             K +   +    DQ            Q   SE+ N+L +  D F+       T+      
Sbjct: 564  -KSVTEAMSGISDQ------------QKELSELRNVLQSYNDKFKHVITGIFTE------ 604

Query: 2020 LLFDEIND-NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 2196
             L D++ D     L+ LTS     I + + +L ++ +                 + E+L 
Sbjct: 605  -LEDKVKDTRKSTLEPLTSMNLRLILDMIGELRDDIST----------------RFEMLK 647

Query: 2197 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 2376
            K      T I  +  D++ T  + +NE+  + ++++  S++      + +  D  + K  
Sbjct: 648  KPRTEDTTKIFKAHQDIIETCFSHINEYCDSMEKVLTTSINQFQAHSLPSSFDIFQDKTK 707

Query: 2377 KWEESAELIN 2406
            K  E  EL+N
Sbjct: 708  K--ELDELMN 715

 Score =  132 bits (333), Expect = 1e-30
 Identities = 76/183 (41%), Positives = 108/183 (59%), Gaps = 8/183 (4%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V VRCR RN+REI  KSSVV++      S ++ ++             +TYT D+VF
Sbjct: 60  NIKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPL---LPLAYAKRTYTFDRVF 116

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE------- 390
           G  + Q  +F++ A+    + ++GYNCT+  YG T TGKTYTM+GD  +   +       
Sbjct: 117 GAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMV 176

Query: 391 -LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLR 567
            L + AGIIPR+L +LF  L+  NE + VK SF+ELYNE LKDLL  + + +    + +R
Sbjct: 177 LLGEHAGIIPRVLVELFRWLDG-NEGYSVKVSFLELYNERLKDLLASEQSEE----ENIR 231

Query: 568 IFD 576
           IFD
Sbjct: 232 IFD 234

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar to
            Ashbya gossypii ACR228C
          Length = 1134

 Score =  261 bits (666), Expect = 6e-72
 Identities = 184/540 (34%), Positives = 281/540 (52%), Gaps = 19/540 (3%)
 Frame = +1

Query: 826  DNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIF 1005
            DN K    +     I ++ ++E +I +A+EG+KLL +G   R+VA+T+ ND SSRSHTIF
Sbjct: 241  DNLKLDRSNSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIF 300

Query: 1006 TITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 1170
            TIT        + GE + ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRV
Sbjct: 301  TITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRV 360

Query: 1171 INSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
            IN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK ++EET STLEYA++AK+
Sbjct: 361  INALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKS 420

Query: 1351 IKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTE 1530
            IKN PQ+   + K+  +     E+ K++ +L +  +K+GIY+ ++ Y+            
Sbjct: 421  IKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE------------ 468

Query: 1531 IQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENEL 1710
                  T ES    N +L+++          Q+ KI  + E +K+   K   Q  +  E 
Sbjct: 469  ------TYES----NCILVEE----------QQAKIDNLQEQIKRFKEKYLEQTKLVKEK 508

Query: 1711 DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN 1890
            D ++++    N ++T           + N K    LD        KL +++E+++   I 
Sbjct: 509  DTQVKMIKSINERIT-----------MYNKKLTDYLD--------KLRFRVEDYE---IK 546

Query: 1891 QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITK---FLSDTPLLFDEINDNVLNLK 2061
             N   + N++        LL    +N E  Y   I+K         LL  E+N  +L   
Sbjct: 547  VNDIHNNNMK--------LLLNLNNNRESIYDSLISKTKHIEMSNELLLKEVNGLIL--- 595

Query: 2062 ALTSNYYSQIAENLSDLSEEYN-NFKQFITDEFYNQEKGHQHELLNKYINNTQT---VIE 2229
                         + D  + YN  FK  IT  F+  ++  QH L   + NN       ++
Sbjct: 596  -------------IRDTLKSYNERFKTVITGVFHELQEKMQHVLHLSHQNNLNLDLGYVD 642

Query: 2230 SSSNDVMSTIQNL-------LNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEE 2388
            +   +++  ++         L++ L   K   I + +  T EL   E D L  +L ++ E
Sbjct: 643  AKFGEIIKVVEECSQSLLLNLDQSLAGMKSETIQNAAYSTVEL-QRESDTLYERLKEFIE 701

 Score =  148 bits (373), Expect = 2e-35
 Identities = 80/173 (46%), Positives = 109/173 (63%), Gaps = 8/173 (4%)
 Frame = +1

Query: 37  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 216
           +E+  NI V VRCR RN REI  KSSVVV+     G + +  N S         N+KTYT
Sbjct: 51  EEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKTYT 103

Query: 217 VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE-- 390
            D+VFG  + Q  +FD++A    ++ ++GYNCT+  YG T TGKTYTM+GD  +      
Sbjct: 104 FDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLE 163

Query: 391 ------LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGD 531
                 LS+ AGIIPR+L +LF+ L++ +ED+ VK SF+ELYNE+L+DLL  D
Sbjct: 164 DPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVED 216

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBL063W
            (KIP1)
          Length = 1129

 Score =  257 bits (656), Expect = 1e-70
 Identities = 180/565 (31%), Positives = 304/565 (53%), Gaps = 14/565 (2%)
 Frame = +1

Query: 841  TIQSDQTA----GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            ++++D+T+     I+++ ++E +I +A+EG+KLL  G   R+VA+TK ND SSRSHTIFT
Sbjct: 238  SLKTDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFT 297

Query: 1009 ITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 1173
            IT        + GE + ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVI
Sbjct: 298  ITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVI 357

Query: 1174 NSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 1353
            N+L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET STLEYA++AK+I
Sbjct: 358  NALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSI 417

Query: 1354 KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEI 1533
            KN PQ+   + K+  +     E+ +++ +L ++ SK+GIY+ Q+ ++             
Sbjct: 418  KNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE------------- 464

Query: 1534 QECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELD 1713
                 T ES    N++L+++          Q+ KI  + E +++L  K   Q  +  E D
Sbjct: 465  -----TYES----NSILVEE----------QQAKIDNLQEQLRRLKEKFLEQTKLIKEKD 505

Query: 1714 GKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQ 1893
            G+I+     N    K +++ K+    +N     L D+  + +              GI+ 
Sbjct: 506  GQIKELDVAN---RKYLEQSKDLTIYINGIHSKLEDYEHTMI--------------GIHN 548

Query: 1894 NFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITK--FLSDTPLLFDEINDNVLNLKAL 2067
            N     N++        LL    DN    +++ + K   +    L+      ++++++ +
Sbjct: 549  N-----NMK--------LLEDINDNRGNIHEDLLAKVDHIETCNLIISREITSLISIRNV 595

Query: 2068 TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDV 2247
               Y  +    L  + EE       + ++     +  +   L+  ++      E  ++ +
Sbjct: 596  LQAYSDRFKTVLGGVFEE-------LQEKLTQVGRTTEESQLDVDLSFVDEKFEEVTDII 648

Query: 2248 MSTIQNL---LNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDA 2418
             +T +NL   ++EH+ +N +L    L++    L+  E   L  KL K+ ES +     ++
Sbjct: 649  KATCENLVRTMDEHV-SNMKLETTDLTSSCASLLEKECQALHGKLQKYVESMK--QELNS 705

Query: 2419 LNNEFNDNVESSMTTMTDKIKQTND 2493
               E   +++   ++M + ++ T D
Sbjct: 706  TLQEMVRDLDMKASSMLNVVQCTKD 730

 Score =  148 bits (374), Expect = 1e-35
 Identities = 85/202 (42%), Positives = 121/202 (59%), Gaps = 16/202 (7%)
 Frame = +1

Query: 19  SSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQM 198
           SS +   E E NI V VRCR RN+REI  KSSVV++     G + +  N           
Sbjct: 43  SSQQSEGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNPGTG------- 95

Query: 199 NSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 378
           ++KTYT D+VFG  + Q  +F+++A    ++ I+GYNCT+  YG T TGKTYTM+GD  +
Sbjct: 96  SNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITM 155

Query: 379 YNEE--------LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL--HG 528
                       LS+ AGIIPR+L +LF  L +++ED+ VK SF+ELYNE+L+DLL    
Sbjct: 156 MGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDK 215

Query: 529 DCNNDNGNF------KKLRIFD 576
           D + ++ NF      + +RI+D
Sbjct: 216 DVSLEDHNFNGMAPPESIRIYD 237

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
            Anc_7.387
          Length = 1186

 Score =  257 bits (656), Expect = 2e-70
 Identities = 190/590 (32%), Positives = 307/590 (52%), Gaps = 34/590 (5%)
 Frame = +1

Query: 814  FSPADNDKSTIQ-----SDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMND 978
            F+  ++++ TI+     ++ ++ I ++ ++E +I +A EG++LL  G   R+VASTK ND
Sbjct: 266  FAQNESEEETIRIFDNNNNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCND 325

Query: 979  FSSRSHTIFTI----TLFKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSIN 1143
             SSRSHT+FTI    T    + GE + +  K+NLVDLAGSENINRSGA N+RA+EAG IN
Sbjct: 326  LSSRSHTVFTIATNITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLIN 385

Query: 1144 QSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCST 1323
            +SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET ST
Sbjct: 386  KSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVST 445

Query: 1324 LEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELT 1503
            LEYA +AK+IKN PQ+   + KD  +    +E+ +++ +L +++ KDGI + Q       
Sbjct: 446  LEYAIRAKSIKNTPQINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQL---- 501

Query: 1504 TDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIE 1683
                               L   N +L+ +++T          KI  M E ++K   K  
Sbjct: 502  ------------------DLYESNGILVDEQKT----------KIHNMEEQIQKFKEKYV 533

Query: 1684 RQQSIENELDGKI----QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL 1851
            RQ  +   L+  +    Q+  +  S+  +++D ++N +   NS  + +L    S ++   
Sbjct: 534  RQTELNKNLESNLKENEQVTKQLRSEKYQLMDLLENYQINSNSFVQRVLQIHESNIALIQ 593

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARD---NFEKFYQECITKFLSDTPL 2022
            N   E  +   I+ N T   N      E  N LS  RD     +   Q     F      
Sbjct: 594  NLDKERNR---IHHNSTQYMNNM---EETFNQLSIQRDELLRLKNSLQSYNINFNDVMQS 647

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
            +F+E+  NV+  +  TSN    I  +L    E   N +  +  +     + +  +  N +
Sbjct: 648  VFNELETNVVANQKETSNKLGSI--SLMKTFELLQNLELTLAKDLNLLNEPYLRD-TNHF 704

Query: 2203 INNTQTVIESSSNDVMSTIQNL----------LNEHLRANKELIINSLSNVTTEL----- 2337
            + + +T++E   N+V S  +++          LN +L ++ + + +     T +L     
Sbjct: 705  LISHKTILEECYNNVHSCTKSMEGLISTQLTDLNGYLSSSFKDLEDQTIEETEDLKQVII 764

Query: 2338 -MSNELDRLKPKLSKWEESAELINRS-DALNNEFNDNVESSMTTMTDKIK 2481
                ++  L+ +  K +ES   +N +  +L + F D+V    + +   IK
Sbjct: 765  SQQKKIQTLEHQFMKEKESTNSLNENLQSLKSYFQDHVSKERSNIFKDIK 814

 Score =  135 bits (339), Expect = 2e-31
 Identities = 79/194 (40%), Positives = 110/194 (56%), Gaps = 7/194 (3%)
 Frame = +1

Query: 16  VSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQ 195
           +SS   P     NI V VRCR R++REI  KSSVV++     G++ +  N S  + +   
Sbjct: 98  LSSSSSPSST--NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYP-- 153

Query: 196 MNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 375
              K+Y+ D+VFG  + Q  +F++ A+   S+ + GYNCT+  YG T TGKTYTM+GD  
Sbjct: 154 --KKSYSFDRVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLN 211

Query: 376 LYNE-------ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDC 534
           +           L + AGIIPR+L  LF+ L  L  D+ VK SF+ELYNE LKDL     
Sbjct: 212 ILGNLESKDMILLGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLF---- 266

Query: 535 NNDNGNFKKLRIFD 576
             +    + +RIFD
Sbjct: 267 AQNESEEETIRIFD 280

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 99/455 (21%), Positives = 197/455 (43%), Gaps = 32/455 (7%)
 Frame = +1

Query: 1165 RVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYA-SK 1341
            R+ NSL   N++       +   L+ ++  N K       S + +   E    LE   +K
Sbjct: 629  RLKNSLQSYNINFNDVMQSVFNELETNVVANQKETSNKLGSISLMKTFELLQNLELTLAK 688

Query: 1342 AKNIKNKPQL---GSFIM--KDILLK--NITTELTKIKSDLLSTKSKDGIYMDQQHYKEL 1500
              N+ N+P L     F++  K IL +  N     TK    L+ST+  D        +K+L
Sbjct: 689  DLNLLNEPYLRDTNHFLISHKTILEECYNNVHSCTKSMEGLISTQLTDLNGYLSSSFKDL 748

Query: 1501 TT----DLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE-LQRIKIQTMNESMKK 1665
                  + ++ K  I   ++ I++L  Q    +K+K + N  NE LQ +K    +   K+
Sbjct: 749  EDQTIEETEDLKQVIISQQKKIQTLEHQ---FMKEKESTNSLNENLQSLKSYFQDHVSKE 805

Query: 1666 ---LYAKIER--QQSIENELDGKIQIFTKTNSKLTKIIDEMKNRE-----ALVNSKFKTL 1815
               ++  I+    Q+ + + D  + I  ++ + LT+    ++ R+     +L+     +L
Sbjct: 806  RSNIFKDIKNIINQAEKKQTDLDVDILQRSENVLTQFNKGLQERQDKQMSSLLMETIASL 865

Query: 1816 LDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARD--NFE--KFY 1983
            L  S++  ++KL + ++   D+      T  + + + KS    +++T +D  N E     
Sbjct: 866  L--SINEHTEKLPFTLKESFDRNKTSLETRVKEIPIQKS-FNEIITTVKDRTNIEVSNNL 922

Query: 1984 QECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYN 2163
            ++ ITKF +       E+   + + +    N +    + L D   E N F +   +   +
Sbjct: 923  EKLITKFNT-------ELTSGLTSKQISIQNAF----KTLHDTITEENQFNENNLESIKS 971

Query: 2164 QEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSN--VTTEL 2337
            +     H +LN Y +NT  + +S S+ ++    ++ +     N+ +   S  N  +    
Sbjct: 972  KLSELYHYILNDYKDNTLQISKSQSDIIIDHCSSVESVMASINEPIQQYSQPNYPILKLE 1031

Query: 2338 MSNELDRLKPKLSK---WEESAELINRSDALNNEF 2433
            ++NE+    PKLSK   +    E+ N S + ++EF
Sbjct: 1032 VNNEIIDELPKLSKPKNFHIYTEMKNSSSSSSSEF 1066

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
            YBL063W
          Length = 1105

 Score =  240 bits (613), Expect = 4e-65
 Identities = 178/573 (31%), Positives = 305/573 (53%), Gaps = 50/573 (8%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            +++  S  ++ I ++ ++EF+I +A EG++LL  G   R+VA+TK ND SSRSHT+FTIT
Sbjct: 237  RTSSASSSSSSIMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTIT 296

Query: 1015 L----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINS 1179
                    V  E + ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+
Sbjct: 297  TNVARTDPVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINA 356

Query: 1180 LADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
            L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK++++ET STLEYA++AK+IKN
Sbjct: 357  LVDNSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKN 416

Query: 1360 KPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY----------KELTTD 1509
             PQ+   + K+  L     E+ +++ +L +++ K+G+Y+ +  +          +E    
Sbjct: 417  TPQVNQSMSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSILVEEQKVR 476

Query: 1510 LQNYKTEIQECK----------RTIESLTSQNALLLK----DKRTINENNELQRIKIQTM 1647
            +QN + +I + K          +  E    Q+ LL K    +K  ++EN +  R      
Sbjct: 477  IQNMEDQILKFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMSENFQSFRQTCTEY 536

Query: 1648 NESMKKLY-AKIERQQSIENELD---GK-IQIFTKTNSKLTKIIDEMKNREALVNS--KF 1806
             +S++ ++ + +E  +S+++E D   GK ++     +S +   I + KN   L +S   +
Sbjct: 537  VDSVEDIHRSNLELIRSLKDERDDLFGKSVESGNMISSLIADNIRQGKNLSKLNSSLQAY 596

Query: 1807 KTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQ 1986
             +  D   + V +++   +   K+  + Q  ++      + + MTN+ S       K + 
Sbjct: 597  SSKYDQVSAGVFEEMESNVIFHKNAIVGQLSSIS-----LDTFMTNIRS-MHSALIKVFS 650

Query: 1987 ECITKFLSDTPLLF-------DEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFI 2145
            E  T    +  ++F       ++    V +   +  + +S +   L   SE   +    +
Sbjct: 651  ELQTYRFDEKGIIFSAHRSILNQCYRRVCHFMTMLDSSFSGLVHGLRQASELSLDEVDKL 710

Query: 2146 TD-------EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 2304
             D       E    +K H  ++ NK    +Q  +E S+  ++S +Q    E++   +  I
Sbjct: 711  GDSYSGRACEVIEAQKRHIEDMENKLCRKSQ-ALEKSNAHILS-LQEYFAENIMKQRSKI 768

Query: 2305 INSLSNVTTELMSNELDRLKPKLSKWEESAELI 2403
             + L         ++L   +  L K  ++ +++
Sbjct: 769  FDDLKKAVETAEGHQLSLEEDVLKKSIDTLQIV 801

 Score =  143 bits (360), Expect = 6e-34
 Identities = 78/192 (40%), Positives = 116/192 (60%), Gaps = 7/192 (3%)
 Frame = +1

Query: 22  SDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMN 201
           S++Q      N+ V VRCR RN++EI+ KSSVV++     G + +  N +  +  +    
Sbjct: 31  SEQQEGRVSSNMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLSHS---- 86

Query: 202 SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 381
            +TYT D+VFG  + Q  +FDE+A+   S+ ++GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 87  KRTYTFDQVFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL 146

Query: 382 NE-------ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 540
            +        L + +GIIPR+L  LF+ L +   ++ VK SF+ELYNE+LKDLL  +   
Sbjct: 147 GDLDSQDKILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL-AESEQ 205

Query: 541 DNGNFKKLRIFD 576
           +  N   +RIFD
Sbjct: 206 EEEN---IRIFD 214

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
            YBL063W
          Length = 1142

 Score =  234 bits (596), Expect = 7e-63
 Identities = 224/777 (28%), Positives = 359/777 (46%), Gaps = 80/777 (10%)
 Frame = +1

Query: 787  SGNNDSANKFSPADNDKSTIQSDQT-AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
            +  + SAN  S + N K     D + + I ++ +QE  I  A EG+ LL KG   R+V S
Sbjct: 180  NSGSSSANDPSVSSNIKIFDNKDSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKS 239

Query: 964  TKMNDFSSRSHTIFTIT-----LFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKE 1128
            TK+ND SSRSHTIFTIT     L  +   E  ++ K+NLVDLAGSENI +SG   +R++E
Sbjct: 240  TKLNDLSSRSHTIFTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KRSQE 297

Query: 1129 AGSINQSLLTLGRVINSLADK------------------------NVHVPFRESKLTRLL 1236
             G IN+SLLTLGRVIN+L+DK                        + H+P+RESKLTRLL
Sbjct: 298  TGLINKSLLTLGRVINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLL 357

Query: 1237 QDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITT 1416
            QDSLGG TKT +IATISPAK  L+ET STLEYA++A +IKN P++         + +   
Sbjct: 358  QDSLGGMTKTCIIATISPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYIN 417

Query: 1417 ELTKIKSDLLSTKSKDG---IYMDQQHY--------KELTTDLQNYKTEIQECKRT-IES 1560
            ++ ++K +L ++  K G   I +++ +Y        +E    + N   +I + K+  +E 
Sbjct: 418  QIDRLKLELQTSTDKIGGIFIPLEKLNYYKSNEILIEEQNAKINNMTNQIAKFKKKFVEQ 477

Query: 1561 LTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKT 1740
            +     L    K++  E N+L  IK       +K +   +  +Q+I   L+  I+ F + 
Sbjct: 478  IQINKQLNTDMKKSQWEKNQLLTIK-------LKLIILIVNFKQNIFQYLN-NIENFDQN 529

Query: 1741 NSKLTKIIDEMKNREALVNSK---FKTLLDHSLSYVSKKLN-YQIENFKDQGINQNFTVD 1908
             + + K +++ KN  +L ++    F   +    + +S K N  QI+N   +  N   +V 
Sbjct: 530  KNNIIKNLNDEKN--SLFDNSIEIFNQFISIHSNLISNKENLLQIDNSLIKFNNNFKSVS 587

Query: 1909 ENL--QLIKSEMT-------NLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNV-LNL 2058
            ++L  +LIK  +T       ++L+    NF          + S +   FD +  N  +NL
Sbjct: 588  KSLFDELIKMLITFSSTTKDSILNIQISNFNDIIDNFQKNYYSISHDHFDNVKSNFQINL 647

Query: 2059 KALTSNYYSQIAENLSDL----SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVI 2226
              L  +    + +  S L    S    N K +  ++ +N+     +E++NK +NN  +  
Sbjct: 648  SNLDQSLKKYLIDQSSKLNKIISMNITNLKSY-NEKIFNKIVMDSNEIINKSLNNFNSEK 706

Query: 2227 ESSSNDVMSTIQNLLNEHLRANKEL-----IINSLSNVTTELMSNE----LDRLKPKLSK 2379
             S   + +  I+NL    L  N EL     IIN+L++     +S++    ++ LK  L  
Sbjct: 707  NSIIENQLIEIKNLKEIILSKNDELINSKIIINNLTSFIKNEISSKRNQLINHLKDSLDD 766

Query: 2380 WEESAELINRSDALNNEFNDNVESS---MTTMTDKIKQTNDSXXXXXXXXXEHFKTNDIA 2550
            ++   EL++ S  L N      +S       + D I    +S          HF   +I 
Sbjct: 767  FQRQNELLDDS-ILENSIQSITKSQTIYQDHLMDSIDNLYNSNINSIDRLDNHFDDQNI- 824

Query: 2551 HXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDID 2730
                                                      K LN +D+    V+K+ D
Sbjct: 825  --------------------------------------QLRKKILNHIDSMESLVIKNFD 846

Query: 2731 YEKDIKETNSPLKPSHKHDYNH------TIPLD--NDKKRSFLNNANDNEMQNQSKI 2877
            Y + IK T    +      +N+      T+ LD  N+ K S   N +D +++   K+
Sbjct: 847  YNEFIKPTRDLYEELDHSKFNNNFNSISTMLLDNINNTKNSMDQNIDDLKLKINEKV 903

 Score =  130 bits (328), Expect = 4e-30
 Identities = 82/200 (41%), Positives = 106/200 (53%), Gaps = 25/200 (12%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V VRCR RNQ+EID KSSVVV+     G++ +  N++         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY-------NEE 390
           G  + Q  IF+ +A     + I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--------HIVKCSFVELYNEELKDLLHGDCN--- 537
           L + AGIIPR+L +LF +LE    +        + VK SF+ELYNE LKDLL  D +   
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLPP 179

Query: 538 -------NDNGNFKKLRIFD 576
                  ND      ++IFD
Sbjct: 180 NSGSSSANDPSVSSNIKIFD 199

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa] {ON}
            weakly similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079W SMY1 not believed to act as a kinesin,
            colocalizes with Myo2p; kinesin heavy chain homolog
          Length = 649

 Score =  145 bits (365), Expect = 3e-35
 Identities = 118/384 (30%), Positives = 187/384 (48%), Gaps = 21/384 (5%)
 Frame = +1

Query: 820  PADNDKS-TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSH 996
            PAD   S ++   + +GIY++ L   ++T+ +E +  +++G   R V+ST MN  SSRSH
Sbjct: 180  PADKRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSH 239

Query: 997  TIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 1173
            +I  I L K     E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VI
Sbjct: 240  SIVRINLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVI 299

Query: 1174 NSLAD-------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
            N+L          + H+P+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL +
Sbjct: 300  NALTQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRF 359

Query: 1333 ASKAKNIK-----NKPQLGSFIMKDILLKNITT-------ELTKIKSDLLSTKSKDGIYM 1476
             S+AK IK     NK  L S  + +  L+ + +        ++ ++ +LL +K+++ I  
Sbjct: 360  GSRAKKIKNFAILNKNNLSSRNLLEQQLEELKSRETGYLLRISTLEKELLESKAQNDIED 419

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 1656
              Q     T DL     +++    ++  L S +     D  +I+ ++ +Q +    MN  
Sbjct: 420  PSQKPLPPTPDLLEENKKLKSQVESLAGLISHSNSGATDDPSISYDDLIQNL----MN-- 473

Query: 1657 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 1836
                  + E    I+  LD ++++  K    L    + M            TL D S   
Sbjct: 474  ------RCENVVEIQASLDEQVELNKKFQQSLASTTERM-----------YTLEDRSQRL 516

Query: 1837 VSKKLNYQIENFKDQGINQNFTVD 1908
            + +    QIEN      N +   D
Sbjct: 517  LYQLQETQIENQDLMNTNNSLARD 540

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 42/115 (36%), Positives = 69/115 (60%), Gaps = 3/115 (2%)
 Frame = +1

Query: 187 TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 366
           + Q N + +T D+VF   +TQ  +++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 367 DEKLYNEELSDSAGIIPRILFKLFETLEKLN-EDHI--VKCSFVELYNEELKDLL 522
            +        ++ G+IPRI   +F+ +E  + ED I  V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 504

 Score =  142 bits (357), Expect = 7e-35
 Identities = 98/272 (36%), Positives = 153/272 (56%), Gaps = 7/272 (2%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            N+        D  K  ++       +++ L EF +   +E ++ +++G + R V  T MN
Sbjct: 173  NEQVRDLLSEDGSKCRVRERADKTTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMN 232

Query: 976  DFSSRSHTIFTITLFKE---VKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSIN 1143
            + SSRSH IFTI++ +    + G++  R S + LVDLAGSE ++ +GA   R KE  +IN
Sbjct: 233  NSSSRSHAIFTISIKQSETTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNIN 292

Query: 1144 QSLLTLGRVINSLADKN--VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            +SL TLGRV++ LA KN    +P+R+S LT +L+++LGGN+KT +IA +SP     EET 
Sbjct: 293  KSLTTLGRVVSVLAKKNRPKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETI 350

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            STL YA+ AK +KN  ++ S            +E  K K  L++ +++      ++  KE
Sbjct: 351  STLRYATTAKEVKNTARVNS------------SESLKNKEQLVTMRNQ-----LEELQKE 393

Query: 1498 LTTDLQNYKTEIQECKR-TIESLTSQNALLLK 1590
            L+  LQ+ K + QE  R  I  +   NA L K
Sbjct: 394  LS--LQSVKLQNQELLREQINKIKCTNAYLEK 423

 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 62/181 (34%), Positives = 86/181 (47%), Gaps = 21/181 (11%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI VAVR R    RE        VT P     ++  I+TS  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 232 ----GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE---KLYNEE 390
                 S  Q +I+D I        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 391 ------LSDSA-GIIPRILFKLFETLEKLN--EDHI-----VKCSFVELYNEELKDLLHG 528
                 + DSA GIIPR+   LF+     N  ED I     + CS++E+YNE+++DLL  
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 529 D 531
           D
Sbjct: 183 D 183

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation;
            functionally redundant with Cin8p
          Length = 456

 Score =  138 bits (347), Expect = 6e-34
 Identities = 104/326 (31%), Positives = 170/326 (52%), Gaps = 11/326 (3%)
 Frame = +1

Query: 829  NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            NDK T         ++Q++  F +   +E ++ L  G   R VAST+MN  SSRSH IFT
Sbjct: 144  NDKKT---------FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFT 194

Query: 1009 ITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINSL 1182
            +++ ++      R S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ L
Sbjct: 195  LSIKQQEPDGSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQL 254

Query: 1183 ADKNVH-VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
            A  + H +P+R+S LT +L+++LGGN+KT +IA ISP  + LEE+ STL YA+ AK IK 
Sbjct: 255  AKNSKHLIPYRDSLLTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKL 312

Query: 1360 KPQLGSFI------MKDIL--LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQ 1515
            +  +   +      MK  +    +   EL  +KS++ S +S+  I  +Q    E      
Sbjct: 313  RATMNEIVPNINEDMKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRF 372

Query: 1516 NYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQS 1695
            N+ T++       + L +Q    +   +++   N+L R+++  +  ++  +   +     
Sbjct: 373  NHITKLN------DYLENQLTNEITKSQSLQNENKLSRLEMSNVQTALLGVVGAL----F 422

Query: 1696 IENELDGKIQIFTKTNSKLTKIIDEM 1773
              N  D KI   TK  S     +  +
Sbjct: 423  SNNNHDTKIMEATKLVSDFDDFVSRL 448

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 58/187 (31%), Positives = 86/187 (45%), Gaps = 4/187 (2%)
 Frame = +1

Query: 187 TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 366
           T +   +++  D +F  S++Q+ I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 367 DEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGDCNN 540
                    + + GIIP +   LF+ LE L++  +  V  ++ E+YNE+L DLL GD + 
Sbjct: 89  --------TNSNPGIIPLLCRDLFDALE-LDKTTVSSVSITYFEIYNEKLIDLL-GDTSP 138

Query: 541 --DNGNFKKLRIFDXXXXXXXXXXXXXXXXXXXXXTTFLKKKLRNEALLRSRNIASSKRS 714
                N KK  + D                     TTF  K  R E +L   +I  SKRS
Sbjct: 139 RVRETNDKKTFVQD--------------------ITTF--KVNRVEEVLEYLSIGDSKRS 176

Query: 715 SMQTIRN 735
              T  N
Sbjct: 177 VASTRMN 183

>Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {OFF}
            [contig 185] FULL
          Length = 108

 Score =  127 bits (318), Expect = 1e-33
 Identities = 64/108 (59%), Positives = 78/108 (72%)
 Frame = -2

Query: 1469 IPSLLFVDNKSDFIFVNSVVIFFKRISFIINEPNCGLFLIFFAFEAYSKVLQVSSKVTFA 1290
            +PS  FV+++SDFI  +S V    + SFII  P CGLFLIF AF AYS VL+VSS+   A
Sbjct: 1    MPSFDFVESRSDFILTSSAVTLLSKTSFIIKLPTCGLFLIFLAFVAYSSVLEVSSEFILA 60

Query: 1289 GDIVAMRAVFVFPPRESCNNLVNFDSLKGT*TFLSAREFMTLPNVNKL 1146
            G+IVA+ AV VFPP+ESC+NLVNFDS  G    LSA EF+TLP V +L
Sbjct: 61   GEIVAINAVLVFPPKESCSNLVNFDSRNGICKLLSASEFITLPKVKRL 108

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YKL079W
            (SMY1)
          Length = 635

 Score =  139 bits (350), Expect = 2e-33
 Identities = 114/390 (29%), Positives = 192/390 (49%), Gaps = 7/390 (1%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            N  S+ K +       T+    T G+Y++      ++   E +  +  G   R   ST M
Sbjct: 164  NKASSPKKNSDKRASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDM 223

Query: 973  NDFSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQ 1146
            N  SSRSH I  I L K   ++G I + S + LVDLAGSE + ++ A+    +EA  IN 
Sbjct: 224  NLESSRSHAIVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINL 282

Query: 1147 SLLTLGRVINSLA--DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
            SL +LG VIN+L   +K  H+P+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +
Sbjct: 283  SLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLT 342

Query: 1321 TLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKEL 1500
            TL + S+AK+IKNK  +      D+ LK       K++  +   + K+            
Sbjct: 343  TLRFGSRAKHIKNKAIVNK---SDLFLKK------KLERKIAQLEKKE------------ 381

Query: 1501 TTDLQNYKTEIQECKRTIESL--TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 1674
                Q+YKT I+  +  ++ L  T+ +  L ++   + EN +L R ++ ++   +     
Sbjct: 382  ----QDYKTRIELLEHEVKELQATASHRPLPEEVDLLAENTKL-RAQVDSLKVLLNPRTD 436

Query: 1675 KIERQQSIE-NELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL 1851
             ++ +Q I  ++L  K+    +   +L   +D+  ++E  +  K  T L H+ + + +K 
Sbjct: 437  SLDTEQHISVDDLLTKLMEKCELVVELQSRLDDQADKEKAL-KKLMTDLKHTEAQLVEKN 495

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMT 1941
            +   E      ++     +EN+ L K   T
Sbjct: 496  HQLAEQLAIAQLDNLNLTNENMTLSKDIAT 525

 Score = 80.1 bits (196), Expect = 1e-14
 Identities = 54/161 (33%), Positives = 83/161 (51%), Gaps = 7/161 (4%)
 Frame = +1

Query: 100 DAKSSVVVTVPDIMGSKEVAINTSED--IGFT-AQMNSKTYTVDKVFGPSATQSLIFDEI 270
           D K  VVV +  +      A+  +++  + F  A   ++ +  D VFG  A Q  +FD +
Sbjct: 20  DDKMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYV 79

Query: 271 AEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLE 450
           AE +   F  GYN T+L YG T +GK+YTM G             G+IPRI  ++FE + 
Sbjct: 80  AEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIG 131

Query: 451 KLNE----DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK 561
            L      +++V  SF+E+Y E++ DLL G+  N   + KK
Sbjct: 132 LLKNCADIEYVVSVSFLEIYLEKVYDLL-GESINKASSPKK 171

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W
          Length = 473

 Score =  136 bits (342), Expect = 4e-33
 Identities = 81/200 (40%), Positives = 125/200 (62%), Gaps = 6/200 (3%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            N++      A+  +   ++D+T   +++ LQEF + +  E +  L++G + + V +T +N
Sbjct: 146  NETVRDLLGANKCRIRERADKTT--FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVN 203

Query: 976  DFSSRSHTIFTITLFKEVKGEIF----RLSKMNLVDLAGSENINRSGALNQRAKEAGSIN 1143
            + SSRSHTIFTI + ++    +     R S + L+DLAGSE  N SGA  +R KE  +IN
Sbjct: 204  EQSSRSHTIFTINVEQKENSPLGHVLERRSSIRLIDLAGSERANASGATGERLKEGSNIN 263

Query: 1144 QSLLTLGRVINSLADKNVH--VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            +SL TLGRVI  LA K     +P+R++ LT +L++SLGGN+KT +IA +SP     EET 
Sbjct: 264  KSLSTLGRVIAMLAKKKQPRLIPYRDAALTWVLKESLGGNSKTCMIACVSPC--DFEETM 321

Query: 1318 STLEYASKAKNIKNKPQLGS 1377
            STL YA+ A+++K   QL +
Sbjct: 322  STLRYATLARSVKTFAQLNT 341

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 47/164 (28%), Positives = 79/164 (48%), Gaps = 7/164 (4%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI V+VR R   +RE  A+  +   V + +   E      E   F   +   TY+     
Sbjct: 4   NIKVSVRLRKPLERE-SAERVIAQVVSENLIKVEQRAKREETRNFEFDLCC-TYSESL-- 59

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGI 411
                Q+ +++++A       + GYN  +  YG T +GK++TMTG  +L         GI
Sbjct: 60  --EEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGI 109

Query: 412 IPRILFKLFETLE-------KLNEDHIVKCSFVELYNEELKDLL 522
           +PR+  +LFE  E       + +    ++CS++E+YNE ++DLL
Sbjct: 110 VPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
            Ashbya gossypii ADR145C
          Length = 662

 Score =  138 bits (347), Expect = 6e-33
 Identities = 109/377 (28%), Positives = 183/377 (48%), Gaps = 18/377 (4%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            N  ++ K +       TI    T G+Y+Q+     ++   E +  +  G   R  +ST M
Sbjct: 191  NKSASPKKTSEKRTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDM 250

Query: 973  NDFSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQ 1146
            N  SSRSH I  I L K   ++G I + S + LVDLAGSE ++++ A+    +EA  IN 
Sbjct: 251  NFESSRSHAIVKINLLKRDNLEGSIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINL 309

Query: 1147 SLLTLGRVINSLADKN---VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            SL +LG VIN+L  K+    H+P+R+S+LTRLL+DSLGGN+KT LI   +  K    ET 
Sbjct: 310  SLSSLGNVINALTQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETL 369

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ----- 1482
            +TL + S+AK I+NK  +      D+ LK       K++  +   + ++  Y ++     
Sbjct: 370  TTLRFGSRAKQIENKAIVN---RSDLFLKK------KLERQIALLEKREQEYQNRITLLE 420

Query: 1483 --------QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
                     + +  + D ++ +TE  + K  ++SL          K  ++    L+  + 
Sbjct: 421  HEVLALRANNIRAPSPDTEDIETENTKLKAQMDSL----------KSILSSGGSLEGEQH 470

Query: 1639 QTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 1818
             + ++ + KL  K E    ++  LD ++       + L +++D+++  EA V  K   L 
Sbjct: 471  ISTDDLLSKLMEKCELVVDLQARLDDQLD----KETALKRMMDDLRLLEAQVIEKNHDLA 526

Query: 1819 DHSLSYVSKKLNYQIEN 1869
            +         LN   EN
Sbjct: 527  EQLAILQLDNLNLTNEN 543

 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 55/174 (31%), Positives = 89/174 (51%), Gaps = 4/174 (2%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           N+ V VR +  +  E     +VV      +       +     G   +  S+++  D VF
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPNNDTSPGSTNGVQGESPSRSFHFDYVF 93

Query: 232 GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGI 411
           G ++TQ  ++D +AE +   F  GYN T+L YG T +GK+YTM G          D+ G+
Sbjct: 94  GTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------IDNRGL 145

Query: 412 IPRILFKLFETLEKLNE----DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK 561
           IPRI  ++FE +  L      +++V  SF+E+Y E++ DLL G+  N + + KK
Sbjct: 146 IPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL-GESINKSASPKK 198

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
            kinesin-related protein required for nuclear migration
          Length = 705

 Score =  135 bits (340), Expect = 6e-32
 Identities = 121/412 (29%), Positives = 199/412 (48%), Gaps = 26/412 (6%)
 Frame = +1

Query: 829  NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            + K  I+ D    I + NL +   TT +E + L+ +G   R  + T+ N+ SSRSH +  
Sbjct: 259  SQKLIIREDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQ 318

Query: 1009 ITLFKEVKG----EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            I + ++ +     E      ++++DLAGSE    +     R  E  +IN+SLL LG  IN
Sbjct: 319  IHIVQKNRTPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCIN 378

Query: 1177 SLADKN------VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 1338
            +L           HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA+
Sbjct: 379  ALCINGNDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYAN 438

Query: 1339 KAKNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY 1491
            +AK IK K           +GS++      K    EL   ++ ++  +        QQ  
Sbjct: 439  RAKEIKTKIIRNQQSLNRHVGSYLKMITEQKKEIEELRSRENKMIQFQLDKYKLSRQQIA 498

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES--MKK 1665
              +T  + N + +  +  +       ++ +L K +       E+++  IQ  + S  M  
Sbjct: 499  VAITDCVNNVRFQYTQVPKFQRIKLIKSLILCKRRFLQLVLLEMKKSPIQREDSSGAMAS 558

Query: 1666 LYAKIERQ-QSIENELDGKIQIFTKTNSKLTKIIDEMKNRE-ALVNSKFKTL-LDHSLSY 1836
            L  +I+R+ + +EN+ D   ++ T   +  T  +D +K RE    + K  TL L+  L Y
Sbjct: 559  LEEQIKRKIKQLENKFDSPDELDTVITNART--VDLLKLREMENWDDKIDTLTLELELDY 616

Query: 1837 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTAR--DNFEKFYQ 1986
            VS++L   I     Q   + F  D  L  ++ ++  L+S  R  D F K +Q
Sbjct: 617  VSEQLRNDILITASQMTEKLFDEDSPLHKVELDVEGLISIDREFDEFGKQFQ 668

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 38/131 (29%), Positives = 65/131 (49%), Gaps = 2/131 (1%)
 Frame = +1

Query: 136 IMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCT 315
           +MGS   A    +     +  +   +  DK+F   ATQ  ++      L    + G+N T
Sbjct: 131 LMGSDATASRRFKRANGNSAGSEIKFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGT 190

Query: 316 MLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFV 489
           +  YG T  GKTYT++G          ++ GI+ + + +LF+ +E L +     +  SF+
Sbjct: 191 VFAYGATGCGKTYTVSG--------TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFL 242

Query: 490 ELYNEELKDLL 522
           E+YNE ++DLL
Sbjct: 243 EIYNERIRDLL 253

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
            YGL216W (KIP3) - kinesin-related protein involved in
            mitosis [contig 192] FULL
          Length = 479

 Score =  131 bits (330), Expect = 1e-31
 Identities = 75/183 (40%), Positives = 121/183 (66%), Gaps = 6/183 (3%)
 Frame = +1

Query: 847  QSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE 1026
            ++D+T   +++ L+EF +++ ++ +  +++G + R + ST +N++SSRSHTIFTI++ ++
Sbjct: 163  RADKTT--FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQK 220

Query: 1027 VKGE----IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKN 1194
             K      I R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA + 
Sbjct: 221  EKSALGHVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRK 280

Query: 1195 VH--VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQ 1368
                +P+R++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   Q
Sbjct: 281  QPKLIPYRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQ 338

Query: 1369 LGS 1377
            L +
Sbjct: 339  LNA 341

 Score = 67.8 bits (164), Expect = 7e-11
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 11/168 (6%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 231
           NI VAVR R   +RE+D   S++  V D         N  +      +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDG--------NVIQVKDRNQKNETRSFHFDQCF 53

Query: 232 GPS----ATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 399
             S    A Q  ++++++       + GY+  +  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 400 SAGIIPRILFKLFETLE-------KLNEDHIVKCSFVELYNEELKDLL 522
           S GI+ R+  +LFE  E       ++N    ++CS++E+YNE ++DLL
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
            YGL216W
          Length = 723

 Score =  132 bits (331), Expect = 8e-31
 Identities = 106/365 (29%), Positives = 182/365 (49%), Gaps = 17/365 (4%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D    I + NL      + ++ + L+ +G   R  + T+ N  SSRSH +  I 
Sbjct: 248  KLVIREDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIH 307

Query: 1015 LFKEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + +  K     E      ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L
Sbjct: 308  IMQRNKLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINAL 367

Query: 1183 AD-----KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
                   +N HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 368  CSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAK 427

Query: 1348 NIKNKPQLGSFIMKDILLKNITTELTKIKSDL-LSTKSKDGI-YMDQQHYKELTTDLQNY 1521
             IK K           +++N  T    + S L + T+ K  I  ++ +  + +   + NY
Sbjct: 428  EIKTK-----------VIRNHQTLNRHVASYLKMITEQKRTIDELEARQAQMVQVGITNY 476

Query: 1522 KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIE 1701
            K  I++ +R+IE +       L  K    +N +L +    T    ++ +  ++E   +I 
Sbjct: 477  KLAIEKIERSIEEVVGNVCKQLSSKSF--QNIKLLKALTLTKRTLLQLIVIEVENVLAIV 534

Query: 1702 NELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKT------LLDHSLSYVSKKLNYQI 1863
            +E   +  I T       ++I +M+ +  L+  +F T      +++HS     K+L  ++
Sbjct: 535  SEWTDQRIIET-----CERVIRQMQEQVKLLEDRFDTATELNLVVEHSREIDLKRLR-EM 588

Query: 1864 ENFKD 1878
            E++ D
Sbjct: 589  EHWDD 593

 Score = 62.0 bits (149), Expect = 6e-09
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 2/117 (1%)
 Frame = +1

Query: 187 TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 366
           T   +   +  DK+F    +Q  ++      L    + G+N T+  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 367 DEKLYNEELSDSAGIIPRILFKLFETLEKL--NEDHIVKCSFVELYNEELKDLLHGD 531
                     ++ GII R + +LF  ++ L   +D  +  SF+E+YNE + DLL  D
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLLSPD 243

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
            (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  128 bits (322), Expect = 2e-30
 Identities = 105/349 (30%), Positives = 170/349 (48%), Gaps = 20/349 (5%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  ++ ++   +YI+N+ E  ++   + IK ++ G + R   ST MN  SSRSH I +IT
Sbjct: 178  KYRVRENRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSIT 237

Query: 1015 LFK-----EVKGEIFRLSKMNLVDLAGSENINRS-GALNQRAKEAGSINQSLLTLGRVIN 1176
            + +          I   S    VDLAGSE    +    N R KE  SIN+SL TL RV+ 
Sbjct: 238  IKRTDIDLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLT 297

Query: 1177 SLADK--------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEET 1314
            SL  +              N+ VPFRES LT +L+D+LGGN+KT +IA ISP     EE+
Sbjct: 298  SLKKREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISP--TNFEES 355

Query: 1315 CSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 1494
             STL YA  A+ IK    + ++     LL N+  +L  ++ ++      + +  DQ    
Sbjct: 356  ASTLRYADIAQTIKTNSIINTY-SNTTLLDNLQKQLRIMEIEV------NKLQKDQNSSL 408

Query: 1495 ELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 1674
            EL   L N K E     + +E      A L  + R +  ++E+++ ++  +   +  +  
Sbjct: 409  ELQYILNNLKLE----NKFLEKNFINRANLSSEMRKLLIDSEIKKFQLMKV---ILAIEI 461

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
            K++  + I+ +L G+++     ++KL        N   L   KF+  +D
Sbjct: 462  KLKDPKKIDAKLIGRLEQLKLNDAKL-------YNNFVLNKDKFEATVD 503

 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 53/177 (29%), Positives = 75/177 (42%), Gaps = 14/177 (7%)
 Frame = +1

Query: 34  PQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTY 213
           P    + + VA R   R  R I      V+    I+ S      T+           K +
Sbjct: 2   PDRVSVYVRVAPRDESRRHRAI----CKVINTDSILLSSNPKRQTTFIRSSFENKEEKIF 57

Query: 214 TVDKVF----GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 381
             DK F    G   +QS  +         D + GYNC +L YG T +GKTYTM G+ K  
Sbjct: 58  KFDKCFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK-- 115

Query: 382 NEELSDSAGIIPRILFKLFETLEKL----------NEDHIVKCSFVELYNEELKDLL 522
               +D+ G+IPR    LF  +E +            ++ V CS  E+YNE++ DLL
Sbjct: 116 ----NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL 168

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] {ON}
            Anc_3.528 YGL216W
          Length = 801

 Score =  129 bits (325), Expect = 6e-30
 Identities = 122/435 (28%), Positives = 205/435 (47%), Gaps = 53/435 (12%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D    I + NL  +   T +E + L+ +G   R  +ST  N+ SSRSH +  I 
Sbjct: 215  KLVIREDANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIH 274

Query: 1015 LFKEVK--------GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 1170
            L ++ K         ++F  S ++++DLAGSE    +    +   E  +IN+SLL LG  
Sbjct: 275  LTQQNKLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNC 332

Query: 1171 INSL-------ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLE 1329
            IN+L       + + +H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+
Sbjct: 333  INALCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLK 392

Query: 1330 YASKAKNIKNK---PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKEL 1500
            YA++AK IK K    QL         LK IT +  +I++       K+ + +   H  ++
Sbjct: 393  YANRAKEIKTKIIRNQLSLNRHISSYLKMITQQKQEIEN-----LRKNQLTIINNHLSKI 447

Query: 1501 TTDLQNYKTEIQE----CKRTI------ESLTSQNALLLKDKR---------TINENNEL 1623
              DL+  + EI +     KR I      + +  + +L+L  +R          I +  + 
Sbjct: 448  EIDLKKIEFEIDQIISNLKRKILVNHRFKIIKFEKSLILCKRRFFSLILIELRILQEKQF 507

Query: 1624 QRIKIQTMNESMKKLYAKIERQQSIENELD---GKIQIFTKTNSKLTKIIDEMKNREALV 1794
            +   I  + E  +    ++E Q    + +D     I+       KL    DE K+ + L 
Sbjct: 508  EYEMINQIIEHFQYKINQLELQFDSNDYIDLVFNNIKTIDIKKLKLLNGWDEYKHEKMLF 567

Query: 1795 --------NSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSE----- 1935
                    + K + +++ SL      +N  I N      +     +E+L  I+SE     
Sbjct: 568  IRLDQLYDSIKNEIIMNSSLLIDKLIMNKSINNLTHILTHSKLMNEESLLGIESEGIETR 627

Query: 1936 MTNLLSTARDNFEKF 1980
            +TNL++ A  +FE+F
Sbjct: 628  ITNLINEAEHSFEEF 642

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+   ++TQ  +F    EPL    + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISG-------- 161

Query: 391 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 522
             ++ GII   L  LF  +E L +  +  +  S++E+YNE +KDLL
Sbjct: 162 TPENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLL 207

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 809

 Score =  129 bits (323), Expect = 1e-29
 Identities = 107/375 (28%), Positives = 180/375 (48%), Gaps = 26/375 (6%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D   GI + NL      T ++ + L+ +G   R  + T  N+ SSRSH +  I 
Sbjct: 241  KLVIREDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQIN 300

Query: 1015 LFKEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + ++ +     E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 301  VVQKNRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 360

Query: 1183 A----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
                     HVP+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK 
Sbjct: 361  CVSGRRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKE 420

Query: 1351 IKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELT 1503
            IK K           +GS+      LK IT +  +I+   L  +    + ++   YK   
Sbjct: 421  IKTKVIRNQHSLDRHVGSY------LKMITEQRQEIEE--LRCRESKMVALELNKYKLSR 472

Query: 1504 TDLQ-NYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAK- 1677
              LQ      I   K    ++     L  K    + +   LQ + I+  N  + KL A+ 
Sbjct: 473  EKLQIAIWDSINGVKNNYSNMEKLQLLKTKKSLMLCKRRFLQMVSIELSN--LMKLLAQD 530

Query: 1678 ---IERQQSIENELDGKIQIFTK---TNSKLTKIIDEMKNREALVNSKFKTLLDH-SLSY 1836
                E   ++ ++L  KI+   +   T+ +L   I+  K+ + +   + +T  D   L +
Sbjct: 531  TKIYENCMALYDQLINKIRDLEEKFDTSDELDMAIEHTKSVDLVKLQEMETWDDSVDLPW 590

Query: 1837 VSKKLNYQIENFKDQ 1881
                LN+  E+ +++
Sbjct: 591  FESHLNFLAESLRNE 605

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 2/121 (1%)
 Frame = +1

Query: 184 FTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMT 363
           +  +   + +  DK+F   ATQ+ +++    PL    + G+N T+  YG T  GKT+T++
Sbjct: 127 YMRRSGEQKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTIS 186

Query: 364 GDEKLYNEELSDSAGIIPRILFKLFETLEKLNED-HI-VKCSFVELYNEELKDLLHGDCN 537
           G          +  G+I   + +LF+ +E L +  H  +  S++E+YNE ++DLL  D +
Sbjct: 187 G--------TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLSPDIS 238

Query: 538 N 540
           +
Sbjct: 239 S 239

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
            Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  125 bits (314), Expect = 2e-29
 Identities = 90/266 (33%), Positives = 140/266 (52%), Gaps = 5/266 (1%)
 Frame = +1

Query: 871  YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL----FKEVKGE 1038
            YI+ L +  + + +E +K +++G   R VA T +N+ SSRSH I TI +           
Sbjct: 173  YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 1039 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV-HVPFRE 1215
            + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L++  V  VP+RE
Sbjct: 233  VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 1216 SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDI 1395
            S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L        
Sbjct: 293  SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLN------- 343

Query: 1396 LLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQN 1575
                 TT+++K +  L S          Q   KEL   L     E+++            
Sbjct: 344  -----TTQISKGEEQLFSL---------QNQLKELQATLTLQTAELED-----------Q 378

Query: 1576 ALLLKDKRTINENNELQRIKIQTMNE 1653
             +L +    INE N+  + +++T N+
Sbjct: 379  RVLQQQLDKINETNKYLQHRLETENK 404

 Score = 76.6 bits (187), Expect = 1e-13
 Identities = 54/172 (31%), Positives = 83/172 (48%), Gaps = 10/172 (5%)
 Frame = +1

Query: 52  NITVAVRCRGRNQREIDAKSSVV-VTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKV 228
           NI VA+R R +  RE    S +   T  +I   K+   N    +         T+  D+V
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKTSNEITLQKDNTANVITTV-------EHTFYFDQV 56

Query: 229 FGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAG 408
           F  S+ Q  I+ E+A       ++GY+  ++ YG T  GKTYTM G E+          G
Sbjct: 57  FDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPG 108

Query: 409 IIPRILFKLFETL-----EKLNEDHI----VKCSFVELYNEELKDLLHGDCN 537
           IIP +  +LF+ +     E  +ED +    V  S+ ++YNE++ D+L G CN
Sbjct: 109 IIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCN 160

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
            Anc_3.528
          Length = 868

 Score =  126 bits (316), Expect = 8e-29
 Identities = 119/419 (28%), Positives = 204/419 (48%), Gaps = 35/419 (8%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D+ + I + NL   +  + ++ I L+ +G   R  +ST+ N+ SSRSH +  I 
Sbjct: 296  KLIIREDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIH 355

Query: 1015 LFK-----EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINS 1179
            + +     ++  E    + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+
Sbjct: 356  IMQTNTKIDLTSE-HTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINA 414

Query: 1180 LA-------DKNV--HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
            L         +N+  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+Y
Sbjct: 415  LCIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKY 474

Query: 1333 ASKAKNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQ 1485
            A++AK IK K           +GS+      LK IT +  +I++  L T+    I ++  
Sbjct: 475  ANRAKEIKTKIIRNQQSLNRHVGSY------LKMITEQKREIEN--LRTREAQMIELNLN 526

Query: 1486 HYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK-----IQTMN 1650
             YK     L   K +I           S + ++    R I EN + +++K     I    
Sbjct: 527  RYK-----LSRKKIQI-----------SMDDVINNLNRNILENEKYKQVKNLKSLILCKR 570

Query: 1651 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKT------ 1812
              ++ +  ++    ++ +E DG   I     +  + +I ++ N+   +  KF T      
Sbjct: 571  RFLQMVSLELNNCLNVISE-DGGDTINLNCYNNCSTLIKQIGNKVQELELKFDTKDELDM 629

Query: 1813 LLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN-LLSTARDNFEKFYQ 1986
            ++DH  S    +L  ++EN+ D     NF  +  L+ I   + N +L +A    EK +Q
Sbjct: 630  IIDHCKSMDLNRLK-EMENWDDSRDLINF--ETRLEYISESIKNEILISASMMIEKLFQ 685

 Score = 69.3 bits (168), Expect = 4e-11
 Identities = 37/116 (31%), Positives = 64/116 (55%), Gaps = 2/116 (1%)
 Frame = +1

Query: 190 AQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 369
           A+ N   +  DK+F  +++Q  ++      L    + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 370 EKLYNEELSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGD 531
           +        ++ GII R++ +LFE +E L ++    +  S++E+YNE + DLL  D
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLLKPD 291

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] {ON}
            Anc_3.528 YGL216W
          Length = 733

 Score =  124 bits (312), Expect = 2e-28
 Identities = 118/455 (25%), Positives = 211/455 (46%), Gaps = 20/455 (4%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D    I + NL      T ++ + L+  G   R  ++T  N+ SSRSH +  I 
Sbjct: 234  KLVIREDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQIN 293

Query: 1015 LFKEVK-GEI---FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + +  +  EI      +K++++DLAGSE    +    +R +E  +IN+SLL LG  IN+L
Sbjct: 294  IVQSSRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINAL 353

Query: 1183 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
                   +  HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK
Sbjct: 354  CISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAK 413

Query: 1348 NIKNKPQLGSFIMKDILLKNITTELTKIKS-----DLLSTKSKDGIYMDQQHYKELTTDL 1512
             IK K        +  L ++I++ L  I+      D L  +    I +  + YK LT   
Sbjct: 414  EIKTKVVRN----QQSLDRHISSYLKMIEEQRQEIDELRKRETTMIDLRLKRYK-LTQ-- 466

Query: 1513 QNYKTEIQECKRTIESL-----TSQNALLLKDKRTINENNELQRIKIQTMNE-SMKKLYA 1674
            +  +  I +C  +++         QNA ++K    + +   LQ ++++  N  ++ + + 
Sbjct: 467  EKVQMAIDDCMNSLQDTYDRIPNYQNAKVVK-SLILCKRRFLQMVQLEVNNVIAIAQNWT 525

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN 1854
             IE   S     D           +LT  I E++ +    + + +  +DH+ +    +L 
Sbjct: 526  NIEIVNSCSLVAD-----------QLTNKIRELEIKFDSTHDELEQAIDHARTITLPRLR 574

Query: 1855 YQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDE 2034
             ++EN+ +   +  F         ++ +T +  + R+         + K L D  LL   
Sbjct: 575  -EMENWNETRDHPYF---------EARLTQIADSLRNEILVNGSTMVEKLLQDPTLL--- 621

Query: 2035 INDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQ 2139
                 L+   +         E+L+ + +E+  F Q
Sbjct: 622  SRTKFLSNSLVNDTSVQTAIEDLAHIDQEFEQFGQ 656

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +ATQ  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSG-------- 180

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDH--IVKCSFVELYNEELKDLL 522
             +  G+I   + +LF  +E+L +     +  S++E+YNE ++DLL
Sbjct: 181 TPERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
            Anc_3.528 YGL216W
          Length = 672

 Score =  124 bits (311), Expect = 2e-28
 Identities = 142/552 (25%), Positives = 239/552 (43%), Gaps = 16/552 (2%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ DQ + I + NL        ++ I L+ +G   R  + T+ N+ SSRSH++  I 
Sbjct: 200  KLIIREDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIH 259

Query: 1015 LFKEVK-----GEIFRL-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            + + +K     G   ++ S ++++DLAGSE    +     R  E  +IN+SLL LG  IN
Sbjct: 260  VKQVLKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCIN 319

Query: 1177 SLA--DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
            +L    K+ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK 
Sbjct: 320  ALCINKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKE 379

Query: 1351 IKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTE 1530
            IK K           +++N T+                           L   + +Y   
Sbjct: 380  IKTK-----------VIRNQTS---------------------------LNRHVGSYLKL 401

Query: 1531 IQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENEL 1710
            I E K+ I+ L ++              +++  ++I   N ++KK+   I     I N L
Sbjct: 402  ITEQKQEIDKLKAR-------------EDKIVNMEISKYNLTVKKIEMSI---SDIGNNL 445

Query: 1711 DGKIQIFTKTNSKLTKIIDEMKNREALVNS-KFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
            +                       + L NS  FKT+   SL  V ++    IE   D  I
Sbjct: 446  N-----------------------KVLANSGNFKTM--KSLMLVKRRFLQLIEIEIDDII 480

Query: 1888 NQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLS----DTPLLFDEIN-DNVL 2052
            N ++T  E  Q IK ++ N +      F+    E  T F +    D P L +  N D  +
Sbjct: 481  NWDYTTSEYFQEIKQKIQNDIKQLEIKFDS-NDEIDTIFQNSESIDLPRLRESENWDEAM 539

Query: 2053 NLKALTS--NYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVI 2226
            +L       NY +++  N   ++      K    D      K H   +  +   N  T++
Sbjct: 540  HLPRFQDKLNYLNELTRNEILINSSMIMEKLLTNDTMTRFFKFHASLITQE--KNVDTIL 597

Query: 2227 ESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELIN 2406
            +  ++ V  T     N  +  +      S++  T  + +  L    PK  K   S +++N
Sbjct: 598  QELAS-VDETFDEFANIFMTQDNNTRRFSMTPPTPTVTAAILATAAPK-KKLRWSDDIVN 655

Query: 2407 RSDALNNEFNDN 2442
             S A++ + + N
Sbjct: 656  DSSAMDIDVSQN 667

 Score = 72.4 bits (176), Expect = 3e-12
 Identities = 40/123 (32%), Positives = 65/123 (52%), Gaps = 5/123 (4%)
 Frame = +1

Query: 169 SEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGK 348
           ++ + F  + +   +  DK+F   +TQ  IF++   PL    + G+N T+  YG T  GK
Sbjct: 78  NKHVKFNKKRSETKFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGK 137

Query: 349 TYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDH-----IVKCSFVELYNEELK 513
           TYT+ G         S+  GII R + +LF  +E L +D       +  S++E+YNE ++
Sbjct: 138 TYTING--------TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIR 189

Query: 514 DLL 522
           DLL
Sbjct: 190 DLL 192

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1
          Length = 478

 Score =  122 bits (305), Expect = 2e-28
 Identities = 101/335 (30%), Positives = 157/335 (46%), Gaps = 12/335 (3%)
 Frame = +1

Query: 781  FSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVA 960
            F   N    +  S     K  I+       +++ L+E  +   +E I  + KG + R V 
Sbjct: 149  FEIYNEQVIDLLSSLSQRKCKIRERHDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVR 208

Query: 961  STKMNDFSSRSHTIFTITL-----FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAK 1125
            ST MN  SSRSH IF I++      K+    +   S   LVDLAGSE +  + A  +  +
Sbjct: 209  STNMNQESSRSHAIFHISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQ 268

Query: 1126 EAGSINQSLLTLGRVINSLAD----KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPA 1293
            E  SIN+SL  LGRVI+ LA+    ++  +P+RES LT +L+++LGGN+ T L+A +SP 
Sbjct: 269  EGTSINKSLSILGRVISLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPE 328

Query: 1294 KVTLEETCSTLEYASKAKNIKNKPQLGSF--IMKDILLKNITTELTKIKSDLLSTKSKDG 1467
                 E+ STL YAS  K +K    + S   I +   LK    EL K+ +D   T +   
Sbjct: 329  --NYYESLSTLRYASLTKKVKTNATINSMSHIEQMEELKAKLRELQKMINDKKPTSA--- 383

Query: 1468 IYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTM 1647
                Q   +    D+Q     +++       L  Q+    + +R +  +  LQ I+    
Sbjct: 384  ---HQHTLERRMEDIQRANFFLEQRMAKESQLADQSLQTARYERDLLASMVLQMIESFNW 440

Query: 1648 NESMKKLYAKI-ERQQSIENELDGKIQIFTKTNSK 1749
            N+ +    A++ ER Q ++N        F  T  K
Sbjct: 441  NQPLNDQAAELWERSQKLQNSFQKDRSFFDVTLQK 475

 Score = 68.6 bits (166), Expect = 4e-11
 Identities = 40/120 (33%), Positives = 63/120 (52%), Gaps = 13/120 (10%)
 Frame = +1

Query: 202 SKTYTVDKVFGPSAT----QSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 369
           +K +  D  FG + +    QS+I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 370 EKLYNEELSDSAGIIPRILFKLFETLEKLNE---------DHIVKCSFVELYNEELKDLL 522
           +         + GI+PR   +LFE     ++         D  VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  124 bits (312), Expect = 2e-28
 Identities = 118/464 (25%), Positives = 211/464 (45%), Gaps = 57/464 (12%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D  + I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH +  I + +
Sbjct: 261  IREDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQ 320

Query: 1024 EVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 1185
              K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L   
Sbjct: 321  TNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLN 380

Query: 1186 --DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
               ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 381  DGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKT 440

Query: 1360 K---------PQLGSFI------------MKDILLKNITTELTKIK--SDLLSTKSKDGI 1470
            K           +GS++            +++   K I+ +LTK K   + +     + I
Sbjct: 441  KIIRNQQSLSRHVGSYLKMITEQKRQIEELREREEKMISLKLTKYKLNKEKIQLAINECI 500

Query: 1471 YMDQQHYKELTT-DLQNYKTEIQECKRTI------------------ESLTSQNALLLKD 1593
               QQ Y  + T  +      +  CKR                    E + ++  L++ +
Sbjct: 501  NRVQQTYSAVETYQISKILKSLILCKRRFLQMVRLEVDNLILLFEQEERVAAEMQLVINN 560

Query: 1594 KRTINEN--NELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTN-----SKL 1752
             R I+E   N++  ++++   +    L++ I++  SI+     +++ + +T         
Sbjct: 561  CRMISEQLFNKIHELEVKF--DESDALHSVIQQVHSIDLNKLREMEDWDETYDLVYLESC 618

Query: 1753 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 1932
               I E++  E LVNS          S +++KL        D G+N  F       + ++
Sbjct: 619  LNQISELQRNEILVNS----------SIMTEKL------MSDPGLNSRFKFLSKWLMDRT 662

Query: 1933 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKA 2064
                 +     + ++ ++     FL++    F   N N++N  A
Sbjct: 663  PDIESIIQDLVHIDEEFELFAKNFLANPGSTFTNTNINIINTTA 706

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +++QS ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 522
                GII   + +LF  +  L ++    +  S++E+YNE ++DLL
Sbjct: 205 TPSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13554)
            [2421 nt, 807 aa]
          Length = 806

 Score =  124 bits (310), Expect = 4e-28
 Identities = 129/489 (26%), Positives = 219/489 (44%), Gaps = 34/489 (6%)
 Frame = +1

Query: 778  MFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQV 957
            +++    D  N  +P+   K  I+ D  + I + NL      T ++ + L+ KG   R  
Sbjct: 234  IYNESIRDLLNPDTPSK--KLVIREDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTT 291

Query: 958  ASTKMNDFSSRSHTIFTITLFKE------VKGEIFRLSKMNLVDLAGSENINRSGALNQR 1119
            ++T  N+ SSRSH +  I + +           +F  + ++++DLAGSE    +    +R
Sbjct: 292  SATDANETSSRSHAVLQIHISQTNRTVDLTSSHVF--ATLSIIDLAGSERAASTKNRGER 349

Query: 1120 AKEAGSINQSLLTLGRVINSLA-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATI 1284
              E  +IN+SLL LG  IN+L       ++ HVP+R+SKLTRLL+ SLGGN KT +I  +
Sbjct: 350  LYEGANINKSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCV 409

Query: 1285 SPAKVTLEETCSTLEYASKAKNIKNK---------PQLGSFIMKDILLKNITTELTKIKS 1437
            SP+    +ET +TL+YA++AK IK K           +GS+      LK IT +  +I  
Sbjct: 410  SPSSTHYDETLNTLKYANRAKEIKTKVIRNQQSLNRHVGSY------LKMITEQKKEI-- 461

Query: 1438 DLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENN 1617
            D L  + ++ I +  + YK      +  +  + +C R I                  +N 
Sbjct: 462  DELRQREQNMIEIQLKKYK---LGREKIQLSMDDCLRNI------------------QNT 500

Query: 1618 ELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKT---------NSKLTKIIDE 1770
              Q  K Q        +  K    Q I  ELD  + +   T         N    +I+++
Sbjct: 501  YAQTSKFQNAKNIKSLILCKRRFLQMINLELDSVLYVVNSTQDMGVMETCNILKEQILNK 560

Query: 1771 MKNREALVNS--KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 1944
            ++  E   ++  +   +++HS    + KL+ ++E + D     NF         +S + N
Sbjct: 561  IRELEEQFDTPDELDLVIEHSKKNDAMKLS-EMEYWDDIIDRANF---------ESRLDN 610

Query: 1945 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVL-NLKALTSNYYSQ--IAENLSDLS 2115
            +    R+       E +      T  LF+  N+N++   K  +   Y Q  I E+L +L 
Sbjct: 611  INEVVRN-------EVLVNGSMLTEKLFE--NENLMYKCKFFSKCLYHQGDINESLQELL 661

Query: 2116 EEYNNFKQF 2142
            +    F+QF
Sbjct: 662  DIDKEFEQF 670

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F   ++Q  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISG-------- 197

Query: 391 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLLHGD 531
             +  GII   + +LF+ +E + +  +  +  S++E+YNE ++DLL+ D
Sbjct: 198 TPEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPD 246

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa] {ON}
            YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  124 bits (310), Expect = 4e-28
 Identities = 118/441 (26%), Positives = 214/441 (48%), Gaps = 59/441 (13%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  ++ D    I + NL    ++T ++ + L+ KG   R  ++T  N+ SSRSH +  + 
Sbjct: 230  KLVLREDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVH 289

Query: 1015 LFKEVKG----EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + +  +     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 290  ITQRNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 349

Query: 1183 ADKN-----VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
                      HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 350  CVSGRKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAK 409

Query: 1348 NIKNK---------PQLGSFI------------MKDILLKNITTELT--KIKSDLLSTKS 1458
             IK K           +GS++            +++   K I  E++  KI  + +    
Sbjct: 410  EIKTKIIRNQHSLDRHVGSYLKMITEQRQEIEELRERERKMIDLEISRYKISRERIHMAV 469

Query: 1459 KDGIYMDQQHYKELTTDLQNYKT--EIQECKRT-IESLTSQNALLLKDKRTINENNELQR 1629
             D ++  + +YK  +   Q+ K    +  CKR  ++ +  + A+LLK      + +    
Sbjct: 470  WDSVHSLRHNYKN-SEKFQHLKVIKSLMLCKRRFLQMVGVELAVLLKHITPDTDMHANCS 528

Query: 1630 IKIQTMNESMKKLYAKIERQQSIENELDGKIQI----------------FTKTNSKLTKI 1761
               + +N+ +K L    +    +E+ L+   ++                    +S L+ +
Sbjct: 529  TLHEQLNQKVKNLEQSFDSPDELESALEHTREVDMVKLQEMEGWRDDTDLPWYDSLLSWV 588

Query: 1762 IDEMKNREALVNSKF---KTLLDHS----LSYVSKKLNYQIENFKD-QGINQNFTVDENL 1917
             D ++N E LV S     + + DH+    L +VS+ L   + N  D +G + ++  +E  
Sbjct: 589  SDAVRN-EILVGSSVMMERLMEDHTLIERLKFVSQTLLSFVRNNDDPEGRSPDW--EELN 645

Query: 1918 QLIKSEMTNLLSTARDNFEKF 1980
            + + S++ +L+S   D F++F
Sbjct: 646  EHLHSQIRDLIS-IDDEFDRF 665

 Score = 62.0 bits (149), Expect = 6e-09
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D+VF   ++Q  +++    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 522
             ++ GII   + +LF  +E+L +     +  S++E+YNE ++DLL
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
            Anc_3.528 YGL216W
          Length = 847

 Score =  124 bits (310), Expect = 4e-28
 Identities = 150/582 (25%), Positives = 268/582 (46%), Gaps = 33/582 (5%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D    I + NL      T +E +  + +G   R  + T  N+ SSRSH +  I 
Sbjct: 233  KLVIREDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIH 292

Query: 1015 LFKE------VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            + +       +    F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN
Sbjct: 293  IAQTDRTPDLISNSTF--ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCIN 350

Query: 1177 SLA-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 1341
            +L       +  HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++
Sbjct: 351  ALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANR 410

Query: 1342 AKNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 1494
            AK+IK K           +GS+      LK IT +    K ++   + ++   +D  H K
Sbjct: 411  AKDIKTKIIRNQQSLNRHVGSY------LKMITEQ----KKEIQELRHRENNMID-LHLK 459

Query: 1495 ELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 1674
            +     +  +  I++C + I++   Q     ++ R I      +R  +Q +N  + ++  
Sbjct: 460  KYKLGREKVELAIEDCIQKIKNSLLQTP-KFQNTRIIKSLILCKRRLLQLVNLEISEVLE 518

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN 1854
             +E    +   +    +I  +  +K TK ++E  +  A    + + +++++ +   ++L+
Sbjct: 519  AVEDWTDV--AIVENCRIIQEQLNKKTKELEEQFDTPA----ELEIIIENAKTIEKQRLS 572

Query: 1855 YQIENFKDQGINQNFTVDEN--LQLIKSEMTNLLSTARDN-FEKFYQECITKFLSDTPLL 2025
             ++E +       NF +  N   +LI++++    S   ++ FE        KFLS     
Sbjct: 573  -EMEFWDPANDAYNFDIKLNYIAELIRNDILVKASMFTESLFENRKLISKFKFLS----- 626

Query: 2026 FDEINDNVLNLKALTSNY-YSQIAENLSDLSEEYNNF-KQFITDEFYNQEKGHQHE-LLN 2196
                       K L+S     +  ++L D+ +E++ F K+ ++ E  N       E  ++
Sbjct: 627  -----------KCLSSKQDIHECLKDLLDIDKEFDIFGKELMSYENSNITGFSDFENRIS 675

Query: 2197 KYINNTQTVIESSSNDVMS-TIQNLLNEHLRANKELIIN------SLSNVTTELMSNELD 2355
            K  + T+T I S +N+V    I NL N    ANK +  N      S+S    +L  N+  
Sbjct: 676  KANDYTKTSIVSEANNVPPVNITNLKNSPTVANKIVTHNNSETPPSISKFPNKLKYNKYS 735

Query: 2356 RLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIK 2481
                +  K   +A+ I++++   N  N N  S      +KIK
Sbjct: 736  SPLSEKKK-ITAAKRISKNE---NGGNSNSNSPSPKNINKIK 773

 Score = 63.2 bits (152), Expect = 3e-09
 Identities = 38/122 (31%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +A Q+ +++     L    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHIVK--CSFVELYNEELKDLLHGDCNNDNGNFKKL 564
             +  GII   + +LF+ +E L +   ++   S++E+YNE ++DLL     N N + KKL
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLL-----NPNVSSKKL 234

Query: 565 RI 570
            I
Sbjct: 235 VI 236

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
            Anc_3.528
          Length = 784

 Score =  122 bits (307), Expect = 8e-28
 Identities = 139/538 (25%), Positives = 240/538 (44%), Gaps = 28/538 (5%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D    I + NL   +  T +E I L+ KG   R  + T+ N+ SSRSH +  I + +
Sbjct: 259  IREDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQ 318

Query: 1024 -----EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA- 1185
                 ++  E    + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L  
Sbjct: 319  TNRTADLTSE-HTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCL 377

Query: 1186 -----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
                 +++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK 
Sbjct: 378  TDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 437

Query: 1351 IKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELT 1503
            IK K           +GS+      LK IT +  +I+   L  +    I +  + YK   
Sbjct: 438  IKTKIIRNQQSLNRHVGSY------LKMITEQKREIEE--LRERETKMIELQLRKYKISR 489

Query: 1504 TDLQNYKTE-IQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKI 1680
              +Q  + + IQ   ++  +L             + +   LQ +K++            I
Sbjct: 490  ERIQMAQDDCIQNIIKSYSTLPKYKMAKNMKSLMLCKRRFLQMVKLE------------I 537

Query: 1681 ERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK--FKTLLDHSLSYVSKKLN 1854
            E   S+         +F        +I+++++  E   +SK   + ++DH       +L 
Sbjct: 538  ENCISLIQNWTDHYMVFETCGQLNNQIMNKIRELEREFDSKDELELVIDHVRVTDLVRLR 597

Query: 1855 YQIENFKDQGINQNFTVDENLQLIKSEMTN-LLSTARDNFEKFYQECI----TKFLSDTP 2019
             ++EN+ D         +  L  I   + N +L  A    EK +Q  I     KFLS   
Sbjct: 598  -EMENWDDS--TDLIIFESRLDYISESIRNEILVNASIMTEKLFQNEILMQRCKFLS--T 652

Query: 2020 LLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
             L +E N              + + ++L  L EE+  F + + +E Y      + +L  +
Sbjct: 653  CLANEQN-------------LANVIQDLIKLDEEFEEFGKLLINEDYGV---REEKLEYR 696

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKL 2373
               N  T   ++S+  +  ++      L    ++ IN   +VT E  ++  D+ +P L
Sbjct: 697  ATKNEMTAATATSSAPLKKVR-----WLPDTSDVDIN--MSVTAETDADAWDQPEPLL 747

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F   A+Q  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 202

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 522
             +  GII R++ +LFE +E L +     +  S++E+YNE ++DLL
Sbjct: 203 TPEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (307), Expect = 9e-28
 Identities = 120/457 (26%), Positives = 207/457 (45%), Gaps = 50/457 (10%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D    I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH +  I + +
Sbjct: 261  IREDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQ 320

Query: 1024 EVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 1185
              K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L   
Sbjct: 321  TNKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLN 380

Query: 1186 --DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
               +  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 381  DGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKT 440

Query: 1360 K---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK----EL 1500
            K           +GS+      LK IT +  +I+   L  + +  I M    YK    ++
Sbjct: 441  KIIRNQQSLSRHVGSY------LKMITEQKRQIEE--LREREEKMISMKLTKYKLNKEKI 492

Query: 1501 TTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN---------E 1653
               +      +Q+   T+E  T Q A +LK    + +   LQ +K++  N          
Sbjct: 493  QLAINECINRVQQSYSTVE--TYQVAKILK-SLILCKRRFLQMVKLEVDNLVQLFQQGDI 549

Query: 1654 SMKKLYAKIERQQSIENELDGKIQ----IFTKTNSKLTKI-------IDEMKNREALVNS 1800
             + ++   I   Q I  +L  KI      F +TN+  + I       +++++  E    +
Sbjct: 550  MVAEMQPVISNCQMISEQLFNKIHELEVKFDETNALDSVIQQVHSIDLNKLREMEDWDET 609

Query: 1801 KFKTLLDHSLSYVSKKLNYQI---------ENFKDQGINQNFTVDENLQLIKSEMTNLLS 1953
                 L+  LS +S+    +I         +   D G+N+ F       + ++     + 
Sbjct: 610  YDLVYLESCLSQISELQRNEILINSSIMTEKLISDAGLNRRFKFLSKWLMDRTPDIEFII 669

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKA 2064
                + ++ ++     F+++    F   N N++N  A
Sbjct: 670  QDLVHIDEDFELFAKSFIANPSNTFSNTNINIINTTA 706

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +++Q+ ++ E   PL    + GYN T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSG-------- 204

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 522
                G+I   + +LF  ++ L ++    +  S++E+YNE ++DLL
Sbjct: 205 TPSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (305), Expect = 2e-27
 Identities = 92/298 (30%), Positives = 155/298 (52%), Gaps = 17/298 (5%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D    I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH++  I + +
Sbjct: 261  IREDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQ 320

Query: 1024 EVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 1185
              K          + ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L   
Sbjct: 321  TNKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLN 380

Query: 1186 --DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
               +  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 381  DGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKT 440

Query: 1360 K---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDL 1512
            K           +GS++      K    EL + +  ++S K    +   + + +++   +
Sbjct: 441  KIIRNQQSLSRHVGSYLKMITEQKRQIEELREREEKMISLK----LTKYKLNKEKIQLAI 496

Query: 1513 QNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIER 1686
                  +Q+   T+E  T Q A +LK    + +   LQ +K++  N ++  L+ + ER
Sbjct: 497  NECINHVQQTYSTVE--TYQVAKILK-SLILCKRRFLQMVKLEVDNLTL--LFQQEER 549

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +++Q  ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 391 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 522
                GII   + +LF  +  L ++    +  S++E+YNE + DLL
Sbjct: 205 TPSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
            KIP3Kinesin-related motor protein involved in mitotic
            spindle positioning
          Length = 805

 Score =  122 bits (305), Expect = 2e-27
 Identities = 147/573 (25%), Positives = 249/573 (43%), Gaps = 27/573 (4%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D    I + NL   H  T ++ + L+ +G   R  + T+ N+ SSRSH +  I + +
Sbjct: 261  IREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQ 320

Query: 1024 EVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 1185
              K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L   
Sbjct: 321  TNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLN 380

Query: 1186 --DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 1359
               ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 381  DGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKT 440

Query: 1360 K---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDL 1512
            K           +GS+      LK IT +  +I+   L  + +  I +    YK    + 
Sbjct: 441  KIIRNQQSLSRHVGSY------LKMITEQKRQIEE--LREREEKMISLKLTKYK---LNK 489

Query: 1513 QNYKTEIQECKRTIESL-----TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAK 1677
            +  +  I EC   ++       T Q A  LK    + +   LQ +K++  N     L   
Sbjct: 490  EKIQLAINECVNRVQQTYAGVETYQVAKTLK-SLILCKRRFLQMVKLEVDN-----LILL 543

Query: 1678 IERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNY 1857
             ER++S   E+   I       S    I  ++ N+   +  KF      +LS V     +
Sbjct: 544  FEREESTAAEMQPVI-------SNCRMISGQLYNKIHELEMKFDE--TDTLSSVI----H 590

Query: 1858 QIENFKDQGINQNFTVDENLQLIKSE-MTNLLSTARDNFEKFYQECITKFLSDTPLLFDE 2034
            Q+ +     + +    DE   L+  E   N +S  + N        +T+ L   P L   
Sbjct: 591  QVHSIDLNKLREMEDWDETYDLVYLESCLNQISELQRNEILVNSSIMTEKLMSDPGLNSR 650

Query: 2035 INDNVLNLKALTSNYYSQIAENLSDLSEEYNNF-KQFITDEFYNQEKGHQHELLNKYINN 2211
                   L   T N  S I ++L  + EE+ +F + FI +   N            + N 
Sbjct: 651  FKFLSKWLMNRTPNIES-IIQDLVHIDEEFESFARTFIANPDSN------------FTNT 697

Query: 2212 TQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEE- 2388
               +I +++ D+    + L  ++    K  +  +  +++   M      L+P+L + ++ 
Sbjct: 698  NINIINTTAADLAVPAETLQRQNFSQKK--VKWTSPDLSPSPMIEPQPELEPELHQDQDA 755

Query: 2389 --SAELINRSDALNNEFNDNVESSMTTMTDKIK 2481
              S   ++  D   NE   +  S+ TT   + K
Sbjct: 756  IASEVDVSMQDTTFNEQGPSTPSAPTTAVPRRK 788

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F  +++Q+ ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 391 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 522
                GII   + +LF  +  L +  D  +  S++E+YNE ++DLL
Sbjct: 205 TPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
            Anc_8.678 YPL155C
          Length = 658

 Score =  121 bits (303), Expect = 2e-27
 Identities = 105/352 (29%), Positives = 169/352 (48%), Gaps = 40/352 (11%)
 Frame = +1

Query: 817  SPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSH 996
            S  ++ +  I+ D   G+ I  L E    T++E +K ++ G   R+ + T+ N  SSRSH
Sbjct: 250  SRLNSSELRIRDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSH 309

Query: 997  TIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 1173
             +  + L    V       S + L DLAGSE   R+    +R KE   IN+SLL LG VI
Sbjct: 310  AVILVRLVTHNVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVI 366

Query: 1174 NSLADK------------------------NVHVPFRESKLTRLLQDSLGGNTKTALIAT 1281
            + L+ +                        N H+P+R+SKLTRLLQ +L GN+    I T
Sbjct: 367  SKLSAESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICT 426

Query: 1282 ISPAKVTLEETCSTLEYASKAKNI-------KNKPQLG-SFIMKDILLKNITTELTKIKS 1437
            I P   T  ET +TL +AS+AKN+       KN   +  S + KD ++K +T  L K K 
Sbjct: 427  IDPRMETYAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKE 486

Query: 1438 DLLSTKSKDG------IYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKR 1599
             +   K K          +D  +   L T+    K +++      E++ +++ + L+D +
Sbjct: 487  TINDMKLKSSHDTSNKFSLDNPNISLLQTENSILKKKLE----NYENIMNKDMIELQDSQ 542

Query: 1600 TINENNELQRIKIQTMNES-MKKLYAKIERQQSIENELDGKIQIFTKTNSKL 1752
             ++E  ++  I+I  + E+  + + ++I + Q   NEL+ KI    K N  L
Sbjct: 543  -MSEIIDMLPIEIGALLENKFQGMESQIRQFQKYTNELENKILNLKKQNRSL 593

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 43/120 (35%), Positives = 59/120 (49%), Gaps = 2/120 (1%)
 Frame = +1

Query: 187 TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 366
           T   N+  Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 367 DEKLYNEELSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLLHGDCNN 540
           D +       +  GI+P  +  LF  +     D  + V  S++E+YNE++ DLL  D  N
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 819

 Score =  121 bits (304), Expect = 2e-27
 Identities = 119/445 (26%), Positives = 209/445 (46%), Gaps = 63/445 (14%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  ++ D    I + NL    + T ++ + L+ KG   R  ++T  N+ SSRSH +  + 
Sbjct: 230  KLVLREDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVH 289

Query: 1015 LFKEVKG----EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + ++ +     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 290  ITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 349

Query: 1183 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
                      HVP+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK
Sbjct: 350  CAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAK 409

Query: 1348 NIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK-- 1494
             IK K           +GS+      LK IT +  +I+   L ++ +  I ++   YK  
Sbjct: 410  EIKTKIIRNQHSLDRHVGSY------LKMITEQRQEIEE--LRSRERKMIDLELSRYKIS 461

Query: 1495 ----------ELTTDLQNYKT-----------EIQECKRT-IESLTSQNALLLK---DKR 1599
                       + +  QNYKT            +  CKR  ++ +  + A+LLK      
Sbjct: 462  RERVHMSVWDSVQSLRQNYKTSEKFHHLKVIKSLMLCKRRFLQMVGVELAVLLKFTSPNS 521

Query: 1600 TINEN------NELQRIK-IQTMNESMKKLYAKIERQQSIE----NELDGKIQIFTKTNS 1746
             I+ N        +Q++K ++   +S  +L + +E  + ++     E++G  +       
Sbjct: 522  DIHVNCMALHEQLVQKVKNLEQSFDSPDELESALEHTRQVDLVKLQEMEGWAESDLVWYE 581

Query: 1747 KLTKIIDEMKNREALVNSKF---KTLLDH----SLSYVSKKLNYQIENFKDQGINQNFTV 1905
             L   + E    E LV S     + + DH     L ++S+ L  +  +  +     +F  
Sbjct: 582  SLLSWVSESVRNEILVGSSLMMERLMEDHVLLDRLKFISETL-LRFTHTAEGSDEHSFDF 640

Query: 1906 DENLQLIKSEMTNLLSTARDNFEKF 1980
            D   + +  ++ +L++   D F++F
Sbjct: 641  DSLTEQLHGQIRDLIN-IDDEFDRF 664

 Score = 65.1 bits (157), Expect = 7e-10
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D+VF   A+Q  +++    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 176

Query: 391 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 522
            +++ GII   + +LF  +E+L +     +  S++E+YNE ++DLL
Sbjct: 177 TAENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 778

 Score =  121 bits (303), Expect = 2e-27
 Identities = 76/251 (30%), Positives = 135/251 (53%), Gaps = 9/251 (3%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I  D    I + NL  ++    ++ + L+ KG   R  ++T  N+ SSRSH +  I 
Sbjct: 233  KLVILEDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIH 292

Query: 1015 LFKEVKGEIFR----LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + +  +    +     + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L
Sbjct: 293  IMQHNRTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINAL 352

Query: 1183 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
                   ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 353  CLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAK 412

Query: 1348 NIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKT 1527
             IK K    +  + D  + +    +++ K ++   + ++ + +D +  K   T  +  + 
Sbjct: 413  EIKTKVSRNNQTL-DRHVSSYLKMISEQKQEIDELRRREQVVIDMRLKKYQLTQ-EKVQL 470

Query: 1528 EIQECKRTIES 1560
             I++C + +++
Sbjct: 471  AIEDCLQNVQT 481

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D++F   +TQ  +++    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 391 LSDSAGIIPRILFKLFETLEKLNE-DHI-VKCSFVELYNEELKDLL 522
             ++ GII + + +LF  +E L +  H  +  SF+E+YNE ++DLL
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  119 bits (298), Expect = 9e-27
 Identities = 78/192 (40%), Positives = 106/192 (55%), Gaps = 5/192 (2%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            NDS  K     N K  I+ DQ T    I N+    + + +    +L+K  K R  AST  
Sbjct: 533  NDSIGKDDTNTNSKHEIRHDQETKTTMITNVTSCQLESEERVDMILKKANKLRSTASTAS 592

Query: 973  NDFSSRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1149
            N+ SSRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+S
Sbjct: 593  NEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKS 652

Query: 1150 LLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
            L  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET +
Sbjct: 653  LSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLN 712

Query: 1321 TLEYASKAKNIK 1356
            +L +ASK  + +
Sbjct: 713  SLRFASKVNSTR 724

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 52/181 (28%), Positives = 84/181 (46%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQRE-IDAKSSVVVTVPDIMGSKEVAINTSED 177
           + + TV      + +EL   + V CR R   E ++   + ++ V +   ++ V       
Sbjct: 367 VKEETVRRTLHNELQELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEVTK 426

Query: 178 IGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYT 357
           I  T Q++   +  DK+F    T   +F E+ + L    + GYN  +  YG T +GKT+T
Sbjct: 427 IQSTTQVHE--FKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 358 MTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG 528
           M          L+   GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  
Sbjct: 484 M----------LNTGDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRN 533

Query: 529 D 531
           D
Sbjct: 534 D 534

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  119 bits (297), Expect = 1e-26
 Identities = 78/197 (39%), Positives = 109/197 (55%), Gaps = 4/197 (2%)
 Frame = +1

Query: 778  MFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQV 957
            +  SG     N    AD+        +    YI N+    + +     K+L++  K R  
Sbjct: 491  LLRSGAPSQENNDRNADSKHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRST 550

Query: 958  ASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSK-MNLVDLAGSENINRSGALNQRAKEAG 1134
            AST  N+ SSRSH+IF I L  + +G   +    +NLVDLAGSE +N S  + +R +E  
Sbjct: 551  ASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQ 610

Query: 1135 SINQSLLTLGRVINSLAD---KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 1305
            SIN+SL  LG VI++L     +  H+PFR SKLT LLQ SL G++KT +   ISPA + L
Sbjct: 611  SINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHL 670

Query: 1306 EETCSTLEYASKAKNIK 1356
             ET ++L +ASK  N K
Sbjct: 671  NETINSLRFASKVNNTK 687

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 3/117 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F    T   IF E+ + L    + GYN  +  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 391 LSDSAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLLHGDCNNDNGN 552
           L+   GI+P  +  +F  ++KL      + V C F+E+YNE + DLL     +   N
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENN 502

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 61/287 (21%), Positives = 121/287 (42%), Gaps = 40/287 (13%)
 Frame = +1

Query: 1237 QDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA----KNIKNKPQLGSFIMKDILLK 1404
            Q  +GG  +     T  P ++   ++ S+    S      K+I+++  L SF  ++++  
Sbjct: 10   QTGIGGAGQKRRYTTTPPREIRQYQSRSSFGVNSSGNVDGKSIRSRTHLTSFYKENVM-- 67

Query: 1405 NITTELTKIKSDLLSTKSK-DGIYMDQQHYKELTTDL---------------QNYKTEIQ 1536
                EL +++  L   K   DG+  + +  K   T L               Q  + + +
Sbjct: 68   ----ELNELQDKLFQKKGVLDGLKDEYEDLKSRYTALDLKWEQKKEERKLKAQKLELKEK 123

Query: 1537 ECKRTIESLTSQNALLLKDKR------TINENNELQRIKIQTMNESMKKLYAKIERQQSI 1698
            E K+  +   ++   L +  +      T N+N EL ++  +  ++     Y KI++ ++ 
Sbjct: 124  ELKKIKDDFANKKTFLEESHKLKLEQLTANKNAELNKMNDEYRSKLEALKYEKIKKFENE 183

Query: 1699 ENELDGKI-QIFTKTNSKLTKIIDEMKNREA-LVNSKFKTLLDHSLSY------------ 1836
            +NEL  KI +I  K  +    +   MK+ EA  +  K K L D+   +            
Sbjct: 184  KNELIEKIEEIRNKMITNDVALQQRMKDIEADHLEEKEKWLKDYQKEWREVTEKNQESIR 243

Query: 1837 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK 1977
             +K+L  +IE      I+   T ++ L+ +KSE+  L  T ++  E+
Sbjct: 244  KTKELKSEIETVLTPRID---TQNKRLEELKSEIKKLDDTLQNKNEQ 287

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
            Ashbya gossypii AER441C
          Length = 833

 Score =  119 bits (298), Expect = 1e-26
 Identities = 121/475 (25%), Positives = 224/475 (47%), Gaps = 38/475 (8%)
 Frame = +1

Query: 829  NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            + K  I+ D      + NL      + ++ + L+ KG   R  + T  N+ SSRSH +  
Sbjct: 233  SQKLIIREDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQ 292

Query: 1009 ITLFKEVKGEIFRLSK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            I + +  +    +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN
Sbjct: 293  IHVVQSSRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCIN 352

Query: 1177 SLADKN----VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
            +L         HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 353  ALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRA 412

Query: 1345 KNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            K+IK K           +GS+      LK IT++  +I  D L  +    I +  Q YK 
Sbjct: 413  KDIKTKVIRNQHSLDRHVGSY------LKMITSQKQEI--DELRNREAKMIDLRLQQYKL 464

Query: 1498 LTTDLQ--------NYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNE 1653
                LQ          K+  Q  +R   + T ++ +L K        +E+  + +Q M+ 
Sbjct: 465  SRNKLQMAMWEAVNQLKSNYQVLERFQRAKTIKSLMLCKRHFLQLVQSEVSHL-LQLMDS 523

Query: 1654 SMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD---- 1821
            S  + +  I   +++  +L  KI+    +       +  +++ + +  ++F+T+      
Sbjct: 524  SDIE-HPLILFCRTVSEQLKTKIRELEDSFDTDDDFMISLEHSKEVDVARFQTMESWEET 582

Query: 1822 HSLSYVSKKLNYQIENFKDQ-GINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 1998
              L +  ++L+   E+ +++  +N +  +D  LQ      T L S  +   E  ++   T
Sbjct: 583  SDLLWYEQQLDQLSESMRNEIMVNASMMIDRMLQ-----DTKLTSRHKFVCESLFKLLCT 637

Query: 1999 KFLSDTPL-------LFDEINDNVLNLKALTSNYYSQIAENLSDLS-EEYNNFKQ 2139
            +  +D  +       + DE+ D++++L  +    + + A  +  +S ++ N  KQ
Sbjct: 638  RDDNDNTIPPSGQQAILDEVRDSIIDLVQIDEE-FEKFANQMGPVSTDDVNKRKQ 691

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F   ATQ  +F     PL    I G+N T+  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGD 531
             ++ GII   + +LF+ +E L +     +  S++E+YNE ++DLL  D
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLEPD 230

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 769

 Score =  119 bits (297), Expect = 1e-26
 Identities = 111/456 (24%), Positives = 200/456 (43%), Gaps = 20/456 (4%)
 Frame = +1

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
            K  I+ D     ++ NL +      +E + L+ KG   R  + T  N+ SSRSH +  I 
Sbjct: 229  KLVIREDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIH 288

Query: 1015 LFKEVKGEIFR----LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            + +  +    +     + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L
Sbjct: 289  VAQMNRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINAL 348

Query: 1183 ADKNV------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
               +       HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 349  CVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRA 408

Query: 1345 KNIK-----NKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 1509
            K IK     NK  L   +   + L      +T+ KS++   +S++         K +   
Sbjct: 409  KEIKTKVIRNKQSLDRHVGSYLKL------ITEQKSEIEELRSRE--------QKMIEIQ 454

Query: 1510 LQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQ 1689
            L  ++   ++    I+    +  + L D   I +   ++ + +      +K ++ ++   
Sbjct: 455  LSQFRNGREKVNMLIKESVREMRIHLSDSEKIQDAKLIKSLML-VKRHYLKLVHFELSNV 513

Query: 1690 QSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIEN 1869
                N L+ +  +F   N  + +    +K  E  V       +D +L Y+      Q++ 
Sbjct: 514  LQYLNNLNDERAVFLTDNIHIIQEQILLKMNELEVQFDDPNDIDRTLEYMK---TIQLKK 570

Query: 1870 FKDQGINQNFTVDENLQLI-----KSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDE 2034
             +D    Q     E  +++     +S    +L       EK  ++ I +  S   ++   
Sbjct: 571  MRDCEYWQEAIDFEQYEILISGLSESVRNEILVNGTRLMEKVIEDPILR--SHFQIISKS 628

Query: 2035 INDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQF 2142
            I D   N     +     I   L+ L++    F QF
Sbjct: 629  IVDENENTDGSNTTMVGTIERELNKLNKLDQEFDQF 664

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 2/112 (1%)
 Frame = +1

Query: 193 QMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE 372
           +   + +  D++F    TQ  +++    PL    + G+N T+  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-- 175

Query: 373 KLYNEELSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 522
                  S+  GII   + +LF  +E+L +     ++ SF+E+YNE++ DLL
Sbjct: 176 ------TSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL 221

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL216W
            (KIP3)
          Length = 818

 Score =  118 bits (295), Expect = 2e-26
 Identities = 121/487 (24%), Positives = 220/487 (45%), Gaps = 41/487 (8%)
 Frame = +1

Query: 829  NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            + K  I+ D  +   + NL      T ++ + L+ +G   R  + T  N+ SSRSH +  
Sbjct: 231  SQKLIIREDSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQ 290

Query: 1009 ITLFKEVKGEIFRLSKM----NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            + + +  +    +  KM    +++DLAGSE  + +    +R  E  +IN+SLL LG  IN
Sbjct: 291  VHVVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCIN 350

Query: 1177 SLADKN----VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
            +L         HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 351  ALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRA 410

Query: 1345 KNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            K+IK K           +GS+      LK IT +  +I+   L ++    I +  Q ++ 
Sbjct: 411  KDIKTKVIRNQHSLDRHVGSY------LKMITAQKQEIEE--LRSREAKVIDLRLQQFRL 462

Query: 1498 LTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL--QRIKIQTMNESMKKLY 1671
                LQ    E       +  L S   +L + +RT    + +  +R  +Q +   +  L 
Sbjct: 463  SRNKLQMAMWE------GVNQLKSNYQVLDRFQRTKTMKSLMLCKRHFLQLVQTEVNHL- 515

Query: 1672 AKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL 1851
             ++     +++ L G  Q  T     LTKI +   + +A    +F+  L+H+    +   
Sbjct: 516  LQLTESTKVDHPLSGFCQ--TINEQLLTKICELEDSFDA--EDEFQLTLEHAKE--ADMA 569

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQEC--------ITKFL 2007
             +Q     D+  +  +   +   L +S    ++  A    +K   +         +T+ L
Sbjct: 570  RFQQMETWDEATDALWYEQQLEHLAESIKNEIMVNASAMMDKMLHDTKLRSRFSFVTESL 629

Query: 2008 --------------SDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFI 2145
                          +D+    D++ D++++L  +    + Q A  +  L+++ N  KQ  
Sbjct: 630  FHLLFEGGEYNAQPADSEAALDKVRDSIIDLVQIDEE-FEQFAHQMGPLNDDANKRKQ-- 686

Query: 2146 TDEFYNQ 2166
            T + + Q
Sbjct: 687  TSDLHRQ 693

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  DK+F   A+Q  +F     PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGD 531
             DS GII   + +LF+ +  L +     +  S++E+YNE ++DLL  D
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLEPD 228

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 668

 Score =  116 bits (291), Expect = 5e-26
 Identities = 108/409 (26%), Positives = 194/409 (47%), Gaps = 34/409 (8%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 1020
            ++ D   G+ +  L E ++++ KE +K +  G   R+   T  N  SSRSH +  I +F 
Sbjct: 228  LRDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFC 287

Query: 1021 -KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA---- 1185
              E+ GE   +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+    
Sbjct: 288  TDEITGEQV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESS 343

Query: 1186 --DKNV-HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 1356
                NV H+P+R+SKLTR+LQ +L G++  A I T+     T  E+ +T+ +AS+AKNI 
Sbjct: 344  GLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNIS 403

Query: 1357 ------------NKPQLGSFIMKDILLKNITTE-LTK--------IKSDLLSTKSKDGIY 1473
                        +K QL   + K +  + IT + LT+        I SD    +  + + 
Sbjct: 404  LAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLK 463

Query: 1474 MDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK---IQT 1644
            M  +HY+ L T L+    +  E    I+ L     ++L+ K  +N +++LQ  K    Q 
Sbjct: 464  MKVEHYERLET-LEPSILKDTELVEIIDMLPQDIGVMLETK-LVNMDSQLQESKRYISQL 521

Query: 1645 MNESMKKLYAKIERQQSIENELDGKI-QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
             +   +   A     + + N  D  + Q+  +   +L ++   ++ ++ ++ +       
Sbjct: 522  ESARTRDASATAATAELLSNVSDIDLTQVLHEQEQELMQLHQSLERKDKMIEALKS---- 577

Query: 1822 HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
                  +K+L  Q+  +  + ++     D ++++  +   N+L     N
Sbjct: 578  ------AKRLRQQLAEYTGEAVS---ATDSDIEIGTATAANVLKPISPN 617

 Score = 71.2 bits (173), Expect = 8e-12
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 2/107 (1%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF P      +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 391 LSDSAGIIPRILFKLFETLE--KLNEDHIVKCSFVELYNEELKDLLH 525
                GIIP  +  +F+ +      +   V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  115 bits (288), Expect = 1e-25
 Identities = 76/192 (39%), Positives = 108/192 (56%), Gaps = 5/192 (2%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            +D+ N+   + + K  I+ DQ T    I N+    + + K    +L+K  K R  AST  
Sbjct: 533  SDNINRDDTSSSLKHEIRHDQETKTTVITNVTTCKLESEKMVDMILKKANKLRSTASTAS 592

Query: 973  NDFSSRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1149
            N+ SSRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+S
Sbjct: 593  NEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKS 652

Query: 1150 LLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
            L  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET +
Sbjct: 653  LSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLN 712

Query: 1321 TLEYASKAKNIK 1356
            +L +ASK  + +
Sbjct: 713  SLRFASKVNSTR 724

 Score = 74.3 bits (181), Expect = 9e-13
 Identities = 54/193 (27%), Positives = 89/193 (46%), Gaps = 4/193 (2%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQRE-IDAKSSVVVTVPDIMGSKEVAINTSED 177
           + + TV      + +EL   + V CR R   E ++   + ++ V +   +  +       
Sbjct: 367 IKEETVRRTLHNELQELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDNCGIQSMEVTK 426

Query: 178 IGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYT 357
           I  TAQ++   +  DK+F    T + +F E+ + L    + GYN  +  YG T +GKT+T
Sbjct: 427 IHNTAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 358 MTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG 528
           M          L+   GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  
Sbjct: 484 M----------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRS 533

Query: 529 DCNNDNGNFKKLR 567
           D  N +     L+
Sbjct: 534 DNINRDDTSSSLK 546

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
            (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  114 bits (286), Expect = 2e-25
 Identities = 108/419 (25%), Positives = 191/419 (45%), Gaps = 33/419 (7%)
 Frame = +1

Query: 790  GNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTK 969
            G    ++K + A   +  ++ D   G+ +  L E  + ++++ +K +  G   R+   T 
Sbjct: 252  GYGSFSSKPTHAAGTELPVRDDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETD 311

Query: 970  MNDFSSRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQ 1146
             N  SSRSH I T+ L   ++       S ++L DLAGSE   R+   ++R KE   IN+
Sbjct: 312  YNTRSSRSHAIVTLNLACTDLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINK 368

Query: 1147 SLLTLGRVINSLADK---------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
            SLL LG VI+ L+           N H+P+R+SKLTR+LQ +L G +    I TI     
Sbjct: 369  SLLALGTVISKLSASSMHTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLD 428

Query: 1300 TLEETCSTLEYASKAKNI-----KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKD 1464
             + ET +T+ +AS+AKN+     +N+ +L     KD L+ N+  +L + +  +   K   
Sbjct: 429  AMSETVNTIRFASRAKNVSMTVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKR-- 484

Query: 1465 GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK--- 1635
                  Q   E T DL   + E    KR ++       LL KD+  + ++  ++ ++   
Sbjct: 485  -----NQEKCEQTPDLYLLRKESDALKRKLQLC---ERLLDKDEAAVQDDQLVEIVEMLP 536

Query: 1636 -------------IQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMK 1776
                         +Q+   S +   +++ERQ S   +LD ++     T S  +  I   +
Sbjct: 537  PAVGALLESKIQGLQSQLRSHRDYSSQLERQLS---DLDSRLSSHQSTASDQSLQILLQE 593

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLN--YQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
             +E L        L  SL+  +K L+     +  ++ G+   F+    + L++    N+
Sbjct: 594  QQEELAE------LHKSLTRKNKMLDALQSAKRLREGGLGPLFSARRRVDLLERLQKNV 646

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 3/108 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF P +    ++ +I +P+     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSG-------- 190

Query: 391 LSDSAGIIPRILFKLFETL--EKL-NEDHIVKCSFVELYNEELKDLLH 525
             + AG+I   +  +F  +  E L N+   V  S++E+YNE++ DLL+
Sbjct: 191 TPEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] {ON}
            Anc_3.479 YPR141C
          Length = 764

 Score =  114 bits (286), Expect = 3e-25
 Identities = 70/152 (46%), Positives = 95/152 (62%), Gaps = 4/152 (2%)
 Frame = +1

Query: 898  ITTAKEGI-KLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK-EVKGEIFRLSKMNLVD 1071
            +  +KE + K+L++  K R  AST  N+ SSRSH+IF I L     K +      +NLVD
Sbjct: 602  VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 1072 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV--HVPFRESKLTRLLQDS 1245
            LAGSE ++ S    +R +E  +IN+SL  LG VI +L DKN   H+PFR SKLT LLQ S
Sbjct: 662  LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 1246 LGGNTKTALIATISPAKVTLEETCSTLEYASK 1341
            L GN+KT +   ISP+   + ET ++L +ASK
Sbjct: 722  LVGNSKTLMFVNISPSSSHINETINSLRFASK 753

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 39/117 (33%), Positives = 62/117 (52%), Gaps = 3/117 (2%)
 Frame = +1

Query: 208 TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE 387
           ++  DK+F    +   +F E+ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 388 ELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDNG 549
            L  + G+IP  +  +F+ +E L E   ++ + C FVE+YNE + DLL    +N+NG
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLLR---SNENG 573

 Score = 39.3 bits (90), Expect = 0.060
 Identities = 71/361 (19%), Positives = 149/361 (41%), Gaps = 26/361 (7%)
 Frame = +1

Query: 1093 NRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTAL 1272
            N    +N R    G I+  + +   ++N ++  N+      S L    +  +       L
Sbjct: 89   NVENDMNSRLSLDGKISTGIQS---ILNRVSGSNITSLKSHSHLASFYKQQV--KELNDL 143

Query: 1273 IATISPAKVTLEETCSTLEYAS---KAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL 1443
              T+   K+ L+E    LE      K +      + GS   K+  L+   TEL+K+K DL
Sbjct: 144  QTTLYNRKMELDELRDNLEVRKDQLKEQKYAVGRESGSKNTKEQQLRLRQTELSKLKEDL 203

Query: 1444 LSTKS--KDGIYMDQQHYKELTTDLQ--------NYKTEIQECKRT-IESLTSQNALLLK 1590
             + K    DG  +   H K++  + Q         Y+ +++  KR  I+ +  +   L K
Sbjct: 204  EARKKFLLDGFKL---HLKQMEVENQTKKNKLAIEYRDKLEAVKRVKIKKMEDEKDQLAK 260

Query: 1591 DKRTINE---NNELQRIKIQTMNESMKKLYAKIERQ-----QSIENELDGKIQIFTKTNS 1746
            +   + E   NN+       T+++ ++ +  K E       +S E +    ++I  K   
Sbjct: 261  EVDVLREKIANND------STLDDMLRDVTQKYENMKEPWLKSFEVKWKENVEINEKCIQ 314

Query: 1747 KLTKIIDEMKN----REALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDEN 1914
            ++T++  E++     +   + SKF +L +     ++K    Q E+ K             
Sbjct: 315  EITELRKELEENLQPKAEKLKSKFDSLKEQRDELIAKLKQQQKEHRK------------- 361

Query: 1915 LQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIA 2094
               I+ E++   +T R+  E+  +  + + +S T     E+N+ ++  + L  + ++++ 
Sbjct: 362  ---IEEEISQKKTTLRETEER--EASLKEEISKTESDLKELNEILIKEETLRRSLHNKLQ 416

Query: 2095 E 2097
            E
Sbjct: 417  E 417

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 60/307 (19%), Positives = 118/307 (38%), Gaps = 20/307 (6%)
 Frame = +1

Query: 1636 IQTMNESMKKLYAKI----ERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
            I T + +MK+ Y        +  ++EN+++ ++ +  K ++ +  I++ +        S 
Sbjct: 66   IPTSHAAMKRRYTTSPSPKNKHNNVENDMNSRLSLDGKISTGIQSILNRVSG------SN 119

Query: 1804 FKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFE-KF 1980
              +L  HS           + +F  Q + +   +   L   K E+  L    RDN E + 
Sbjct: 120  ITSLKSHS----------HLASFYKQQVKELNDLQTTLYNRKMELDEL----RDNLEVRK 165

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
             Q    K+            +  L L+             LS L E+    K+F+ D F 
Sbjct: 166  DQLKEQKYAVGRESGSKNTKEQQLRLRQT----------ELSKLKEDLEARKKFLLDGFK 215

Query: 2161 ---------NQEKGHQHELLNKYINNTQTVIE------SSSNDVMSTIQNLLNEHLRANK 2295
                     NQ K  +++L  +Y +  + V            D ++   ++L E +  N 
Sbjct: 216  LHLKQMEVENQTK--KNKLAIEYRDKLEAVKRVKIKKMEDEKDQLAKEVDVLREKIANND 273

Query: 2296 ELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDK 2475
              + + L +VT +  + +   LK    KW+E+ E+  +      E    +E ++    +K
Sbjct: 274  STLDDMLRDVTQKYENMKEPWLKSFEVKWKENVEINEKCIQEITELRKELEENLQPKAEK 333

Query: 2476 IKQTNDS 2496
            +K   DS
Sbjct: 334  LKSKFDS 340

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3.479
            YPR141C
          Length = 676

 Score =  114 bits (285), Expect = 3e-25
 Identities = 74/196 (37%), Positives = 110/196 (56%), Gaps = 5/196 (2%)
 Frame = +1

Query: 784  SSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
            S+ +N   +K    D  K+T+         ++NL+   +T+ +    +L+  +K R  AS
Sbjct: 485  SNSSNGPRHKIHHDDASKTTV---------VENLETITLTSKESVDAVLKNAMKLRATAS 535

Query: 964  TKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGS 1137
            T  N+ SSRSH+IF I +    E  GE  R   +NL+DLAGSE ++ S   ++R KE   
Sbjct: 536  TSSNERSSRSHSIFIIKIHGINEGLGEE-RNGLLNLIDLAGSERLSVSKVQSERIKETQH 594

Query: 1138 INQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 1308
            IN+SL  LG V+NSL   +    H+ FR+SKLT LLQ SL GN+KT ++  IS +   + 
Sbjct: 595  INKSLSFLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHIN 654

Query: 1309 ETCSTLEYASKAKNIK 1356
            ET  +L +A K  + K
Sbjct: 655  ETIKSLNFAKKVNSTK 670

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 3/117 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           Y+ DKVF  + T   IF E++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 391 LSDSAGIIPRILFKLFETLEKLNED---HIVKCSFVELYNEELKDLLHGDCNNDNGN 552
           L+   GIIP     +F+ ++   ++   + V C F+E+YN+E+ DLL  D N  N +
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSS 488

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
            Anc_3.479 YPR141C
          Length = 698

 Score =  114 bits (285), Expect = 3e-25
 Identities = 76/196 (38%), Positives = 106/196 (54%), Gaps = 5/196 (2%)
 Frame = +1

Query: 784  SSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
            SS N+D+ N  S            +     I N+   ++ + +    +L++  K R  AS
Sbjct: 501  SSSNDDTRNIDSNIPTKHEIRHDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTAS 560

Query: 964  TKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGS 1137
            T  N+ SSRSH+IF I L     + GE      +NLVDLAGSE IN S     R +E  +
Sbjct: 561  TGSNEHSSRSHSIFIIHLRGSNSLTGEE-SYGILNLVDLAGSERINSSQVTGDRLRETQN 619

Query: 1138 INQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 1308
            IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL GN+KT +   ISP+   + 
Sbjct: 620  INRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHIN 679

Query: 1309 ETCSTLEYASKAKNIK 1356
            ET ++L +ASK  + K
Sbjct: 680  ETINSLRFASKVNSTK 695

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 56/194 (28%), Positives = 88/194 (45%), Gaps = 10/194 (5%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQR-EIDAKSSVVVTVPDIMGSKEVAINTSED 177
           + + T+      + +EL   + V CR R     I++K +  + V D     +  I + E 
Sbjct: 329 IKEETMRRSLHNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDF--DDDNGIQSMEV 386

Query: 178 I-GFTAQMNSKT-----YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTS 339
           + G     N+ T     +  DK+F  + T + +F E+ + L    + GYN  +  YG T 
Sbjct: 387 MKGIEVNNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTG 445

Query: 340 TGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEEL 510
           +GKTYTM          L    GIIP  +  +F   + L E    + + C FVE+YNE +
Sbjct: 446 SGKTYTM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENI 495

Query: 511 KDLLHGDCNNDNGN 552
            DLL    N+D  N
Sbjct: 496 IDLLRSSSNDDTRN 509

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
            Anc_3.479 YPR141C
          Length = 739

 Score =  114 bits (284), Expect = 4e-25
 Identities = 75/182 (41%), Positives = 100/182 (54%), Gaps = 14/182 (7%)
 Frame = +1

Query: 853  DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKE 1026
            DQ+   Y+ N++ F I    + I L+ K    R  +ST +N  SSRSH IF I L  +  
Sbjct: 557  DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNH 616

Query: 1027 VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-------- 1182
               E   +SK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI++L        
Sbjct: 617  KTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 1183 ----ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
                  K  H+PFR SKLT LL+ SL G++KT +   +S  +  L ET ++L +A+K  N
Sbjct: 676  NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 1351 IK 1356
             K
Sbjct: 736  TK 737

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 5/125 (4%)
 Frame = +1

Query: 199 NSKTYTV--DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE 372
           N+ TY+   D VF      S +F+EI E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 373 KLYNEELSDSAGIIP---RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 543
                 L+ + G+IP   + +F   ++L+K   ++ V C F+ELYNE + DL       D
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF-----RD 541

Query: 544 NGNFK 558
           NG  K
Sbjct: 542 NGPTK 546

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 84/405 (20%), Positives = 160/405 (39%), Gaps = 26/405 (6%)
 Frame = +1

Query: 1285 SPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKN--ITTELTKIKSDLLSTKS 1458
            S +  T E +    EY+ + K++++       +  ++  KN  +  E+  +K  L S  S
Sbjct: 81   SSSHQTAELSSFYKEYSLQLKSLQSDVNNHQSVRDNLSNKNSLLENEILSLKFKLDSLSS 140

Query: 1459 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
             + +++++   KE      N   E+ E K   E     N  L  ++     +NEL  I  
Sbjct: 141  NNSVFVEKVKSKE------NQLKELNEIKILKEKNIVDNHHLEINQLKSTHDNELSSIIR 194

Query: 1639 QTMNESMKKLYAKIERQQSIENELDGKIQIFTK--------TNSKLTKI--------IDE 1770
            Q   +     ++K+E   + + +++ K+ + +K         NS+L K+        ID 
Sbjct: 195  QYKKKYESTKFSKLESFGNQKKDINEKLSVISKDIINNEKNLNSELRKVDNNQSKSNIDW 254

Query: 1771 MKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLL 1950
            +K  +   N K K       + ++K++    EN K Q         + LQL + E  N L
Sbjct: 255  LKENQTQYNEKTK-----ENNGLTKEIYKLSENIKKQLEPDCSNKRKELQL-QIENNNNL 308

Query: 1951 STARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNN 2130
             +   +  K  +  I    S    L D  N+N   LK +     ++  + LS L  E + 
Sbjct: 309  DSELSDVLKEKENLIEHISSIQKKLLDLKNENETQLKLIEDE--NEKRKILSKLIIENDT 366

Query: 2131 FKQFITDEFYNQEKG-----HQHELLNKYINNTQT---VIESSSNDVMSTIQNLLNEHLR 2286
             ++ I ++F                L K  N+ QT    IE   +  +  +QN   +  +
Sbjct: 367  NRRIIHNQFQELRGNIRVYCRVRPPLKKITNSPQTSHFSIEIPEDKNILEVQNF--DQTK 424

Query: 2287 ANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDAL 2421
              + + +  L +      S E D +     + E ++E+ N  + L
Sbjct: 425  GTQTIKVKKLDSNNNATYSFEFDHV---FKQDEGNSEVFNEIEQL 466

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155C KIP2 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 657

 Score =  113 bits (283), Expect = 4e-25
 Identities = 90/321 (28%), Positives = 163/321 (50%), Gaps = 29/321 (9%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 1020
            I+ D   G+ +  L E  + T+++ +K +  G   R+   T  N  SSRSH I  I L  
Sbjct: 265  IRDDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTC 324

Query: 1021 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
             ++K  +   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L+ ++  
Sbjct: 325  TDLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQ 381

Query: 1198 --------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 1353
                    H+P+R+SKLTR+LQ +L G+     I T+     +  ET +T+ +AS+AKNI
Sbjct: 382  NMGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

Query: 1354 K---NKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD-----QQHYKELTTD 1509
                 + ++     KD +++N+  +L +    +   KS +G          +    L ++
Sbjct: 442  SLVVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSE 501

Query: 1510 LQNYKTEIQECKRTIESLTSQNALLLKDKRTIN-------ENNELQRIKIQTMNESMK-- 1662
             +  K  ++ C    E L  +++++L+D+  +        + + +   KIQ +   ++  
Sbjct: 502  NKVLKLRLEHC----EKLLDKDSMILQDQELVEIVDMLPPDVSTVLESKIQGIESQLREH 557

Query: 1663 KLY-AKIERQ-QSIENELDGK 1719
            K Y A +E Q Q++++++ G+
Sbjct: 558  KAYAAHLEHQLQNLQHQVTGQ 578

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 37/108 (34%), Positives = 62/108 (57%), Gaps = 3/108 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           ++ D VF P+     +++E A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSG-------- 198

Query: 391 LSDSAGIIPRILFKLFETL--EKLNEDHI-VKCSFVELYNEELKDLLH 525
            S+  G+IP  +  +F  +  + LN     VK S++E+YNE++ DLL+
Sbjct: 199 TSNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] {ON}
            Anc_3.479 YPR141C
          Length = 706

 Score =  113 bits (282), Expect = 7e-25
 Identities = 73/172 (42%), Positives = 96/172 (55%), Gaps = 4/172 (2%)
 Frame = +1

Query: 853  DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF-KEV 1029
            D++    I N+    +   +   K+L +  K R  ASTK N+ SSRSH+IF I L  K  
Sbjct: 531  DESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNS 590

Query: 1030 KGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI---NSLADKNVH 1200
            K        +NLVDLAGSE IN S    +R +E   IN+SL  LG VI   NS   K  H
Sbjct: 591  KTNEDSYGILNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERH 650

Query: 1201 VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 1356
            +PFR SKLT LL+ SL GN+KT +   IS +   + ET ++L +ASK  + K
Sbjct: 651  IPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 41/121 (33%), Positives = 63/121 (52%), Gaps = 3/121 (2%)
 Frame = +1

Query: 169 SEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGK 348
           ++ +  T   N+  Y  DK+F    + S IF E+ + L    + GYN  +  YG T +GK
Sbjct: 407 TQTMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGK 465

Query: 349 TYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDL 519
           T+TM          L+ S GIIP  +  +F  ++ L E   ++ + C FVE+YNE + DL
Sbjct: 466 TFTM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDL 515

Query: 520 L 522
           L
Sbjct: 516 L 516

 Score = 39.3 bits (90), Expect = 0.059
 Identities = 52/292 (17%), Positives = 114/292 (39%), Gaps = 6/292 (2%)
 Frame = +1

Query: 1633 KIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKT 1812
            +I+ +N   ++LY K  +  +++++ +     + +   K  K+  E +N++  +++K K 
Sbjct: 89   QIRELNSLQEELYVKKSKLDTLKDQYEMLNSTYKEKKLKWDKLYLEKQNKQNQLSTKKKE 148

Query: 1813 LL------DHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFE 1974
            +       D  +  + K     +E  K +  NQ       +  +++E    ++  +   E
Sbjct: 149  IEVLNDKNDEKIKQLKKGHELHMEQLKIK--NQG-----EINKLQNEYLIKINQLKHQKE 201

Query: 1975 KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDE 2154
            K +Q+             D +   V+ L+    +  + + + L+DL  +Y+  K+    +
Sbjct: 202  KKFQD-----------ERDNLQKEVIKLERRIDSNDAILNDLLNDLKIKYDKLKETWLID 250

Query: 2155 FYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTE 2334
            + N+ K    E   +Y N          ND+   I+ L N                 T  
Sbjct: 251  YQNEWK-QNIEKNERYSNEINDFKLKLGNDLTPRIEKLNN-----------------TVN 292

Query: 2335 LMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 2490
             + NE+  L   L   +  +E +       NE   N+E+    + + IK +N
Sbjct: 293  NLENEITTLNATLIDKKRESETLKTKTIETNEKIRNIEAEKAELVEFIKTSN 344

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  113 bits (282), Expect = 7e-25
 Identities = 72/183 (39%), Positives = 106/183 (57%), Gaps = 6/183 (3%)
 Frame = +1

Query: 826  DNDKSTIQSD-QTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTI 1002
            D+ K  I+ D +  G YI N+    +T+  +   +L+K  K R  A+T+ N+ SSRSH++
Sbjct: 524  DSQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSV 583

Query: 1003 FTITLFKEV--KGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            F + +       GE  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI 
Sbjct: 584  FMVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIY 642

Query: 1177 SLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
            +L   +    ++PFR SKLT LLQ SL G++KT +   I P    + ET ++L +ASK  
Sbjct: 643  ALNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVN 702

Query: 1348 NIK 1356
            + K
Sbjct: 703  STK 705

 Score = 74.7 bits (182), Expect = 7e-13
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 7/175 (4%)
 Frame = +1

Query: 43  EELNITVAVRCRGR----NQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKT 210
           +EL   + V CR R    N+ + D    ++    +  G++ + IN +E      ++ S  
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINRNE-----GRILSYN 414

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D +F PS T   IF+EI + L    + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 391 LSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDN 546
           L+   G+IP  L  +F+    L E   ++ ++C ++E+YNE + DLL    ++DN
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSHDN 518

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
            KAR3Minus-end-directed microtubule motor that functions
            in mitosis and meiosis, localizes to the spindle pole
            body and localization is dependent on functional Cik1p,
            required for nuclear fusion during mating; potential
            Cdc28p substrate
          Length = 729

 Score =  113 bits (282), Expect = 7e-25
 Identities = 76/192 (39%), Positives = 107/192 (55%), Gaps = 5/192 (2%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            +D+ NK   +   K  I+ DQ T    I N+    + + +    +L+K  K R  AST  
Sbjct: 533  SDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTAS 592

Query: 973  NDFSSRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1149
            N+ SSRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+S
Sbjct: 593  NEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKS 652

Query: 1150 LLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
            L  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET +
Sbjct: 653  LSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLN 712

Query: 1321 TLEYASKAKNIK 1356
            +L +ASK  + +
Sbjct: 713  SLRFASKVNSTR 724

 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 54/184 (29%), Positives = 86/184 (46%), Gaps = 4/184 (2%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQ-REIDAKSSVVVTVPDIMGSKEVAINTSED 177
           + + TV      + +EL   + V CR R   + ++   + ++ V +   +  V       
Sbjct: 367 IKEETVRRTLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTK 426

Query: 178 IGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYT 357
           I  TAQ++   +  DK+F    T   +F E+ + L    + GYN  +  YG T +GKT+T
Sbjct: 427 IQNTAQVHE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 358 MTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG 528
           M          L+   GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  
Sbjct: 484 M----------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRS 533

Query: 529 DCNN 540
           D NN
Sbjct: 534 DNNN 537

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
            Anc_3.479 YPR141C
          Length = 724

 Score =  112 bits (280), Expect = 1e-24
 Identities = 77/197 (39%), Positives = 108/197 (54%), Gaps = 6/197 (3%)
 Frame = +1

Query: 784  SSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
            + GN   +       +DK T+ +  T      N+    +        +L+K  K R  A+
Sbjct: 530  TDGNEAGSPNKHEIRHDKETMTTSVT------NINTIALNNKGIVNNVLKKATKLRATAA 583

Query: 964  TKMNDFSSRSHTIFTITLFKEVKGEIFRLSK---MNLVDLAGSENINRSGALNQRAKEAG 1134
            T  N+ SSRSH++F I L  + K EI   S    +NLVDLAGSE +N S A+  R +E  
Sbjct: 584  TNSNERSSRSHSVFMIYL--KGKNEITGDSSEGILNLVDLAGSERLNSSQAVGARLRETQ 641

Query: 1135 SINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 1305
            +IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP K  L
Sbjct: 642  NINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTLMFVNISPTKSHL 701

Query: 1306 EETCSTLEYASKAKNIK 1356
             ET ++L +ASK  + K
Sbjct: 702  NETINSLRFASKVNSTK 718

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 3/118 (2%)
 Frame = +1

Query: 202 SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 381
           S+ Y  D++F  + + + +F EI + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 382 NEELSDSAGIIPRILFKLFETLEKLNED---HIVKCSFVELYNEELKDLLHGDCNNDN 546
              L+D+ G+IP  +  +F+  E + E    + + C F+E+YNE + DLL  +  + N
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGN 533

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] {ON}
            Anc_2.633 YKL079W
          Length = 644

 Score =  111 bits (278), Expect = 2e-24
 Identities = 97/319 (30%), Positives = 155/319 (48%), Gaps = 20/319 (6%)
 Frame = +1

Query: 862  AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE--VKG 1035
            + I I+NL+  ++T+  E +   +KG   R +AS       SRS  I  IT+ +   VK 
Sbjct: 187  SSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVK- 235

Query: 1036 EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK-------- 1191
            E+F+     LVDL  S+ I++   L    +    INQS++TL  V  SLA          
Sbjct: 236  EVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGR 295

Query: 1192 ----NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK- 1356
                N ++P++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K 
Sbjct: 296  PRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKN 355

Query: 1357 ----NKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQN-Y 1521
                NK    S  M D+L+K+   +    +S  +    K+ + + +  Y   T D QN  
Sbjct: 356  LFQQNKAGTNSKAMLDLLMKDFDAKEKNYQSH-IQLLEKELMNLKKLQYGSETADKQNEI 414

Query: 1522 KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIE 1701
              E ++ K  +ESL SQ       K  ++  N+ +  KI  M   M+K    +E Q  ++
Sbjct: 415  MLENKKLKAQLESL-SQLLHSSSSKANVSTKNDEEHSKI--MGILMEKCEKVMEVQMRLD 471

Query: 1702 NELDGKIQIFTKTNSKLTK 1758
            NE+     + ++   K +K
Sbjct: 472  NEISSNKSLTSQLEFKSSK 490

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 5/116 (4%)
 Frame = +1

Query: 190 AQMNSKTYTVDKVFGPSA-----TQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTY 354
           A  N K + VD++F P A     T S+I D +A+        GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-----LFNGYNVAIMAYGQTDSGKTS 118

Query: 355 TMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL 522
           TM G    YN+      G+  +I F   ET  + N D+ +  S +E+  E ++DLL
Sbjct: 119 TMFG----YNKGDGVINGVCKQI-FTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
            YPR141C (REAL)
          Length = 731

 Score =  112 bits (279), Expect = 2e-24
 Identities = 75/188 (39%), Positives = 105/188 (55%), Gaps = 5/188 (2%)
 Frame = +1

Query: 808  NKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFS 984
            NK     N K  I+ DQ T    I N+    + + +   ++L++  K R  AST  N+ S
Sbjct: 536  NKDDTNTNLKHEIRHDQETKTTMITNVTSCKLESEEMVDRVLKRANKLRSTASTASNEHS 595

Query: 985  SRSHTIFTITLFK-EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1161
            SRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+SL  L
Sbjct: 596  SRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCL 655

Query: 1162 GRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
            G VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET ++L +
Sbjct: 656  GDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRF 715

Query: 1333 ASKAKNIK 1356
            ASK  + +
Sbjct: 716  ASKVNSTR 723

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] {ON}
            Anc_3.479
          Length = 763

 Score =  112 bits (279), Expect = 2e-24
 Identities = 82/202 (40%), Positives = 110/202 (54%), Gaps = 15/202 (7%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKL-----LQKGLKYRQVA 960
            ND     S +++ K  I+ D       Q  +  +ITT K   K+     L++  K R  A
Sbjct: 559  NDLLASPSQSNSTKHEIRHDPET----QTTKVTNITTCKLDSKITVDNILRRANKLRSTA 614

Query: 961  STKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAG 1134
            ST  N+ SSRSH+IF I L    E+ GE      +NLVDLAGSE IN S    +R +E  
Sbjct: 615  STLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINSSQVTGERLRETQ 673

Query: 1135 SINQSLLTLGRVINSLAD--------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISP 1290
            +IN+SL  LG VI++L          K  H+PFR SKLT LLQ SL GN+KT +   ISP
Sbjct: 674  NINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGNSKTLMFVNISP 733

Query: 1291 AKVTLEETCSTLEYASKAKNIK 1356
            +   + ET ++L +ASK  + K
Sbjct: 734  SINYVNETLNSLRFASKVNSAK 755

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 84/374 (22%), Positives = 154/374 (41%), Gaps = 23/374 (6%)
 Frame = +1

Query: 1444 LSTKSKDGIYMDQQHYKEL---TTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINEN 1614
            L++  KD I    Q  +EL    T   N + E+   K    +L S+   L K+K +  + 
Sbjct: 106  LTSFHKDSIVELNQLQEELFQKKTIFDNLRDELNVNKDEYANLQSEWEKLYKEKNSKEQL 165

Query: 1615 NELQRIKIQTMNESM--KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNR-E 1785
             + +  +I+ +NE +  KK Y     Q  ++       Q+  K N++  K+ +E + + E
Sbjct: 166  LKSKENEIRNLNEKLTNKKKYLNEGHQLHLK-------QLEAKNNAEFNKMENEYRLKIE 218

Query: 1786 ALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARD 1965
             L  SK K   D+  + ++K     +E+      N+  T D+ L+++ +++     T ++
Sbjct: 219  KLKQSKIKKFEDNRNALLNK-----VEDIS----NKILTNDDTLKVMLADVEEKNRTIKE 269

Query: 1966 NF-EKFYQECIT------KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL---- 2112
             + +K++ E  T      K  ++   L + I   +        +    + E L DL    
Sbjct: 270  EWLQKYHAEWKTNLEINEKITNEVGSLNERIEKELEPKAKAQKSEIKNLKEKLDDLQNIL 329

Query: 2113 ----SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEH 2280
                SE  N   + + ++   +EK  +   L  YI NT+  ++             +NE 
Sbjct: 330  KTTQSESSNLESEILENDLKVEEKLRRKVELEDYIENTEVDLKE------------INEI 377

Query: 2281 LRANKELIINSLSNVTTELMSN--ELDRLKPKLSKWEESAELINRSDALNNEFNDNVESS 2454
            L   +E +  SL N   EL  N     R++P +   E +    N S    +EF+DN   +
Sbjct: 378  L-IKEETMRRSLHNTLQELRGNIRVYCRIRPPILPQESN----NTSHLKVSEFDDN-NGT 431

Query: 2455 MTTMTDKIKQTNDS 2496
             T    K    N S
Sbjct: 432  QTLEIQKALNNNSS 445

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
            Anc_3.479 YPR141C
          Length = 704

 Score =  111 bits (278), Expect = 2e-24
 Identities = 79/191 (41%), Positives = 107/191 (56%), Gaps = 6/191 (3%)
 Frame = +1

Query: 802  SANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMND 978
            SA+      N K  I+ +Q T    I N+    +T+     +LL++  K R  AST  N+
Sbjct: 507  SASGDDTNSNTKLEIRHNQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNE 566

Query: 979  FSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSL 1152
             SSRSH+IF + L  E  + GE      +NLVDLAGSE IN S  + +R +E  SIN+SL
Sbjct: 567  RSSRSHSIFIVHLSGENVLTGERSH-GILNLVDLAGSERINTSQVIGERLRETQSINKSL 625

Query: 1153 LTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCST 1323
              LG VI++L   +    H+PFR SKLT LLQ SL GN+KT +   IS       ET ++
Sbjct: 626  SCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNS 685

Query: 1324 LEYASKAKNIK 1356
            L +ASK  + K
Sbjct: 686  LRFASKVNSTK 696

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 41/123 (33%), Positives = 59/123 (47%), Gaps = 9/123 (7%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D++F    T   +F EI + L    + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 391 LSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLH------GDCNND 543
           L+ + GIIP  +  +F   + L E    + V C FVE+YNE + DLL       G  + D
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLLRREEKPAGSASGD 511

Query: 544 NGN 552
           + N
Sbjct: 512 DTN 514

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
            (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  110 bits (276), Expect = 3e-24
 Identities = 101/368 (27%), Positives = 175/368 (47%), Gaps = 44/368 (11%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ +  L E    + +E +  ++ G K+R+ +ST  N  SSRSH I  I L  
Sbjct: 223  IRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLIS 282

Query: 1024 E--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK-- 1191
                 GE+   S ++L DLAGSE +    A ++R +E   IN+SLL LG VI+ L+ +  
Sbjct: 283  SDLSSGEVVT-STLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVN 338

Query: 1192 -------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 1350
                   N H+P+R+SKLTR+LQ +L GN+    I TI  +     E+ +TL +AS+AKN
Sbjct: 339  NSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKN 398

Query: 1351 IK----NKPQLGSF---IMKDILLKNITTEL--TKIKSDLLSTKSKDGIYMDQQ----HY 1491
            +      K  + ++     KD +++++  +L   KIK + +        + D +     Y
Sbjct: 399  VSLHVVKKSSISAYDANDQKDRIIESLVQQLQEQKIKIEAMENNYNINSFGDNETITSSY 458

Query: 1492 KELTTDLQN----YKTEIQECKRTIESLTSQNALLLKDKRTIN-------ENNELQRIKI 1638
                  L+N     + +++ C+R ++  T++    L DK   N       E   L   K 
Sbjct: 459  DPSVALLENENKILRYKLEHCERLLDKDTNE----LHDKEIANIADILPLEIGMLLETKF 514

Query: 1639 QTMNESMK--KLYAKIERQQSIENELDGKIQIFTKTNSKL-------TKIIDEMKNREAL 1791
            Q +   ++  K Y     ++ +E   + K  + T ++  +       T+ +D +  ++A 
Sbjct: 515  QGLESQIREFKNYTDNLEKEIMEKNTNKKRILSTSSDLSMKDIDDCETEKLDSINPKDAE 574

Query: 1792 VNSKFKTL 1815
            +    KTL
Sbjct: 575  IAELKKTL 582

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 12/167 (7%)
 Frame = +1

Query: 67  VRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKT--------YTVD 222
           +R R  N   ++   S   T+   + +K V IN  E   +  +  +KT        YT D
Sbjct: 51  IRIRKTNHGNLN-NDSYNGTISVSIRTKPVGIN--EKCNWYVETENKTIIHTDIGEYTYD 107

Query: 223 KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
            VF P A+   ++    +PL      G+N T+  YGMT +GKTYTM+G        +  +
Sbjct: 108 NVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG--------VDGN 159

Query: 403 AGIIP----RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGD 531
           AG+IP     +  K+F++    N+ +    S++E+YNE++ DLL  D
Sbjct: 160 AGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETD 206

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8.678
            YPL155C
          Length = 637

 Score =  110 bits (276), Expect = 3e-24
 Identities = 91/328 (27%), Positives = 157/328 (47%), Gaps = 30/328 (9%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ I  L E    +++E  + +Q G K R+ + T  N  SSRSH I  + L  
Sbjct: 243  IRDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNN 302

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK--- 1191
             +++      S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI+ L+ +   
Sbjct: 303  TDLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLS 359

Query: 1192 ---------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTL 1326
                           N H+P+R+SKLTR+LQ +L GN+    I TI        ET +T+
Sbjct: 360  KNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTI 419

Query: 1327 EYASKAKN----IKNKPQL--GSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH 1488
             +AS+AKN    +  +P +  GS+  KD  ++N+T +L K    ++  K +  +     H
Sbjct: 420  RFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSM-TSSSH 478

Query: 1489 YKELTTD----LQNYKTEIQECK-RTIESLTSQNALLLKDKRTINENNELQRIKIQTMNE 1653
              + T D    L   +  + +CK    E L  ++ + L+D   +   + L       +  
Sbjct: 479  NDDSTVDPNSTLLKAENRVLKCKLSNCEKLLDKDTIELEDSEMVAIIDMLPIDVGSVLET 538

Query: 1654 SMKKLYAKIERQQSIENELDGKIQIFTK 1737
              + L +++ + +    +L+ K+  F +
Sbjct: 539  KFQGLESQLRQYKEYTKQLEFKLMNFDR 566

 Score = 75.5 bits (184), Expect = 4e-13
 Identities = 41/116 (35%), Positives = 66/116 (56%), Gaps = 4/116 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +T D+VF  + T   I++  + P+    ++G+N T+  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 391 LSDSAGIIP----RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDN 546
             D AG+IP     +  K+ E   +    + V  S++E+YNE++ DLL  DC ++N
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLL--DCESEN 217

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
            complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  110 bits (276), Expect = 4e-24
 Identities = 73/183 (39%), Positives = 103/183 (56%), Gaps = 6/183 (3%)
 Frame = +1

Query: 826  DNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIK-LLQKGLKYRQVASTKMNDFSSRSHTI 1002
            +N +  I+ D    I      +  I  +K+ +  L++K  K R  A+T  N+ SSRSH+I
Sbjct: 505  NNGRHDIRHDSDKRITTITNIKTSILKSKDSVDFLIKKATKLRATATTAANERSSRSHSI 564

Query: 1003 FTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1176
            F I L     + GE      +NLVDLAGSE +N S     R +E  +IN+SL  LG VI+
Sbjct: 565  FIIHLRGSNNITGES-SYGILNLVDLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIH 623

Query: 1177 SLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
            +L   +    H+PFR SKLT LLQ SL GN+KT +   ISP +  ++ET ++L +ASK  
Sbjct: 624  ALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVN 683

Query: 1348 NIK 1356
              K
Sbjct: 684  TTK 686

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 3/107 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D++F        +FDEI + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 391 LSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL 522
           L+ + G+IP  +  +F+  + L E   ++ V C FVE+YNE + DLL
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 731

 Score =  110 bits (274), Expect = 7e-24
 Identities = 74/185 (40%), Positives = 105/185 (56%), Gaps = 9/185 (4%)
 Frame = +1

Query: 829  NDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIF 1005
            N K  I+ +Q T    + N+    + + ++   LL+K  + R  AST  N+ SSRSH++F
Sbjct: 533  NAKHEIRHNQETNTTTVTNVTLCPLNSEEQVDGLLRKANRLRSTASTSANERSSRSHSVF 592

Query: 1006 TITLFKEVKGEIFRLSK-----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 1170
             I L    KG      +     +NLVDLAGSE IN S  L +R +E  +IN+SL  LG V
Sbjct: 593  IIFL----KGSNHLTGEQSDGILNLVDLAGSERINSSQVLGERLRETQNINKSLSCLGDV 648

Query: 1171 INSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 1341
            +++L   +    H+PFR SKLT LLQ SL GN+KT +   IS  +  L ET ++L +ASK
Sbjct: 649  VHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISACESHLNETLNSLRFASK 708

Query: 1342 AKNIK 1356
              + K
Sbjct: 709  VNSTK 713

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 56/192 (29%), Positives = 92/192 (47%), Gaps = 6/192 (3%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTV---PDIMGSKEVAINTS 171
           + + T+      + +EL   + V CR R   + +  ++  +TV    D  G + + I  S
Sbjct: 358 IKEETMRRSLHNELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKS 417

Query: 172 EDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKT 351
            + G +   N K    D++F  + T   +F+EI + L    + GYN  +  YG T +GKT
Sbjct: 418 NNTGNSIPQNFK---FDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKT 473

Query: 352 YTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL 522
           YTM          L+   GIIP  +  +F  +E L E   ++ + C F+E+YNE + DLL
Sbjct: 474 YTM----------LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

Query: 523 HGDCNNDNGNFK 558
             D ++   N K
Sbjct: 524 RSDQDDIQANAK 535

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 123/573 (21%), Positives = 228/573 (39%), Gaps = 39/573 (6%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKS-TIQSDQTAGIYIQNLQEFHITTA-KEGIK---LLQKGLKYRQV 957
            N+D+ N  +  +N K+ TI    T   Y  N   FH+T+  KE I+    LQ  L  ++ 
Sbjct: 52   NHDNNNDNNNNNNSKNQTISRGATGTSYRSN---FHLTSFYKENIRDLNQLQDSLFQKKA 108

Query: 958  ASTKMNDFSSRSHTIFTITLFK--------EVKGEIFRLSKMNLVDLAGSENINRSGALN 1113
                + D  S  +  +    FK         +K +   L    L  L   E + ++G L 
Sbjct: 109  QMDVLLDELSECNGKYKNIEFKWEDLKEERSLKNQQMNLKNNELARLK-EELVTKNGFLE 167

Query: 1114 Q---------RAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKT 1266
            Q         RAK    IN+        +  L  K   V   E++   LL        + 
Sbjct: 168  QGHQLHLQQLRAKNDADINKMENEYRVQLERL--KFAKVKKFENERNSLLDKV--EEVRN 223

Query: 1267 ALIATISPAKVTLEETCSTLEYASKA-------KNIKNKPQLGSFIMKDILLKNITTELT 1425
             +I   +  +  L E C T  Y +K        KN K   Q+      D+ +  +  ++ 
Sbjct: 224  NIITNETNLQNMLRE-CETNHYRAKENWLQDYQKNWKENVQMNENFSNDVTV--LGQQIK 280

Query: 1426 KIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI 1605
             +     + K ++   + +   + L   L+  + + Q  KR I+ +  +     + ++ +
Sbjct: 281  TVLEPQCNEKMQEVAAL-RGKLQNLQNSLKQRQDDTQSMKRQIDEIKGKTVQTKRKRQEL 339

Query: 1606 NENNELQRIKIQTMNESMKKLYAKIERQQSIENELD---GKIQIFTKTNSKLTKIIDEMK 1776
            ++     + ++Q ++E + K   +   ++S+ NEL    G I++F +    L     E  
Sbjct: 340  HDYIHNTKSELQQIDEILIK---EETMRRSLHNELQELRGNIRVFCRIRPPLKY---ENP 393

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQI---ENFK-DQGINQNFTVDENLQLIKSEMTN 1944
            N   L  +KF          + K  N      +NFK D+  +QN T +EN   +  E+  
Sbjct: 394  NTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQNFKFDRIFDQNET-NEN---VFEEIGQ 449

Query: 1945 LLSTARDNFEKFYQECITKF-LSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEE 2121
            L+ ++ D     Y  CI  +  + +   +  +N     + A  S+ +S I ENL +    
Sbjct: 450  LVQSSLDG----YNVCIFAYGQTGSGKTYTMLNPRNGIIPATISHIFSWI-ENLKERGWN 504

Query: 2122 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL 2301
            Y    QFI  E YN+              N   ++ S  +D+ +  ++     +R N+E 
Sbjct: 505  YEINCQFI--EIYNE--------------NIADLLRSDQDDIQANAKH----EIRHNQET 544

Query: 2302 IINSLSNVTTELMSNE--LDRLKPKLSKWEESA 2394
               +++NVT   +++E  +D L  K ++   +A
Sbjct: 545  NTTTVTNVTLCPLNSEEQVDGLLRKANRLRSTA 577

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 706

 Score =  109 bits (272), Expect = 1e-23
 Identities = 74/193 (38%), Positives = 106/193 (54%), Gaps = 5/193 (2%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 972
            NND+ +      ++    Q  QT   ++ N+    +T       LL++  K R  A+T  
Sbjct: 512  NNDTEDITESLKHEIRHDQESQTT--HVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGS 569

Query: 973  NDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQ 1146
            N+ SSRSH++F I L  +    GE  +   +NLVDLAGSE IN S     R +E  +IN+
Sbjct: 570  NERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINK 628

Query: 1147 SLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            SL  LG VI++LA  +    H+PFR SKLT LLQ SL G++KT +   ISP      ET 
Sbjct: 629  SLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETL 688

Query: 1318 STLEYASKAKNIK 1356
            ++L +ASK  + +
Sbjct: 689  NSLRFASKVNSTR 701

 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 51/170 (30%), Positives = 79/170 (46%), Gaps = 3/170 (1%)
 Frame = +1

Query: 43  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 222
           +EL   + V CR R   + +   S  V + ++    E     ++ +  T       +  D
Sbjct: 362 QELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSKKHEFKFD 416

Query: 223 KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 402
           K+F P  +   IF+EI + L    + GYN  +  YG T +GKTYTM          L   
Sbjct: 417 KIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LHPQ 465

Query: 403 AGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNND 543
            G+IP  L  +F+ +  L E   ++ +   F+E+YNE + DLL G  NND
Sbjct: 466 NGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRG-LNND 514

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 690

 Score =  108 bits (269), Expect = 2e-23
 Identities = 66/164 (40%), Positives = 98/164 (59%), Gaps = 3/164 (1%)
 Frame = +1

Query: 874  IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF--KEVKGEIFR 1047
            I N+    + T      +L+   K + +A+T  N+ SSRSH++FTI +     + GE   
Sbjct: 524  ITNVTSIKLETRARVNTVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD 583

Query: 1048 LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV-HVPFRESKL 1224
               +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI +L  K++ H+PFR SKL
Sbjct: 584  -GVLNLVDLAGSERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKL 642

Query: 1225 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 1356
            T LLQ SL G++KT +   +SP+   ++ET ++L +ASK  + K
Sbjct: 643  TYLLQYSLIGDSKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 50/165 (30%), Positives = 79/165 (47%), Gaps = 3/165 (1%)
 Frame = +1

Query: 37  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 216
           QE   NI V  R R   + E+   S + V+  D     +    ++ED        +  + 
Sbjct: 353 QELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNED-------RNSRFL 405

Query: 217 VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 396
            DKVF  +A+   +F+E+ + L    + GYN  +  YG T +GKTYTM          ++
Sbjct: 406 FDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------MN 454

Query: 397 DSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL 522
           D  G+IP  L  +F+    L E   D+  +  F+E+YNE++ DLL
Sbjct: 455 DPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

 Score = 48.5 bits (114), Expect = 8e-05
 Identities = 72/303 (23%), Positives = 128/303 (42%), Gaps = 2/303 (0%)
 Frame = +1

Query: 1585 LKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKII 1764
            LK+   + E    ++IK+ T  + M  L +K+E  +   N L  + Q+      K+ +I 
Sbjct: 74   LKELNRLQEELSRKKIKLNTAQDEMNSLKSKVETVEFKMNNLKEEKQV------KVRQI- 126

Query: 1765 DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 1944
              +K  E  +NS  +   DH L     +  + +E  K +G   +  ++E     K E+  
Sbjct: 127  -GLKQNE--LNSMDQ---DHELKLEFMRNGFDLEIKKIEG-KYHCEMNETESKFKFEVQQ 179

Query: 1945 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 2124
            +     +  +KF QE     L D   L DE+N+N         N  +Q+ E   +L ++Y
Sbjct: 180  I---EFEKIQKFKQEK-EHLLKDIHNLNDEVNNN--------DNVINQLKE---ELDKKY 224

Query: 2125 NNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 2304
            +N K+    EF  + K                       ++    Q+++ +         
Sbjct: 225  SNLKEKWMVEFQTEWK-----------------------NITEANQSMIKD--------- 252

Query: 2305 INSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALN--NEFNDNVESSMTTMTDKI 2478
            IN LS      M+NELD+ K K +  E+  EL    + LN  N F +++   + T+ ++I
Sbjct: 253  INKLSQDIENDMTNELDQSKDKRNILEK--ELAKLEEKLNEKNVFKESITVQIDTVEEEI 310

Query: 2479 KQT 2487
            +QT
Sbjct: 311  EQT 313

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
            YPL155C
          Length = 625

 Score =  107 bits (268), Expect = 3e-23
 Identities = 101/389 (25%), Positives = 175/389 (44%), Gaps = 55/389 (14%)
 Frame = +1

Query: 829  NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 1008
            N++  ++ D   G+ +  + E    TA+E +K +  G   R+   T  N  SSRSH I  
Sbjct: 230  NEELKVRDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQ 289

Query: 1009 ITLFK-EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA 1185
            + L    +       + ++L DLAGSE  +      +R KE   IN+SLL LG VI+ L+
Sbjct: 290  VKLITTNLLNGTTHFNTLSLCDLAGSEKASEQ---LERRKEGSFINKSLLALGTVISKLS 346

Query: 1186 DK---------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 1320
             +               N H+P+R+SKLTRLLQ +L  ++    I TI P K  + ET +
Sbjct: 347  AESNAHDSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVN 406

Query: 1321 TLEYASKAKNIKNKPQLGSF--------IMKDILLKNIT---TELTKIKSDLLSTKSKDG 1467
            TL +AS+AKN+       S           KD  ++++T    E   I S+L   +   G
Sbjct: 407  TLRFASRAKNVSLNVSRKSISYRPDSQDAEKDKRVRSLTKLVEEQDLIISNLKKQQQHAG 466

Query: 1468 IYMDQQHYKELTTDLQN--YKTEIQECKRTIESLTSQNALLLKDKRTIN-------ENNE 1620
              + + + +    + +N   + ++Q C+R +++    +++ L+D + +        E   
Sbjct: 467  SALQRPNSRTALLEAENRVLRDKLQHCERLLDN----DSVELQDSQIMEIVDFLPPEVGV 522

Query: 1621 LQRIKIQTMNES-------MKKLYAKIE------------RQQSIENELDGKIQIFTKTN 1743
            L   K Q++           K+L AKI               Q+   E + KI    +  
Sbjct: 523  LLETKFQSLESENRQYRNYTKQLEAKIASGGDNSDTPAALTLQTNLAERESKIHELLQML 582

Query: 1744 SKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
             +  K+ID +++ + L N   + + D+S+
Sbjct: 583  DRKDKMIDALQSSKRLRNRALRPIADNSI 611

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 38/118 (32%), Positives = 61/118 (51%)
 Frame = +1

Query: 190 AQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 369
           A  +   +  D VFGP+AT   +F E+   L      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 370 EKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 543
              +N+ +    G    +  ++    ++      V  S++E+YNE++ DLL+ +C N+
Sbjct: 179 ---HNDGIVKMCG--DCVFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRNE 231

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
            Anc_8.678
          Length = 655

 Score =  107 bits (267), Expect = 4e-23
 Identities = 75/218 (34%), Positives = 112/218 (51%), Gaps = 20/218 (9%)
 Frame = +1

Query: 784  SSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 963
            S G      +      ++  I+ D   G+ +  L+E    +++E +K +++G  +R+ A 
Sbjct: 251  SRGFGSGGGRNESVSTNELKIRDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAE 310

Query: 964  TKMNDFSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGS 1137
            T  N  SSRSH I  I L     + G     S ++L DLAGSE   R+    +R KE   
Sbjct: 311  TDYNARSSRSHAIVLIRLTNTNVIDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAF 366

Query: 1138 INQSLLTLGRVINSL--------------ADKNVHVPFRESKLTRLLQDSLGGNTKTALI 1275
            IN+SLL LG VI+ L              A+ N H+P+R+SKLTR+LQ +L G++    I
Sbjct: 367  INKSLLALGTVISKLSAESTAASHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTI 426

Query: 1276 ATISPAKVTLEETCSTLEYASKAKN----IKNKPQLGS 1377
             TI   K +  ET +TL +AS+AKN    +  KP + S
Sbjct: 427  CTIDTQKESAAETLNTLRFASRAKNVSLHVNRKPLMNS 464

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 35/111 (31%), Positives = 57/111 (51%), Gaps = 4/111 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D V+ P  +   I++ I +P+     +G+N T+  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGS----GGD 190

Query: 391 LSDSAGIIPRILFKLFETLEKL----NEDHIVKCSFVELYNEELKDLLHGD 531
             D  G+IP  +  LF  + ++         V  S++E+YNE + DLL  +
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDSE 241

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141C KAR3 Minus-end-directed microtubule motor that
            functions in mitosis and meiosis localizes to the spindle
            pole body and localization is dependent on functional
            Cik1p required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 702

 Score =  106 bits (265), Expect = 8e-23
 Identities = 65/167 (38%), Positives = 100/167 (59%), Gaps = 5/167 (2%)
 Frame = +1

Query: 871  YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIF 1044
            +I N+    +T+ +   ++L++ LK R  A+T  N  SSRSH++F I L  +  + GE  
Sbjct: 532  HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 1045 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRE 1215
                +NLVDLAGSE I+      +R +E  +IN+SL  LG VI++L   +    H+PFR 
Sbjct: 591  STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 1216 SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 1356
            SKLT LLQ SL G++KT +   +SP   ++ ET ++L +A+K  + K
Sbjct: 651  SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 59/197 (29%), Positives = 90/197 (45%), Gaps = 7/197 (3%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
           + + T+      + +EL   + V CR R   E +  SS  + +     S E  + +    
Sbjct: 344 LKEETMRRKLHNELQELRGNIRVFCRLRPALENENYSSSSIEIEKF--SDETGMQS---- 397

Query: 181 GFTAQMNSKT--YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTY 354
             T + +SK   +T D+ F    T   +F EI + L    + GYN  +  YG T +GKT+
Sbjct: 398 -ITIKRDSKQHKFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTF 455

Query: 355 TMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL- 522
           TM          L+ + GIIP  L  +F  +EKL E    + +   FVE+YNE +KDL  
Sbjct: 456 TM----------LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFK 505

Query: 523 HGDCN-NDNGNFKKLRI 570
             D + +D G   K  I
Sbjct: 506 ENDADVDDTGESLKFEI 522

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  105 bits (263), Expect = 1e-22
 Identities = 115/446 (25%), Positives = 190/446 (42%), Gaps = 36/446 (8%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 1020
            I+ D   G+ +  L +    T++E +  + KG K R+ + T+ N  SSRSH I  I L  
Sbjct: 261  IRDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLIS 320

Query: 1021 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
            K+++     +  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+ L+ +N  
Sbjct: 321  KDIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNG 377

Query: 1198 ------------------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 1305
                                    H+P+R+SKLTRLLQ +L G++    + TI  A  + 
Sbjct: 378  SHHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESS 437

Query: 1306 EETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQ 1485
             ET +TL +AS++KN+         +    + K I        S    +K   G    +Q
Sbjct: 438  SETLNTLRFASRSKNVA--------LDVSRVYKRINRSAHPFSS---PSKLDGGDDRSEQ 486

Query: 1486 HYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKK 1665
              +EL   LQ    E+ + +     + S          T+N   +      Q + +    
Sbjct: 487  RIQELLIQLQTRDRELAKLREVSAGVAS---------GTMNGAQQNLHPDTQLLTKENLL 537

Query: 1666 LYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSK 1845
            L  K++  +S+  E DG        +   T+      +   LV+S     LD+   Y   
Sbjct: 538  LKNKLKHYESLLVE-DG-----MGVSGASTRNTSNSSSSSTLVSS--SPALDNKGRYAGT 589

Query: 1846 KLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK------FYQECITKFL 2007
                        G++    ++E  QL+ SE+  +L T  DN  +       Y E + K L
Sbjct: 590  ---------NSTGVDAE--LEEIAQLLPSEVAVMLETKFDNLRRQLQSAHRYSESLEKQL 638

Query: 2008 SDTPLLFDEINDNVLN----LKALTS 2073
            +D+    +++  ++      ++ALTS
Sbjct: 639  NDSHTETEQLKRSLQTKDKLIEALTS 664

 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 42/108 (38%), Positives = 61/108 (56%), Gaps = 4/108 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +T D VF    +   I+ +  +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 391 LSDSAGIIPRILFKLFET-LEKL---NEDHIVKCSFVELYNEELKDLL 522
             +  G+IP  +  LF + LEK    NE   V  S++E+YNE++ DLL
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL 232

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 678

 Score =  105 bits (263), Expect = 1e-22
 Identities = 87/315 (27%), Positives = 147/315 (46%), Gaps = 17/315 (5%)
 Frame = +1

Query: 808  NKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSS 987
            +K  P    +  ++ D   G+ +  L E  + ++++ ++ ++ G   R+   T  N  SS
Sbjct: 255  SKNVPGAGAELPVRDDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSS 314

Query: 988  RSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 1164
            RSH I TI +   E+       S ++L DLAGSE   R+   ++R KE   IN+SLL LG
Sbjct: 315  RSHAIVTIKVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALG 371

Query: 1165 RVINSLADK----------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 1296
             VI+ L+                  N HVP+R+SKLTR+LQ +L G++    I TI    
Sbjct: 372  TVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKP 431

Query: 1297 VTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYM 1476
              + ET +T+ +AS+AKN+             + +K    E T  K +LL +  +    +
Sbjct: 432  DAMSETVNTIRFASRAKNV------------SMTVKRNEAEATHDKDELLHSLRRQ---L 476

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 1656
            D+Q  ++L  +L+  +    +       L     +L+     +   NE  + K+Q     
Sbjct: 477  DEQ--QDLICELRRAQPPADQSSCEATPLGPSATVLM-----LRRENETLKKKLQHCERL 529

Query: 1657 MKKLYAKIERQQSIE 1701
            + K  A +E +Q +E
Sbjct: 530  LDKDDAAVEDEQFVE 544

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 3/105 (2%)
 Frame = +1

Query: 220 DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 399
           DKVF P      +++EI +P+     +GYN T+  YGMT +GKT+TM+G          D
Sbjct: 143 DKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR--------D 194

Query: 400 SAGIIPRILFKLFETLEK---LNEDHIVKCSFVELYNEELKDLLH 525
            AG+I   + ++F  + K    N+ + V+ S++E+YNE++ DLL+
Sbjct: 195 EAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa] {ON}
            complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  104 bits (259), Expect = 4e-22
 Identities = 61/144 (42%), Positives = 97/144 (67%), Gaps = 4/144 (2%)
 Frame = +1

Query: 922  KLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSK-MNLVDLAGSENINR 1098
            +L+Q+  K R+ A T MN+ SSRSH++F + +    K    R    +NLVDLAGSE +NR
Sbjct: 550  ELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLAGSERMNR 609

Query: 1099 SGALN-QRAKEAGSINQSLLTLGRVINSL--ADKNVHVPFRESKLTRLLQDSLGGNTKTA 1269
            SG ++ +R +E   IN+SL ++G VI++L     ++H+PFR +KLT LL+ SL G++KT 
Sbjct: 610  SGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTL 669

Query: 1270 LIATISPAKVTLEETCSTLEYASK 1341
            ++ T+SP+  +  ET ++L +A+K
Sbjct: 670  MLVTVSPSNSSRNETMNSLRFATK 693

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 3/193 (1%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
           + D T+      Q +EL   + V CR R   + D     V       G++ + +    DI
Sbjct: 343 VKDETLRRKVHNQIQELRGNIRVFCRVRPTDD-DTNIIKVHGFDSDTGTQSLTL----DI 397

Query: 181 GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
                  S  +  DK+F    +   +F E+ E L    + G+N  +  YG T +GKTYTM
Sbjct: 398 KRPMTNGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM 456

Query: 361 TGDEKLYNEELSDSAGIIPRILFKLFE---TLEKLNEDHIVKCSFVELYNEELKDLLHGD 531
                     L++  GIIP  L  + +   +++KL   + +K  FVE+YN+ + DLL   
Sbjct: 457 ----------LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLL--- 503

Query: 532 CNNDNGNFKKLRI 570
            N+  G  K+  +
Sbjct: 504 -NDGKGKHKECEV 515

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
            Ashbya gossypii AGR253W
          Length = 711

 Score =  103 bits (257), Expect = 7e-22
 Identities = 63/166 (37%), Positives = 97/166 (58%), Gaps = 5/166 (3%)
 Frame = +1

Query: 874  IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFR 1047
            I N+ +  +T+ ++   +L++  + R  A T+ N+ SSRSH++F + +    +  GE+  
Sbjct: 543  ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH 602

Query: 1048 LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRES 1218
              K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI +L   +    H+PFR S
Sbjct: 603  -GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 1219 KLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 1356
            KLT LLQ SL G++KT +   I   +    ET ++L +ASK  + K
Sbjct: 662  KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 42/118 (35%), Positives = 61/118 (51%), Gaps = 3/118 (2%)
 Frame = +1

Query: 202 SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 381
           S  +  DK+F P  T + +F EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 382 NEELSDSAGIIPRILFKLFETLEKLNED---HIVKCSFVELYNEELKDLLHGDCNNDN 546
              L+   G+IP  L  +F+  E L E    + + C ++E+YNE + DLL    +NDN
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSNDN 520

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
            similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  103 bits (256), Expect = 9e-22
 Identities = 93/360 (25%), Positives = 165/360 (45%), Gaps = 38/360 (10%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ + +L E  + +  E IK +  G K R+   T  N  SSRSH I  + L +
Sbjct: 268  IRDDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTR 327

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
             E+K      S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L+  +  
Sbjct: 328  CELKTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAG 384

Query: 1198 ---------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
                           H+P+R+SKLTR+LQ +L G++    I TI     +  ET +T+ +
Sbjct: 385  SGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRF 444

Query: 1333 ASKAKNIK---NKPQLGSFIMKDILLKNITTELTKIKSDLLSTK---------------S 1458
            AS+AKNI     K ++ +   KD +++N+  +L +  + + + +               S
Sbjct: 445  ASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQLDEQHATIAALRRNNSTSSRKLDNRRVS 504

Query: 1459 KDGIYMDQQHYKE---LTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQR 1629
              G   ++ H  E   L  +    KT+++ C    E L  ++ ++L+D       + L +
Sbjct: 505  SGGSLTERAHNMEKGLLEVENNILKTKLEHC----EKLLDKDMVVLEDPHVREIVDMLPQ 560

Query: 1630 IKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFK 1809
                 +   ++ + +++ + +     L+  +    K+   + +      NR++ VN + K
Sbjct: 561  DIASVLESKVQGMESQLRQYRHYVQRLESDL---IKSQKNIIETHTVQFNRQSTVNIQEK 617

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 5/109 (4%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF    T S ++  + +P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 391 LSDSAGIIPRILFKLF-----ETLEKLNEDHIVKCSFVELYNEELKDLL 522
                G+IP  +  +F     ET +     + VK S++E+YNE++ DLL
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 654

 Score =  102 bits (255), Expect = 1e-21
 Identities = 81/232 (34%), Positives = 117/232 (50%), Gaps = 25/232 (10%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            ++ D   G+ I  L E    ++ E +K ++ G K R+   T  N  SSRSH I  I L K
Sbjct: 254  LREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTK 313

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
             ++K      S ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ ++  
Sbjct: 314  TDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTS 370

Query: 1198 ------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 1341
                        H+P+R+SKLTR+LQ +L GN     I TI        ET +TL +AS+
Sbjct: 371  HRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASR 430

Query: 1342 AKNIK----NKPQL-------GSFIMKDILLKNITTELTKIKSDLLSTKSKD 1464
            AKN+      KP L       G    KD  + ++T +L   +  LL  K +D
Sbjct: 431  AKNVSLHIFRKPLLPSMSGSNGIVEEKDKTIMSLTRQLE--EQQLLIGKLRD 480

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 4/115 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF  +     ++ + ++P+     +G N T+  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 391 LSDSAGIIPRILFKLFETL--EKLNED--HIVKCSFVELYNEELKDLLHGDCNND 543
             ++ G+IP  +  L+  +  E L  D    +  S++E+YNE++ DLL  DC N+
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLL--DCENE 226

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
            YPL155C
          Length = 696

 Score =  102 bits (254), Expect = 2e-21
 Identities = 77/254 (30%), Positives = 127/254 (50%), Gaps = 27/254 (10%)
 Frame = +1

Query: 808  NKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSS 987
            N F+ A + +  I+ D   GI +  L E   ++  + +K ++ G K ++++ T+ N  SS
Sbjct: 231  NSFNSAQDLR--IRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSS 288

Query: 988  RSHTIFTITLFK-EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 1164
            RSH+I  + L   +++  I   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG
Sbjct: 289  RSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALG 345

Query: 1165 RVINSLADK-------------------NVHVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
             VI  L+ +                   N H+P+R+SKLTR+LQ +L GN+    I T+ 
Sbjct: 346  TVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVD 405

Query: 1288 PAKVTLEETCSTLEYASKAKNIK----NKPQLGSFIMKDILLKNITTEL---TKIKSDLL 1446
                   ET +TL +AS+AKN+      K  +     KD L+  +  +L    K+  D+ 
Sbjct: 406  IRSDASSETLNTLRFASRAKNVSLHVTKKQNVSKDEEKDKLIFTLIQQLEEQKKLIDDMN 465

Query: 1447 STKSKDGIYMDQQH 1488
              K    +   ++H
Sbjct: 466  VNKMSGNVLNFEKH 479

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 40/119 (33%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           + +D++F    +   I+ E+ +PL      GYN T+  YGMT +GKT+TM+G +      
Sbjct: 109 FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQ------ 162

Query: 391 LSDSAGIIPRILFKLFETLEKLN----EDHIVKCSFVELYNEELKDLLHGDCNNDNGNF 555
             +  G+IP  +  LF T+ + N    + + +  S++E+YNE+L DLL  D N +  NF
Sbjct: 163 --EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLL--DTNVEGVNF 217

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
            YPL155C (REAL)
          Length = 704

 Score =  100 bits (250), Expect = 5e-21
 Identities = 102/358 (28%), Positives = 164/358 (45%), Gaps = 52/358 (14%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ +  L E    +++E +K +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295  IRDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTS 354

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-ADK-- 1191
             +++    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK  
Sbjct: 355  TDLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKIN 411

Query: 1192 ----------------------------NVHVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
                                        N H+P+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412  PTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 1288 PAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM-------KDILLKNITTEL---TKIKS 1437
                   ET +TL +AS+AKN+       S I        KD  ++ +  +L    ++ S
Sbjct: 472  TRNDAAAETINTLRFASRAKNVALHVSKKSIISNGNNDGDKDRTIEMLRRQLEDQRRLIS 531

Query: 1438 DLLSTKSKD------GIYMDQQHYKELTTDLQNYKTEIQECKRTIES---LTSQNALLLK 1590
            DL    S D       I  + ++   +  +L   K E +  K  +E+   L  ++ + L+
Sbjct: 532  DLKGRPSPDEGPSQFSIDSNIKNNGAVDPNLALMKAENRILKYKLENCEKLLDKDVVDLQ 591

Query: 1591 DKRTINENNELQRIKIQTMNES-MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI 1761
            D   I E  E+   ++ T+ E+  + L ++I + +    +L+ KI    K  +  T +
Sbjct: 592  DSEII-EIVEMLPFEVGTLLETKFQGLESQIRQYRKYTQKLEDKIMTLEKPGNTATSL 648

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 4/108 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF    T   +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 391 LSDSAGIIPRILFKLFETLEKL----NEDHIVKCSFVELYNEELKDLL 522
                G+IP  +  LF  + +L    ++   V  S++E+YNE + DLL
Sbjct: 218 ---ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLL 262

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
            complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  100 bits (249), Expect = 6e-21
 Identities = 102/366 (27%), Positives = 162/366 (44%), Gaps = 22/366 (6%)
 Frame = +1

Query: 865  GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK-GEI 1041
            G  ++NL+   + T +E +K+L       Q    + N+   RSHTI  +++ K  K  E 
Sbjct: 192  GFQVENLRTTQVLTLEE-LKILINICLLNQ--KERHNNLIQRSHTIMEVSIEKRNKLDES 248

Query: 1042 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKN--------- 1194
              +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L   N         
Sbjct: 249  ITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDI 308

Query: 1195 ---VH-VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNK 1362
               +H VP++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+    
Sbjct: 309  STLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTN 368

Query: 1363 PQLGSFIMKDILLKNITTELTKIKSD---LLSTKSKDGIYMDQQHYKELTTDLQNYKTEI 1533
            P++  F +      +I     K+K D    ++    + +         L  +L+N +T+ 
Sbjct: 369  PRINRFGLNSKATMDIFLTDMKLKEDNFISITNNLTNQVNNLMTQANSLEDELKNNETKY 428

Query: 1534 QECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES---MKKLYAKIERQQSIEN 1704
               K+    L SQ   L +    +N  N   ++ ++  NE+   + KL  K E   S+E 
Sbjct: 429  N--KKETNILKSQVETLTE---LLNNPNNRSQVDLRNQNENTEILTKLLEKCEHNASLEL 483

Query: 1705 ELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH--SLSYVSKKLNYQIENFKD 1878
             LD K+    K    L +   E K R A   +  + LLD    L    K L     NF+ 
Sbjct: 484  SLDDKM----KEILILRRRESEYKARIASTETMNQHLLDRVTELELQMKSLLVGNSNFEI 539

Query: 1879 QGINQN 1896
               N+N
Sbjct: 540  GIDNEN 545

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 34/116 (29%), Positives = 62/116 (53%), Gaps = 6/116 (5%)
 Frame = +1

Query: 193 QMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE 372
           Q+ +  Y  DKVF  + T  +   E  E      ++GYN +++ YG + TGK++ + G++
Sbjct: 67  QVVNTQYKFDKVFASNDT-GVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQ 125

Query: 373 KLYNEELSDSAGIIPRILFKLFETLEK------LNEDHIVKCSFVELYNEELKDLL 522
           +          G+I ++L KLF  +++       N  + VK SF+E+Y E++ DL+
Sbjct: 126 Q---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLM 172

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 103/383 (26%), Positives = 171/383 (44%), Gaps = 57/383 (14%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 1020
            I+ D   G+ +  L E    +++E +  + KG K R+ A T  N  SSRSH I  I L  
Sbjct: 273  IRDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTT 332

Query: 1021 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
             ++K      S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ ++  
Sbjct: 333  SDMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNK 389

Query: 1198 --------------------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
                                      H+P+R+SKLTRLLQ +L G++    I TI     
Sbjct: 390  NRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNE 449

Query: 1300 TLEETCSTLEYASKAKNI----KNKPQLGS---FIMKDILLKNITTELTKIKSDLLST-- 1452
            +  ET +TL +AS+AKNI      KP + +      K+  +  +T +L + +  L+ST  
Sbjct: 450  SSAETLNTLRFASRAKNISLHVNRKPLVHTGEDSDDKNYKIMQLTKKLQE-QQQLISTLR 508

Query: 1453 ---KSKDGIYMDQQHYKELTTDLQNYKTEI----QECKRTIESLTSQNALLLKDKRTINE 1611
               KS + +      +   TT        I     E K     LT+   LL KD   +++
Sbjct: 509  QDDKSLNKVSSSVYDHMPGTTSGNLIDPTIALIYAENKVLKHKLTNCEKLLDKDTVELDD 568

Query: 1612 NNELQRIKI------QTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEM 1773
               ++ +++        +   ++ L +++ + +   NEL+ KI+ F   N   ++     
Sbjct: 569  PEIIEIVEMLPYEVGSLLETKIQGLQSQLRQYKEYTNELESKIRDFENANKGTSRQYPNK 628

Query: 1774 -------KNREALVNSKFKTLLD 1821
                    N+E ++  K   +L+
Sbjct: 629  GSPSISNSNKENIIQDKENQILE 651

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 58/171 (33%), Positives = 84/171 (49%), Gaps = 5/171 (2%)
 Frame = +1

Query: 55  ITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFG 234
           ITVA+R +  +     + SS +VT       K +A    +D+G         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVT-----DEKTIA---HDDVG--------EFKFDHVFN 144

Query: 235 PSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGII 414
              +   I+  I  P+     +G+N T+  YGMT +GKTYTM G       E     G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGLI 199

Query: 415 PRILFKLF-----ETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN 552
           P  +  LF     ETL+   +  IV  S++E+YNE++ DLL GD NN+N N
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIV-LSYLEIYNEKIYDLL-GDENNNNNN 248

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
            KIP2Kinesin-related motor protein involved in mitotic
            spindle positioning, stabilizes microtubules by targeting
            Bik1p to the plus end; Kip2p levels are controlled during
            the cell cycle
          Length = 706

 Score = 98.2 bits (243), Expect = 4e-20
 Identities = 98/355 (27%), Positives = 162/355 (45%), Gaps = 56/355 (15%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ +  L E    +++E ++ +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295  IRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTS 354

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-ADK-- 1191
              VK    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK  
Sbjct: 355  TNVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMN 411

Query: 1192 ----------------------------NVHVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
                                        + H+P+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412  SVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 1288 PAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM-------KDILLKNITTELTKIKSDLL 1446
                   ET +TL +AS+AKN+       S I        KD  ++ +  +L + +  + 
Sbjct: 472  TRNDAAAETMNTLRFASRAKNVALHVSKKSIISNGNNDGDKDRTIELLRRQLEEQRRMIS 531

Query: 1447 STKSKDGI------YMDQQHYKELTT-------DLQNYKTEIQECKRTIES---LTSQNA 1578
              K++  I        ++  YK++         +L   + E +  K  +E+   L  ++ 
Sbjct: 532  ELKNRSNIGEPLTKSSNESTYKDIKATGNDGDPNLALMRAENRVLKYKLENCEKLLDKDV 591

Query: 1579 LLLKDKRTINENNELQRIKIQTMNES-MKKLYAKIERQQSIENELDGKIQIFTKT 1740
            + L+D   I E  E+   ++ T+ E+  + L ++I + +    +L+ KI    K+
Sbjct: 592  VDLQDSE-IMEIVEMLPFEVGTLLETKFQGLESQIRQYRKYTQKLEDKIMALEKS 645

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 4/108 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF    T   +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 391 LSDSAGIIPRILFKLFETL--EKLNED--HIVKCSFVELYNEELKDLL 522
                G+IP  +  LF  +  + +N D    V  S++E+YNE + DLL
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLL 262

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.8 bits (242), Expect = 4e-20
 Identities = 87/309 (28%), Positives = 148/309 (47%), Gaps = 38/309 (12%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ + +L E  +++ ++ +K +  G + R+   T  N  SSRSH I  + L +
Sbjct: 267  IRDDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTR 326

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 1197
             ++K      S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L+     
Sbjct: 327  YDLKTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQ 383

Query: 1198 -----------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
                       H+P+R+SKLTR+LQ +L G++    I TI     +  ET +T+ +AS+A
Sbjct: 384  ANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRA 443

Query: 1345 KNIK---NKPQLGSFIMKDILLKNITTELTKIKSDLL-------------STKSKDGIYM 1476
            KNI     K ++ S   KD +++N+  +L +    ++             ST   D   +
Sbjct: 444  KNIALNVRKNEMDSHAEKDTIIQNLRKQLDEQHETIVMLRRSAAAPSGNGSTSPLDSPGV 503

Query: 1477 DQQHYKELTTDLQN---------YKTEIQECKRTIESLTSQNALLLKDKRTINENNELQR 1629
                  E T +++           KT+++ C    E L  ++ ++L+D   + E  E+  
Sbjct: 504  GGTSLSERTHNMEKGLLEVENSILKTKLEHC----EKLLDKDMMVLEDPH-VREIVEMLP 558

Query: 1630 IKIQTMNES 1656
            + I ++ ES
Sbjct: 559  LDIASVLES 567

 Score = 65.1 bits (157), Expect = 6e-10
 Identities = 32/109 (29%), Positives = 59/109 (54%), Gaps = 4/109 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF        ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 391 LSDSAGIIPRILFKLFETLEKLNED----HIVKCSFVELYNEELKDLLH 525
                G+IP+ +  +F+ +   +      + VK S++E+YNE++ DLL+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
            YPL155C (REAL)
          Length = 706

 Score = 96.3 bits (238), Expect = 1e-19
 Identities = 69/202 (34%), Positives = 99/202 (49%), Gaps = 32/202 (15%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ +  L E    + +E ++ +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295  IRDDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTS 354

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA----- 1185
             +V     R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+     
Sbjct: 355  TDVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTT 411

Query: 1186 --DKNV------------------------HVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
              D N+                        H+P+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412  SVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 1288 PAKVTLEETCSTLEYASKAKNI 1353
                   ET +TL +AS+AKN+
Sbjct: 472  TRNDAAAETMNTLRFASRAKNV 493

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 4/108 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF    T   +++   +P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 391 LSDSAGIIPRILFKLFETLEKLNEDHIVK----CSFVELYNEELKDLL 522
                G+IP  +  LF  + + + D   K     S++E+YNE + DLL
Sbjct: 218 ---ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLL 262

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
            (REAL)
          Length = 715

 Score = 95.1 bits (235), Expect = 3e-19
 Identities = 105/390 (26%), Positives = 176/390 (45%), Gaps = 66/390 (16%)
 Frame = +1

Query: 844  IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 1023
            I+ D   G+ +  L E    ++++ ++ +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295  IRDDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTS 354

Query: 1024 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-ADK-- 1191
             +V+    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK  
Sbjct: 355  TDVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTN 411

Query: 1192 ----------------------------------NVHVPFRESKLTRLLQDSLGGNTKTA 1269
                                              + H+P+R+SKLTRLLQ +L G++   
Sbjct: 412  SVGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVT 471

Query: 1270 LIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM-------KDILLKNITTELT- 1425
             I T+        ET +TL +AS+AKN+       S I        KD  ++ +  +L  
Sbjct: 472  TICTVDTRNDAAAETMNTLRFASRAKNVSLHVSKKSIINNGNYDGDKDRTIELLRRQLED 531

Query: 1426 --KIKSDL---------LSTKSKDGIYMDQQ---HYKELTTDLQNYKTEIQECK-RTIES 1560
              ++ S+L          +  S +  Y D      +K+    L   +  I + K    E 
Sbjct: 532  QHRLISELKDRANLGERSTQSSNENNYKDNNVIVSHKDPNLALMKAENRILKYKLDNCEK 591

Query: 1561 LTSQNALLLKDKRTINENNELQRIKIQTMNES-MKKLYAKIERQQSIENELDGKIQIFTK 1737
            L  ++ + L+D   I E  E+  +++ T+ E+ ++ L ++I + +    +L+ KI    K
Sbjct: 592  LLDKDVVDLQDSE-IMEIVEMLPLEVGTLLETKIQGLESQIRQYRKYTQKLEDKIMAMEK 650

Query: 1738 T--NSKLTKIID--EMKNREALVNSKFKTL 1815
            +  N+KL+   D  E+   + ++  K K +
Sbjct: 651  SGYNAKLSAPCDGTEVMELQKMLERKDKMI 680

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 4/108 (3%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +  D VF    T   ++++ ++P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 391 LSDSAGIIPRILFKLFETL--EKLNED--HIVKCSFVELYNEELKDLL 522
                G+IP  +  LF  +  + +N D    V  S++E+YNE + DLL
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLL 262

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 64/178 (35%), Positives = 99/178 (55%), Gaps = 6/178 (3%)
 Frame = +1

Query: 826  DNDKSTIQSDQTAGIYIQ--NLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHT 999
            D+ K T +   T  I I+  + ++  I  + +  +L++ G   R   ST MN+ SSRSH+
Sbjct: 492  DDKKGTTEVTNTHKITIKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHS 551

Query: 1000 IFT--ITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRA--KEAGSINQSLLTLGR 1167
            +F   IT    +  E     ++NLVDLAGSE + +   +  +   KE  SIN+SL  L  
Sbjct: 552  VFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLAD 610

Query: 1168 VINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 1341
            VI+S+  +  ++PFR SKLT LL++SL   +KT +   ISP   ++ ET ++L  A K
Sbjct: 611  VIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLMYVNISPNINSIRETINSLRLARK 668

 Score = 62.0 bits (149), Expect = 6e-09
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 3/115 (2%)
 Frame = +1

Query: 211 YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 390
           +T DK+FG       +FD+I   L    + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 391 LSDSAGIIPRILFKLFE---TLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDN 546
           L++  GII + +  +      L KL  ++ ++  F+E+YNE ++DLL+ +  + +
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLNPEAKHQH 487

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 62/262 (23%), Positives = 96/262 (36%), Gaps = 31/262 (11%)
 Frame = +1

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNE--SMKK 1665
            KE T  L+N  + +Q     IES  SQ    +++K ++ E  E   +K Q + E  + KK
Sbjct: 249  KEQTKSLENRLSTLQHESNKIESTISQIRYSIQEKESLIE--EFSGVKPQLLQEITNWKK 306

Query: 1666 ----LYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLS 1833
                L  + +R++S+      KIQ          ++   +K+  A  NS           
Sbjct: 307  RTLLLDEEFKREESLRRINHNKIQELRGNIRVYCRLRPYIKDEAATSNSD---------G 357

Query: 1834 YVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF----------- 1980
            Y+       I+ F      Q   V++  QL       +     DN+E F           
Sbjct: 358  YIF------IKPFDANAGQQRIIVNDLKQLHAFTFDKIFGMQDDNYEVFDDIKNLVQSSL 411

Query: 1981 --YQECITKF----LSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQF 2142
              Y  CI  +       T  + +E +  ++     T  Y    A NL  L  EY    +F
Sbjct: 412  DGYNVCIFTYGQTGSGKTYTMLNEKDGIIMQ----TIEYIVHFAGNLHKLGWEYELEVEF 467

Query: 2143 ITDEFYNQ--------EKGHQH 2184
            I  E YN+        E  HQH
Sbjct: 468  I--EIYNETIRDLLNPEAKHQH 487

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
            Anc_2.633 YKL079W
          Length = 682

 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 86/348 (24%), Positives = 162/348 (46%), Gaps = 29/348 (8%)
 Frame = +1

Query: 865  GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK-GEI 1041
            G+ + NL++ H+ + KE +    + +    V ++K ++   R++TIF I + K  K  E 
Sbjct: 208  GLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 1042 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD------KNVH- 1200
               S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265  TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 1201 -----VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKP 1365
                 VP+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325  SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 1366 QLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTT--------DLQNY 1521
            Q+  F + +    +I  E  K+K +    +  + +   ++    +T         +L   
Sbjct: 385  QINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEELNKL 444

Query: 1522 KTEIQECKRTIESLT--------SQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAK 1677
            ++E  + K  + +LT        +  + +L++ +T+  NN  +R +    N  ++ L  K
Sbjct: 445  RSENAKLKAQVNTLTQLMVSPKLASPSPMLENNKTV-RNNSAERNETSYEN-VVQTLMEK 502

Query: 1678 IERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
             E+    E  LD K+    K    L +  D++K+  A + +    LLD
Sbjct: 503  CEKLADTELSLDDKL----KDILVLKRENDQIKSNIASIETLNSHLLD 546

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 7/130 (5%)
 Frame = +1

Query: 154 VAINTSEDIGFTAQMNSK-TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYG 330
           + +N +  +   +  NS  ++    +F   +   LI + I   +  + ++GYN  ++ YG
Sbjct: 64  IPVNNNHKMNGDSLPNSNNSFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYG 123

Query: 331 MTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNED------HIVKCSFVE 492
              +GKTY+      LY  ++ DS G+   I   LF  + K   D       IVK SF+E
Sbjct: 124 PKYSGKTYS------LYGNDVDDSFGLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLE 177

Query: 493 LYNEELKDLL 522
           ++ +++ DLL
Sbjct: 178 VWLDKVVDLL 187

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
            YPL155C
          Length = 468

 Score = 86.7 bits (213), Expect = 7e-17
 Identities = 52/150 (34%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query: 919  IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 1098
            ++L+ +G + R+V ST+ N  SSRSH +  + +   +     +   + L DLAGSE    
Sbjct: 241  LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSMGS---KARVLTLCDLAGSER--- 294

Query: 1099 SGALNQRA--KEAGSINQSLLTLG---RVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 1263
              +++ R    E G+IN+SL+ LG   R++N     + HVP+R+SKLTRLL+ SL GN  
Sbjct: 295  -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 1264 TALIATISPAKVTLEETCSTLEYASKAKNI 1353
              ++ T+S +    E++  TL +A +A  +
Sbjct: 354  VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/97 (34%), Positives = 51/97 (52%)
 Frame = +1

Query: 286 SDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNED 465
           +D I G   T++ YG T +GKTYTM G +           GI+      + + L +L+++
Sbjct: 136 TDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQ---LSIRDLLTQLSKN 181

Query: 466 HIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 576
             +  S++E+YNE L DLL   C+      K+LRI D
Sbjct: 182 CQITISYLEIYNERLHDLL---CDGT----KELRILD 211

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 84.7 bits (208), Expect = 5e-16
 Identities = 83/304 (27%), Positives = 143/304 (47%), Gaps = 25/304 (8%)
 Frame = +1

Query: 985  SRSHTIFTITLFKEVKGE-IFRLSKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 1155
            S+SH +F + + +  + E I + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233  SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALK--KLNQSIE 290

Query: 1156 TLGRVINSLADKNVHVPF----------RESKLTRLLQDSLGGNTKTALIATISPAKVTL 1305
             L  ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   + V  
Sbjct: 291  ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNV-- 348

Query: 1306 EETCSTLEYASKAKNIKNKPQLGS----------FIMKDILLK--NITTELTKIKSDLLS 1449
              T STLE+    + I NK    +            ++D+ +K  N  +++  +KS+L S
Sbjct: 349  PTTISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDS 408

Query: 1450 TKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQR 1629
             K    +  +    +++ T+L+NY+ E  + K  ++S+T     LL      N NN +  
Sbjct: 409  LKD---LSNESSSREDMKTELENYEKENVKLKLQLDSITQ----LLSSSTNENPNNNID- 460

Query: 1630 IKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFK 1809
                  +E  + L  + E+   +E   D ++      NSKL K  +  K++E  + S   
Sbjct: 461  ------DEVAEILMKRCEQIAQLELSFDRQM----NANSKLRKEFEYKKSKEEALESMNV 510

Query: 1810 TLLD 1821
             LL+
Sbjct: 511  RLLE 514

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +1

Query: 154 VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 333
           V   TS+ +         T+  DKVF  +ATQ  + D +  P   D + GYN T+L YG 
Sbjct: 56  VLFRTSKPLHNATGSPHSTFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGP 115

Query: 334 TSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYN 501
           + +GK+Y++ G +  YNE      G++P I   LFETLE+  E    +  V     E+Y 
Sbjct: 116 SFSGKSYSLLGSQ--YNE------GVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYM 167

Query: 502 EELKDLL 522
           E+  DLL
Sbjct: 168 EKSYDLL 174

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
            that interacts with Myo2p, proposed to be involved in
            exocytosis; N-terminal domain is related to the motor
            domain of kinesins
          Length = 656

 Score = 83.6 bits (205), Expect = 1e-15
 Identities = 88/339 (25%), Positives = 155/339 (45%), Gaps = 15/339 (4%)
 Frame = +1

Query: 985  SRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1161
            SRSH +F + +  +  K +I + S + LVDL G+E  ++             +NQS+  L
Sbjct: 233  SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 1162 GRVINSLADK----------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 1311
               + SL+ K          +    +RES+LT +L+DSLGGN KT +I T   + V    
Sbjct: 293  KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNV--PT 350

Query: 1312 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY 1491
            T STLE+    + I NK               +T   T      L+ K K  +++     
Sbjct: 351  TLSTLEFGDSIRQINNK---------------VTDNTTG-----LNLKKKMDLFIQDMKI 390

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTS--QNALLLKDKRTINENNELQRIKIQTMNESMKK 1665
            K+      NY  +I   K  I+SL S    +L   D++ + EN + + IK++   +S+ +
Sbjct: 391  KD-----DNYVAQINILKAEIDSLKSLHNKSLPEDDEKKMLENTKKENIKLKLQLDSITQ 445

Query: 1666 LYAKIERQQSIENELDGKI-QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
            L +     +   N +D ++ +I TK   ++ + ++   +R+   NSK +  L++  S   
Sbjct: 446  LLSS-STNEDPNNRIDEEVSEILTKRCEQIAQ-LELSFDRQMNSNSKLQQELEYKKS--- 500

Query: 1843 KKLNYQIENFKDQGI-NQNFTVDENLQLIKSEMTNLLST 1956
                      K++ + + N  + E +QL + E+  LL+T
Sbjct: 501  ----------KEEALESMNVRLLEQIQLQEREIQELLTT 529

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 4/127 (3%)
 Frame = +1

Query: 154 VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 333
           V   T+  +  T +    T+  DKVF  +ATQ  +   +  P+ +D + GYN T++ YG 
Sbjct: 56  VLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGP 115

Query: 334 TSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYN 501
           + +GK+Y++ G +        +S GI+P I   LF+TLEK  E       V     E+Y 
Sbjct: 116 SFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYM 167

Query: 502 EELKDLL 522
           E+  DLL
Sbjct: 168 EKTYDLL 174

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 82.4 bits (202), Expect = 3e-15
 Identities = 89/384 (23%), Positives = 171/384 (44%), Gaps = 14/384 (3%)
 Frame = +1

Query: 847  QSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE 1026
            +S     + I+++   HI + K+    +Q             N   S+SH +F + + + 
Sbjct: 187  RSSSKMDLEIKDICPAHIRSYKDLKSYIQSVQNTDNRMGYSGNTERSKSHLVFQLHVEQR 246

Query: 1027 VKG-EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHV 1203
             +  +I R S + L+DL G+E  ++   +         +NQS+  L  ++  L+ K+   
Sbjct: 247  NRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEALKNIVRLLSVKDRDS 306

Query: 1204 PF----------RESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 1353
             +          RES+LT +L+DSLGGN KT +I T   + V+   T STLE+    + I
Sbjct: 307  AYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVS--TTLSTLEFGECIRQI 364

Query: 1354 KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEI 1533
             NK           ++ N T          L+ K K  ++++    ++      NY + I
Sbjct: 365  TNK-----------VIDNTTG---------LNLKKKMDLFIEDMKIRD-----NNYASRI 399

Query: 1534 QECKRTIESLTSQNALLLK--DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENE 1707
               K  I+SL + +  L+   D +T  EN+E +  K++   +S+  L +     ++  + 
Sbjct: 400  NILKAEIDSLKTPSGELVSQGDMKTKFENSEKENAKLKLQLDSISLLLSS-STSENPNHS 458

Query: 1708 LDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
            +D ++        +    ++   +R+  VNSK           + K+L Y+I   K++ +
Sbjct: 459  IDEEVAEILMKRCEQVAQLELSFDRQMNVNSK-----------LQKELEYKIS--KEKAL 505

Query: 1888 -NQNFTVDENLQLIKSEMTNLLST 1956
             + N  + E +Q+ + E+  LL+T
Sbjct: 506  ESMNVRLLEQIQIQEKEIQELLTT 529

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 4/127 (3%)
 Frame = +1

Query: 154 VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 333
           V   TSE    T      T+  DKVF  +ATQ  + D +  P   D + GYN T++ YG 
Sbjct: 56  VLFRTSEPSHETTGDTYSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGP 115

Query: 334 TSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYN 501
           + +GK+Y++ G +        +  GI+P I   LFETLEK  E    +  V     E++ 
Sbjct: 116 SFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFM 167

Query: 502 EELKDLL 522
           E+  DLL
Sbjct: 168 EKTYDLL 174

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
            uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
            weakly similar to YKL079W uniprot|P32364 Saccharomyces
            cerevisiae YKL079W SMY1 not believed to act as a kinesin
            colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 100/412 (24%), Positives = 189/412 (45%), Gaps = 25/412 (6%)
 Frame = +1

Query: 841  TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 1020
            T    +T  + ++ L+   + +  E +  + +G   R  + +      SRS     IT+ 
Sbjct: 178  TSSDTKTHTLSVKGLRTVSVNSVYELLAYINEGHLRRCHSDSHYR--KSRSSAFLNITVE 235

Query: 1021 -KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD--- 1188
             +  K E  + S + L+DLA S+ ++++   +    E  S N S+  L +V+  L++   
Sbjct: 236  QRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELES 295

Query: 1189 --------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
                    K+ H   R S+L + LQ ++GG++KT  +   S  K   E T  TL   S+ 
Sbjct: 296  PSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRL 352

Query: 1345 KNI-----KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 1509
            ++I     +NK  L S  + D+ LKN++T     + D   T+ K   Y++ +   +L   
Sbjct: 353  RSIHNFPVQNKMGLNSKALLDLRLKNMST-----REDSYLTRIK---YLEDE-VSKLGGT 403

Query: 1510 LQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQ 1689
            +Q  K ++     T +SLT +N  L+       +  EL R   QT              +
Sbjct: 404  IQQNKNQVS----TNKSLTEKNMKLM-------DQLELYRKSQQTQKSG--------SEE 444

Query: 1690 QSIENELDGKIQIFTKTNSKLTKIIDE-MKNREALVNSKFKTLLDHSL---SYVSKKLNY 1857
            +++ ++ +G+IQ      +++++++D  M+  E ++  + +  LD  L   S +S++LNY
Sbjct: 445  ENLTSQQNGRIQ------NEMSEVLDNLMEKCERVIQLQMR--LDEELRQKSQMSQQLNY 496

Query: 1858 QIENFKDQGIN-QNFTVDENLQLIKSEMTNLLST---ARDNFEKFYQECITK 2001
              +  K Q +   N  + E L   ++EM N+L+T    R   EK+     T+
Sbjct: 497  --KESKAQALEAMNVKLLEQLNTNENEMRNVLNTNSILRKEMEKWMHVAKTR 546

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 33/117 (28%), Positives = 63/117 (53%), Gaps = 4/117 (3%)
 Frame = +1

Query: 184 FTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMT 363
           F+   ++  +  +KV+     Q  + ++I      + + G+N +++ +G   +GKTYTM 
Sbjct: 59  FSDANDTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMF 118

Query: 364 GDEKLYNEELSDSAGIIPRILFKLFETLEKLNED----HIVKCSFVELYNEELKDLL 522
           G++   +EE     GI+ R+   +F+ L+KL+ED      +  +F EL+ E + DLL
Sbjct: 119 GND---HEE-----GIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
            Anc_2.633
          Length = 598

 Score = 79.3 bits (194), Expect = 2e-14
 Identities = 98/414 (23%), Positives = 181/414 (43%), Gaps = 41/414 (9%)
 Frame = +1

Query: 871  YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEV---KGEI 1041
            +++NL    I +  +  K  + G +              RS++I    +  E    K ++
Sbjct: 205  HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 1042 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPF---- 1209
            ++LS ++ +DL G +   +   +     E   +N  + +   +I +L+D    +P+    
Sbjct: 265  YKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSDPK-SLPYTSSL 322

Query: 1210 -RESKLTRLLQDSLGGNTKTALIATI-SPAKVTLEETCSTLEYASKAKNIKNKPQLGSF- 1380
             ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+IKN   +  F 
Sbjct: 323  YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVFG 382

Query: 1381 --IMKDILL---------KNITTELTKIKSDL-LSTKSKDGIYMDQQHYKELTTDLQNY- 1521
              + K +LL         +N  T++  ++S+L L  K  + +  D  H++E   D  +  
Sbjct: 383  LNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPVATD--HHEENYNDESSCS 440

Query: 1522 -KTEIQECKRTIESL--------TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 1674
             K  I + K  IESL        TS+N    K K   NE++EL + K+    E + KL  
Sbjct: 441  DKETIMKLKLKIESLEQVLEHISTSENP---KSKTETNEHDELLK-KLMDKCEDVAKLQV 496

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN 1854
            +IE +++              TNSKL +            + K+     H+L  ++ KL 
Sbjct: 497  EIEAEKN--------------TNSKLKQ------------DLKYSASKQHALETMNLKLL 530

Query: 1855 YQIEN---------FKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQE 1989
             Q++N           ++ + +     ENL+  K+E   +L  A  ++  F ++
Sbjct: 531  EQLQNQEKECKELLISEERLKRELASAENLKNSKAERIVILERAIKDYRAFEKQ 584

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 36/167 (21%), Positives = 78/167 (46%), Gaps = 15/167 (8%)
 Frame = +1

Query: 115 VVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDF 294
           VV+ +  +  +++ A     +   T +++S+ +  D +F  ++ Q+   + +      D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 295 IKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDH-- 468
             GYN + + YG +++GK+ T      L+NE+     G+I  +  +LF+ ++ L  D+  
Sbjct: 94  FDGYNQSFITYGKSNSGKSDT------LFNEK----DGLIRLLFEQLFKKVQSLTADNNN 143

Query: 469 ------------IVKCSFVELY-NEELKDLLHGDCNNDNGNFKKLRI 570
                           S +E++ +E++ DLL  +   DN   K L++
Sbjct: 144 NNTREGNNILTFNFSLSMMEIFSSEKIYDLLSNEYTKDNPILKSLKV 190

 Score = 35.4 bits (80), Expect = 0.86
 Identities = 68/314 (21%), Positives = 125/314 (39%), Gaps = 18/314 (5%)
 Frame = +1

Query: 1888 NQNFTVDENLQLIKSEMTNLL--STARDNFEKFYQECITKFLSDT---PLLFDEINDNVL 2052
            +Q+F  D N+    SE   +L  ST +D F+ + Q  IT   S++     LF+E  D ++
Sbjct: 66   SQDFKFD-NIFPTNSEQNEMLTVSTIKDLFDGYNQSFITYGKSNSGKSDTLFNE-KDGLI 123

Query: 2053 NL--KALTSNYYSQIAENLSDLSEEYNNFKQFITD----EFYNQEKGHQHELLNKYINNT 2214
             L  + L     S  A+N ++ + E NN   F       E ++ EK   ++LL+      
Sbjct: 124  RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFSSEK--IYDLLSNEYTKD 181

Query: 2215 QTVIESSSNDVMSTIQNLL--NEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKW-- 2382
              +++S        I+N +  ++H++    + I SL +                L KW  
Sbjct: 182  NPILKSLKVHQHDIIENGIKGDKHVKNLSHIQIASLDD----------------LQKWFK 225

Query: 2383 ---EESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFKTNDIAH 2553
               + S+ +IN   A     N  + S +      ++Q N           + +K + ++ 
Sbjct: 226  IGCQRSSAIINAGTAKEKRSNSIIISKI-----HLEQVNPKD--------QLYKLSTLSF 272

Query: 2554 XXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDY 2733
                                     + +F K+   +TN+ MKKLN L +S + ++  +  
Sbjct: 273  IDLYG--------------------IDKFTKKDIQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 2734 EKDIKETNSPLKPS 2775
             K +  T+S  K S
Sbjct: 313  PKSLPYTSSLYKDS 326

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 79.0 bits (193), Expect = 3e-14
 Identities = 92/393 (23%), Positives = 173/393 (44%), Gaps = 10/393 (2%)
 Frame = +1

Query: 865  GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIF 1044
            G +I++L + H+T+  E    L+ G  Y+ ++   ++   S+    F +      K ++ 
Sbjct: 196  GDHIRDLHQIHVTSPIEIKDTLKNG--YKNISP--LHHSKSQIFVRFEVQCIDR-KDDVT 250

Query: 1045 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV--HVPFRES 1218
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I +L ++       F++S
Sbjct: 251  RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSHFKDS 310

Query: 1219 KLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMK--- 1389
             L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +    +    
Sbjct: 311  SLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLNAKR 367

Query: 1390 --DILLK--NITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE 1557
              D+L++  N+  +    K +LL T+ K     +       +  L+N   E  + K  +E
Sbjct: 368  KMDLLVQDMNVKEQNYLAKINLLQTEIKTLKTENDSTTNSTSNSLENALQENSKLKLQLE 427

Query: 1558 SLTS-QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFT 1734
            SL      + L +  + N+N      ++   +E +KKL +  E   +++  +D    I  
Sbjct: 428  SLQQILGTMSLANPSSSNKN------EMNEHDELLKKLMSTCEDVANLQLSVDNGKHI-- 479

Query: 1735 KTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDEN 1914
              N KL K ID   ++E +  +   TLL             QI+N +++ + +  T + +
Sbjct: 480  --NRKLKKQIDANSSKEDVFETMNSTLLK------------QIQN-QEKELEELLTANAS 524

Query: 1915 LQLIKSEMTNLLSTARDNFEKFYQECITKFLSD 2013
            LQ+   E  NL   +    E+     + K L D
Sbjct: 525  LQI---EFENLRKVSNSRKERITH--LEKILKD 552

 Score = 58.5 bits (140), Expect = 7e-08
 Identities = 35/109 (32%), Positives = 57/109 (52%)
 Frame = +1

Query: 196 MNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEK 375
           +++  Y  D +F   + ++  +D I + L  D  KGYN T++ YG TS+GK++ + GD  
Sbjct: 81  VSNNEYQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD 140

Query: 376 LYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL 522
             N+ L +   I  R+LF   E     N   +   S  ELY +++ DLL
Sbjct: 141 STNDGLINH--IADRLLFPQCED----NLKTLCSISMWELYIDKVYDLL 183

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 55/188 (29%), Positives = 86/188 (45%), Gaps = 4/188 (2%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
           M + T+      + +EL   + V CR R   + + + S  +++           N ++ I
Sbjct: 343 MKEETMRRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCI 397

Query: 181 GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
               +     +T D+ FG   +   IF EI + L    + GYN  +  YG T +GKTYTM
Sbjct: 398 TIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM 456

Query: 361 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG- 528
                     L+   GIIP  L  +F  +EKL E    + +   F+E+YNE +KDL    
Sbjct: 457 ----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

Query: 529 DCNNDNGN 552
           D  ND+G+
Sbjct: 507 DTENDDGS 514

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +1

Query: 871  YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGE 1038
            +I N+    +T  +    +L + +K R  A+T  N  SSRSH++F I L  +  + GE
Sbjct: 531  HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
            YKL079W
          Length = 803

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 120/530 (22%), Positives = 206/530 (38%), Gaps = 33/530 (6%)
 Frame = +1

Query: 862  AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE-VKGE 1038
            + + I+NL++ ++ + +E    L +G   R      M   +SRS+ +  I L +  ++ +
Sbjct: 235  SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 1039 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRE- 1215
            + + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290  LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 1216 ----------SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKP 1365
                      S L  ++   +GGN KT  I+TISP      ET  TL  + + K+I +  
Sbjct: 349  INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRISEQIKSIISS- 407

Query: 1366 QLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECK 1545
               + I K+I   N   EL  I+ D+                        N K E  +C+
Sbjct: 408  --SNNINKNIKGLNSKKELELIRMDI------------------------NLKEEYYKCQ 441

Query: 1546 RTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQ 1725
              I  L  Q  L+      I E N  +   +Q   +  +K   K+++Q      +     
Sbjct: 442  --IRILEEQLKLMKSHSNIITETNTTRNSGLQEEIKYQEKENRKLKKQ------VKTLAY 493

Query: 1726 IFTKTNSKLTKIIDEMKNREALVNSKF--KTLLDHSLSYVSKKLNYQIENFKDQGINQNF 1899
            I TKTN       + + N +     +     + D       +  N   E+  D G   + 
Sbjct: 494  ILTKTNRNNKSATNTISNDDMNQGDEIDGNNINDDDNELNKQDTNLADEDDDDDGDGNSL 553

Query: 1900 TVDEN-----------------LQLIKSEMTN--LLSTARDNFEKFYQECITKFLSDTPL 2022
              ++N                 LQL   E  N  L+   +  F KF  + +         
Sbjct: 554  ETEDNSEHLLNTLLEKCEQVVELQLSLDEEINKGLILQKQTEFSKFKGQTLETM---NLK 610

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
            L D+IN        L ++    +AEN+S   +E  + KQ       N  K     L N  
Sbjct: 611  LLDQIN-------LLEADLQMTLAENVSK-RKEIEHLKQIA-----NSRKSRIQYLENDI 657

Query: 2203 INNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNEL 2352
                 ++   ++N+ +S  Q   N +L+  +E   NS    TT    N L
Sbjct: 658  KEKDISIKSIATNNSLSVNQTNSNNNLKLQEE-ASNSRKYSTTSSSGNTL 706

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 2/79 (2%)
 Frame = +1

Query: 166 TSEDIGFTAQMNSKT-YTVDKVFGPSATQS-LIFDEIAEPLFSDFIKGYNCTMLVYGMTS 339
           T   I FT++    T + VDKVF     QS L+  +I +   S+   G+N +++ +G + 
Sbjct: 35  TGTRIIFTSETTGNTEFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSG 94

Query: 340 TGKTYTMTGDEKLYNEELS 396
           TGK++TM G+  L +   S
Sbjct: 95  TGKSFTMFGNNSLTSTNTS 113

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 55/188 (29%), Positives = 86/188 (45%), Gaps = 4/188 (2%)
 Frame = +1

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 180
           M + T+      + +EL   + V CR R   + + + S  +++           N ++ I
Sbjct: 343 MKEETMRRKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCI 397

Query: 181 GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 360
               +     +T D+ FG   +   IF EI + L    + GYN  +  YG T +GKTYTM
Sbjct: 398 TIKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM 456

Query: 361 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG- 528
                     L+   GIIP  L  +F  +EKL E    + +   F+E+YNE +KDL    
Sbjct: 457 ----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

Query: 529 DCNNDNGN 552
           D  ND+G+
Sbjct: 507 DTENDDGS 514

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = +1

Query: 871  YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGE 1038
            +I N+    +T  +    +L + +K R  A+T  N  SSRSH++F I L  +  + GE
Sbjct: 531  HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] {ON}
            similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 91/384 (23%), Positives = 170/384 (44%), Gaps = 47/384 (12%)
 Frame = +1

Query: 865  GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIF--TITLFKEVKGE 1038
            G+Y Q     +I + KE  ++++     ++ +  KM+   S SH +   ++     V G 
Sbjct: 205  GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHGT 264

Query: 1039 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV------- 1197
            I   S +   DL GS    +        +    +N S+  L  V+NS+            
Sbjct: 265  ITS-SNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIE 323

Query: 1198 -------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 1338
                          VP+++S+LT L+Q++LGGN++T ++      K   EET +TL +  
Sbjct: 324  NKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGV 383

Query: 1339 KAKNIKNKPQ-----LGSFIMKDILLKNITT-------ELTKIKSDLLSTKSKDGIYMDQ 1482
            + +NI N  +     L S    D+L+ N+         ++T ++S+L   K  D +    
Sbjct: 384  QLQNILNFVRADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESEL--NKLADTV-KKA 440

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN---E 1653
            +  +EL T++     EI++ +  +E++T      L +     E+ + ++I IQT+    E
Sbjct: 441  KVTEELETEIVEKNDEIKKLREQLETMTQ-----LFNNIDPKESEDTKKI-IQTLMEKCE 494

Query: 1654 SMKKLYAKIERQQSIENEL--------DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFK 1809
            S+ +L  ++E Q   EN +        D KI+     NS+L   +++++N+E+      K
Sbjct: 495  SVAQLQLELEGQLH-ENSILKGDGEIKDAKIRTLETMNSRL---VEQLQNQESSTQDILK 550

Query: 1810 T--LLDHSLSYVSKKLNYQIENFK 1875
            +  +L   L  +S     Q E  K
Sbjct: 551  SNGILKKELEALSNISKSQQEKIK 574

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 30/125 (24%), Positives = 57/125 (45%), Gaps = 4/125 (3%)
 Frame = +1

Query: 163 NTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTST 342
           NT      T   +   +  +KV+        I   ++E +  D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 343 GKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDH----IVKCSFVELYNEEL 510
           GK++T+ G+E        DS GII      + +   +L +D      ++ S +E+  E++
Sbjct: 131 GKSFTLFGNE--------DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKV 182

Query: 511 KDLLH 525
            D+LH
Sbjct: 183 YDMLH 187

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
            (REAL)
          Length = 657

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 82/384 (21%), Positives = 167/384 (43%), Gaps = 14/384 (3%)
 Frame = +1

Query: 847  QSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF-K 1023
            +S  T  + I++++  H+ + ++    +Q                 SRSH +F + +  +
Sbjct: 188  RSSSTMDLEIKDIRPAHVNSFEDLKSYIQSVQNPANRMGYSGKAERSRSHVVFQLHVEQR 247

Query: 1024 EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHV 1203
              + +I + S + L+DL G+E  ++             +NQS+  L   + SL  K++  
Sbjct: 248  NRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTVQSLEIKSMDS 307

Query: 1204 ----------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 1353
                       +RES+LT +L+DSLGGN KT +I T   + V    T STL++    + I
Sbjct: 308  VYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNV--PTTLSTLKFGDSIRQI 365

Query: 1354 KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEI 1533
             N+      +M +    N+  ++     D+   K KD                 NY ++I
Sbjct: 366  NNR------VMDNTSGLNLRKKMDLFVQDM---KIKD----------------DNYISQI 400

Query: 1534 QECKRTIESLTSQNAL--LLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENE 1707
               K  +E L  Q++     +D  T  ++++ +  K++   +S+ +L  K+  ++   N 
Sbjct: 401  NILKAEVEILKGQSSESDSKEDMATKFDDSKKENTKLKLQLDSIAQLLGKLTNEEP-NNS 459

Query: 1708 LDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
            ++ ++ +      +    ++   +R+   NSK +  L++  S             K++ +
Sbjct: 460  INDEVSVILMNRCEQIAQLELSFDRQVNANSKLEKELEYKKS-------------KEEAL 506

Query: 1888 -NQNFTVDENLQLIKSEMTNLLST 1956
             + N  + E +QL + E+  LL+T
Sbjct: 507  ESMNVKLLEQIQLQEKEIQELLTT 530

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 5/110 (4%)
 Frame = +1

Query: 208 TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE 387
           T+  DKVF  +ATQ  + D + +P  +D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 388 ELSDSAGIIPRILFKLFETLE-----KLNEDHIVKCSFVELYNEELKDLL 522
              D  GI+P I   LF TLE     K N   +   +F E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAF-EIYMEKTYDLL 175

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
            Anc_2.633 YKL079W
          Length = 693

 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 88/386 (22%), Positives = 159/386 (41%), Gaps = 5/386 (1%)
 Frame = +1

Query: 988  RSHTIFTITLFKEVKGEIFRL-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 1164
            RS TI  I L +  + E     S +  VDLAGS+  ++        + A   N+ + +L 
Sbjct: 265  RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 1165 RVINSLAD-KNVHVP---FRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
             ++ +LA+ +++ +    +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325  SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 1333 ASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDL 1512
            +S A ++ N+                     KI    +    K  I  D  +  E     
Sbjct: 385  SSYASSMSNQ--------------------IKINQTAIGGDKKRAILTDDWNLME----- 419

Query: 1513 QNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQ 1692
            + Y+  I+  K  +  ++ QN ++ +  +T+ ++     I    + + +  L   I+   
Sbjct: 420  EYYRNRIELLKDELHEVSMQNVMMTRGMQTLEQSERENEI----LRDQLNSLVQLIKTPH 475

Query: 1693 SIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENF 1872
            S++          +K  ++  K  DE             T+++  +  V+   + Q  N 
Sbjct: 476  SVKG---------SKNIAREKKFTDE-------------TIINSVMEQVAAIADLQSVNN 513

Query: 1873 KDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVL 2052
              +  N NFT    +++   +  N +    D   K Y+  +T F S   +L D IN N +
Sbjct: 514  DKELENINFTESHIMKISMKDKPNYVEQLHDTESKMYR-ALTDF-SKNQILSDNINFNDI 571

Query: 2053 NLKALTSNYYSQIAENLSDLSEEYNN 2130
                  ++ Y + + N  + S   NN
Sbjct: 572  K----GNDTYLKKSSNKKETSSLKNN 593

 Score = 58.2 bits (139), Expect = 9e-08
 Identities = 52/183 (28%), Positives = 75/183 (40%), Gaps = 44/183 (24%)
 Frame = +1

Query: 154 VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 333
           + +N+S + G     N   Y  DK+F P      I   ++    +D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQ--YRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 334 TSTGKTYTMTG----------DEK--------------LYNEELSDSA------------ 405
           T TGKTYT+ G          D K                N  +  SA            
Sbjct: 99  TGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQK 158

Query: 406 ---GIIPRILFKLFETLEKLNE-----DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK 561
              G+I ++   LFE ++++         +V  SFVE+Y EE+ DLL  D   D  + KK
Sbjct: 159 KNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHD---DTLSNKK 215

Query: 562 LRI 570
           L +
Sbjct: 216 LSL 218

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 135/642 (21%), Positives = 272/642 (42%), Gaps = 75/642 (11%)
 Frame = +1

Query: 784  SSGNNDSANKFSPADNDKSTIQSD---QTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQ 954
            S+  NDS++K    +   + +Q+D    +    I +     + +  E IK     +  + 
Sbjct: 718  SALENDSSSKIDTLEEKLTELQNDFNILSEKHSILSGDNISLNSNYENIKNELNSISEQL 777

Query: 955  VASTKMND---FSSRSHTIFTITLFKEVKGE---IFRLSKMNLVDLAGSENINRSGALNQ 1116
              ++K N+    ++ S  +   +L KE+  +   I+ L K   ++L  +E       +N+
Sbjct: 778  SMASKENENLKATNASQEVDVKSLNKELNEKEKSIYELEKQ--LNLTKTEKDKAQEGINK 835

Query: 1117 RAKEAGSINQSLLTLG----RVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATI 1284
               E   +  S+ TL     R+ N +  + + +  +E+K+   ++ +         +  +
Sbjct: 836  MNNELRKLMTSIDTLNEDKSRLQNEIKLQKIELDDKETKINSEMEKTSKEYDNLKKLLAL 895

Query: 1285 SPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKD 1464
               ++  EE  S L  +++      K   G F   D L+  +T +L       L+T  K+
Sbjct: 896  KEEEI--EELKSKLLISARDL----KEYKGKFQSHDSLVPKLTEKLKT-----LATSFKE 944

Query: 1465 GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQT 1644
                     + L T+ +N  +E+      ++ + S+NA L K+K+T+ EN      KI+ 
Sbjct: 945  LEIERDALLQSLKTNEENTSSELSLLTSKLDIIKSENATLEKNKKTLLENISNLESKIED 1004

Query: 1645 M-----NESMKKLYAKIERQQ---SIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 1800
            M     NE      +K E ++   S+  +L+       ++++K +++  ++K+    VNS
Sbjct: 1005 MITAHTNEKKALEESKEELEEFVISLNEQLEDLETSKLESSNKASELEAKIKSFNNEVNS 1064

Query: 1801 KFKTLLDHSLSYVSK------KLNYQIENFKDQGIN--QNFT-VDENLQLIKSEMTN--- 1944
             +K  LD + + +SK      + N +IE  ++  ++  +N T  D+ L+   +E++N   
Sbjct: 1065 -YKNQLDTANNLISKLQISLDEANSKIEQLEEDKVSDLKNLTKKDQKLEARDNELSNAKL 1123

Query: 1945 ---------------LLST------ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK 2061
                           LLST        D+ E+   + +T    +   L + IN+N   +K
Sbjct: 1124 QNDELLRERQSLKDELLSTKEKFNSVNDDLEELNSKYVT-IEEEKRTLENSINENQFTIK 1182

Query: 2062 ALTSNY------YSQIAENLSDLSEEYNNFKQFITDEFYN--------QEKGHQHELLNK 2199
             L  N       Y+ +  +  DL EE ++    +  +  +        +E   +   LN 
Sbjct: 1183 ELKDNISGLTNDYNALESSKLDLEEELSSQTTELDQKDTSLAELSKKLEEISSEKLKLNS 1242

Query: 2200 YINNTQT---VIESSSNDVMSTIQNLLNE--HLRANKELIINSLSNVTT--ELMSNELDR 2358
             + NT+T    +E  + D    IQ+L  E   +++N +   N L  ++   + MS E + 
Sbjct: 1243 LLQNTETNLKDLEKVNEDKEIRIQSLEKELKVVKSNSKETDNKLQELSDKHDQMSREYEI 1302

Query: 2359 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
            LK       +   L+N  + L  ++NDNVE  +    + +KQ
Sbjct: 1303 LK------ADKESLLNSKEKLYKQYNDNVE-KINNYEESLKQ 1337

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 135/625 (21%), Positives = 246/625 (39%), Gaps = 74/625 (11%)
 Frame = +1

Query: 838  STIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL 1017
            S +QS+  A   I+ ++  H+       KL +  +     +++K N+ S          L
Sbjct: 1856 SELQSNNEA--LIKEVESLHLQITDLDSKLNEANVN----SNSKENEISD---------L 1900

Query: 1018 FKEVKGEIFRLSKMN--LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR------VI 1173
              + K    +LS+M+  +  L     +N    LN++++E  +I    +T G+      + 
Sbjct: 1901 LIKAKDNSDQLSEMHSRIKTLTNEFELNEK-LLNEKSEELSAIKA--VTEGKENEIKKLT 1957

Query: 1174 NSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 1353
              LA     +   +SKL     D    +T+  L+ T    K  L +  + L  A+K K+ 
Sbjct: 1958 QELALSEEEIAVIKSKLKN--SDETAASTERKLLET----KEILSQMPTDLTTANKDKSD 2011

Query: 1354 KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEI 1533
             +     +    D+L   I      + S + S K K+    DQ    ++ +D  N K EI
Sbjct: 2012 LSIQLTETKKQLDVLNLQINENGDLLSSKIESLKEKE----DQLEKLQIESD--NSKEEI 2065

Query: 1534 QECKRTIESLTSQNALLLKDKRTIN------------ENNELQRIKI------QTMNESM 1659
            ++ K  +  L+  +  +L DK  +               NE++R ++      +T N+  
Sbjct: 2066 EKLKHQLSKLSENHDSILLDKNDLEAKVHDYENAIAERENEVKRYQLLLNEKERTSNDFK 2125

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
             K+    E   S+++ELD     F +    L    +E  N  +++  K +   D+    +
Sbjct: 2126 DKITVAEEEIHSLKSELDRLKIAFDEQKKSLDLASEEKYNTNSILEDKLRISRDNFEKQL 2185

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL------LSTARDNFE--------- 1974
            S+K     ++   + I  N    E    +++E+ +L      +   RD +E         
Sbjct: 2186 SEK-----DDKISELIIANTDATEKYSSLQTEIQSLKHLIDEIKEERDLYESNNKNKNDT 2240

Query: 1975 -KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITD 2151
             K     I    SD  +   E ++ +  LKA T     ++ E L+ L ++Y++ K   T+
Sbjct: 2241 IKDLTASIANIKSDCKMKIYEKDEEIELLKANTKYEERRLDEELTSLKQKYDDLKSKSTE 2300

Query: 2152 EFYNQEKGHQHELLNKYINNTQ------------------------TVIESSSNDVMS-T 2256
            E    +   QH+ LN    NT+                         +++ S ND +S  
Sbjct: 2301 EAILLKDKLQHKALNIETLNTEITRLETNISELNLDTSKFKSLNEDILLKQSDNDSLSKK 2360

Query: 2257 IQNLLNEHL---RANKELIINS--LSNVTTELMS--NELDRLKPKLSKWEESAELINRSD 2415
            I  ++ E      AN+EL+I S  L     EL +  N L      LSK +E  E+    +
Sbjct: 2361 IDEIVKEKTDLKSANEELVIKSRTLEEEMKELSNSKNALQAELKTLSKLKEEKEIQTSLN 2420

Query: 2416 ALNNEFNDNVESSMTTMTDKIKQTN 2490
              + E N  +  S   +  KI + N
Sbjct: 2421 EKSKEENIQLSKSNDELQSKIAELN 2445

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 113/489 (23%), Positives = 210/489 (42%), Gaps = 33/489 (6%)
 Frame = +1

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQ-----QHYKELTTDLQNYKTEIQECKRTIESL 1563
            LK +  E T ++++L +T+++     ++       Y ++ ++      EI+     I+ L
Sbjct: 1335 LKQLKKEKTTLQANLKTTEAELNDLQEKYSANVNSYNDIISEKDKLTEEIKLSDDKIKEL 1394

Query: 1564 TSQNALLLKDKRTINENNELQRIKI------QTMNESMKKLYAKIE--RQQSIENELDGK 1719
              +  L  KDK   N+N E++ IK+           ++  L AK+    ++S E++L   
Sbjct: 1395 --ELVLEEKDKVITNQNAEIKNIKLDFEEKGNDYKRTIVDLKAKLSDLTKESAESKL--- 1449

Query: 1720 IQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNF 1899
              +  KT   L K ++ +K+ E++++S   T    SL     KL       +++ INQ  
Sbjct: 1450 --LMEKTIKDLEKNMETLKS-ESVISSNLSTERITSLELEIAKLT------EEKKINQT- 1499

Query: 1900 TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLL----FDEINDNVLNLKAL 2067
              ++ +  +KS++ NL     D+ EK   E   +  S+   L    F  I ++ + L AL
Sbjct: 1500 NFNDKISELKSDIINLEKEKDDSKEKNKTES-AELKSEIEELQNKNFKMIEEHTITLDAL 1558

Query: 2068 TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDV 2247
             ++      E L    E++      +T +        ++ELL+K    +   I S   D+
Sbjct: 1559 KTD-----VERLEKAKEDFQVQNNSLTSDLET-----KNELLHKLKEKSANTISSLKEDL 1608

Query: 2248 MSTIQNL-LNEHLRANKELIINSLSNVTTEL--MSNELDRLKPKLS-KWEESAELINRSD 2415
             +  QNL L E  +  +E  I  LSN++ +L  +S + + L  KLS K +  +E+ N + 
Sbjct: 1609 ET--QNLQLKEKTKCAEESAI-ELSNISKDLNELSAKYESLNSKLSLKQDALSEITNENA 1665

Query: 2416 ALNNEFNDNVE------SSMTTMTD----KIKQTNDSXXXXXXXXXEHFKTN-DIAHXXX 2562
             LN++   + E      SS+  +      KIK  +           E  K N ++AH   
Sbjct: 1666 ELNSQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVNEELAHLKE 1725

Query: 2563 XXXXXXXXXXXXXXXXXXXXXRLHEFVKEGY-LVTNESMKKLNELDTSIRTVLKDIDYEK 2739
                                 +    + EG   +T E  +K+N L+ S+R V  ++D +K
Sbjct: 1726 SSSKTILSLNDKITSLSEEFEKERTQLTEGSDSITKEYSEKINRLEESLRKV--ELDKDK 1783

Query: 2740 DIKETNSPL 2766
            +  E  + L
Sbjct: 1784 ETLEYKNKL 1792

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 83/387 (21%), Positives = 163/387 (42%), Gaps = 11/387 (2%)
 Frame = +1

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
            L  T +T+E  +     +N+ +  S       +  +  EL+K K   L+ K  D I   +
Sbjct: 1547 LRTTIATVEKENTTLKRENQLKSESIDKHQNNIHLLQEELSKQKE--LADKKHDEIRKLE 1604

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
            +   ++   +   + +  +    I ++  +N+ L+ +++T+ E       K++   + + 
Sbjct: 1605 KENSKMIDRIDKLEKQKADTNEKIANIEKENSSLISERKTLVE-------KVENFQDEIT 1657

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHS--LSY 1836
             L + +E+  S+ +  D     F +  ++L + + E+   E+        +++H   +S 
Sbjct: 1658 NLKSSLEKNDSLSSSHDELKDKFNELETELKRNLTELNKLESENKQLSDKVIEHEEKVSM 1717

Query: 1837 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDT 2016
            V K+L+   +  K++    N   D N +L K+             EK Y+E ITK  SD 
Sbjct: 1718 VEKELSTAQKTLKEREDVINKLKDSNNELNKT------IDKHGATEKHYEESITKKDSDI 1771

Query: 2017 PLLFDEIND------NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 2178
              L  +I D      N+L  KA  +   +Q+ ++ +DL    +  KQ +  E Y  +   
Sbjct: 1772 AQLKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTDLKNSESELKQEL--EHYRSKYSS 1829

Query: 2179 QHELLNKYINNTQTVIESSSNDVMSTIQNL-LNEHLRANKELIINSLSNV--TTELMSNE 2349
                L       + V E S     S   +L   +    + E+ I+ +  +    EL++ E
Sbjct: 1830 LESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEISISEMDAIKKQVELLTKE 1889

Query: 2350 LDRLKPKLSKWEESAELINRSDALNNE 2430
               LK K +K + SA+L +  D L  E
Sbjct: 1890 NVDLKSKSNKADNSAKLKSELDELKKE 1916

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 133/626 (21%), Positives = 247/626 (39%), Gaps = 63/626 (10%)
 Frame = +1

Query: 796  NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            N++ +     + D + IQ        I+  Q   I+T K  I  L+  L   +     + 
Sbjct: 1052 NEANSSIDEKNKDLNNIQQQ------IEGSQS-EISTLKAEITQLKTSLNEEKSTRKALE 1104

Query: 976  DFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSEN---INRSGALNQRAKEAGSINQ 1146
                 + T       +  + E+ +L K   VDL  SEN   ++ + +L Q+  E      
Sbjct: 1105 KLKEENETYI-----QSAQDELLQLQKE--VDLLKSENKDALDNNSSLKQKYDE------ 1151

Query: 1147 SLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT----LEET 1314
                   ++  L  KN+     ESK  +L  +SL  N+K   +     +K      LEE 
Sbjct: 1152 -------LVKELELKNL-----ESK--QLSDNSLNLNSKIEQLEGDIKSKYNTIKELEEK 1197

Query: 1315 CSTLEYASKAKNIKNKPQLGSFIMKDILLK------NITTELTKIKSDLLSTKSKDGIYM 1476
             ST     + +NI N        + DI LK        T +  K++   +S + K     
Sbjct: 1198 LST-SLQEREENIAN--------IADIELKLNSKEEQYTEQTNKLEELRISFEKK----- 1243

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDK-------RTINENNELQRIK 1635
             Q   KEL + L++   ++QE  R  + L      L+KDK       +++ E+ + +  K
Sbjct: 1244 -QSECKELESKLKSSNDDLQEKNRLTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKK 1302

Query: 1636 IQTMNESMKKLYAKIERQQSIEN--------ELDGKIQ-------IFTKTNSKLTKIIDE 1770
             +   + + K    I +Q    N        ++D K +           T  K+ K+ ++
Sbjct: 1303 YKEEIDQLGKENEDITKQNKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEK 1362

Query: 1771 MKNRE-----------ALVNSKFKTLLD----HSLSYVSKKLNYQIENFKDQGINQNFTV 1905
            +K+ E           +L +   KT L+     S +    KL  +++   D+ I +N   
Sbjct: 1363 IKDLEDTQHIFKDSENSLKSELEKTALEMNELRSDNDNIIKLKNELQRTNDKLIEENKRT 1422

Query: 1906 DENLQLIKSEMTNLLSTARDNFE---KFYQECITKFLSDTPLLFDEINDNVLNLKALTSN 2076
            +E L+   +++ + L T  D FE   K   E  +  + +       + + V  +K+    
Sbjct: 1423 EEKLRSEVAKLKDELKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDK 1482

Query: 2077 YYSQIAENLSDLSEEYNNFKQFITDEFYNQ----------EKGHQHELLNKYINNTQTVI 2226
              + + +    L  E ++ KQ I D  YNQ          EK  + ++    + N +   
Sbjct: 1483 EINILEDKKEVLESELSDKKQEIID--YNQKIKEQETKATEKEKEIQVAKNALKNAEKKK 1540

Query: 2227 ESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELIN 2406
            +   ND+ +TI  +  E+    +E   N L + + +   N +  L+ +LSK +E A+   
Sbjct: 1541 KDIENDLRTTIATVEKENTTLKRE---NQLKSESIDKHQNNIHLLQEELSKQKELAD--K 1595

Query: 2407 RSDALNNEFNDNVESSMTTMTDKIKQ 2484
            + D +     +N  S M    DK+++
Sbjct: 1596 KHDEIRKLEKEN--SKMIDRIDKLEK 1619

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 77/360 (21%), Positives = 148/360 (41%), Gaps = 25/360 (6%)
 Frame = +1

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLY 1671
            ++L  +L++  + I E ++T+ES   +    L +    N + E    + + + E +KK  
Sbjct: 742  EQLKKELEDKLSTISEKQQTLESEYEEKKKELAEITANNTSLEQLNTQKEKLTEELKKQL 801

Query: 1672 AKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL 1851
            A  + + +   +++ +++  ++   K  + I++M NR+     + K  L+       K L
Sbjct: 802  ADTKEKLT---QMEKQVKELSEHKEKNEQGINKM-NRDLFSLQREKQKLEEDNKQSKKDL 857

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQEC--ITKFLSDTPLL 2025
                 +F  Q       +     LIK E T  L+ A    ++++ +   IT  +++    
Sbjct: 858  EKTKNDFTKQETKLKDQIKAKEILIK-ETTEKLNEATTQSKEYHDKIQNITSEMNEWQAK 916

Query: 2026 FDEINDNVL----NLKALTSNYYSQIAE------NLSDLSEEYNNFKQFIT------DEF 2157
            +   +  V      LKAL +++    AE       L  +++E +     IT      +E 
Sbjct: 917  YKSHDTFVAKLTEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKSLEEL 976

Query: 2158 YNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTEL 2337
            Y   +  +  LL K I   +T IES +         L +E  R   E I    SN   E 
Sbjct: 977  YKNMESEKDGLLKK-ITELETGIESDNKKFEDEKSALESETKRLTLE-IAEFKSN--AEK 1032

Query: 2338 MSNELDRLKPKLSKWEESAELINRS-DALNNEFN------DNVESSMTTMTDKIKQTNDS 2496
            +  E +RL+     ++E     N S D  N + N      +  +S ++T+  +I Q   S
Sbjct: 1033 LDTERERLQTLTESYKEKLNEANSSIDEKNKDLNNIQQQIEGSQSEISTLKAEITQLKTS 1092

 Score = 37.4 bits (85), Expect = 0.26
 Identities = 61/314 (19%), Positives = 137/314 (43%), Gaps = 42/314 (13%)
 Frame = +1

Query: 958  ASTKMNDFSSRSHTIFTITLFKEVKGEIFR-LSKMNLVDLAGSENINRSGALNQRAKEAG 1134
            +S + ND  S SH       F E++ E+ R L+++N ++   SEN   S  + +  ++  
Sbjct: 1661 SSLEKNDSLSSSHDELK-DKFNELETELKRNLTELNKLE---SENKQLSDKVIEHEEKVS 1716

Query: 1135 SINQSLLTLGR-------VINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPA 1293
             + + L T  +       VIN L D N       ++L + +     G T+     +I+  
Sbjct: 1717 MVEKELSTAQKTLKEREDVINKLKDSN-------NELNKTIDKH--GATEKHYEESIT-- 1765

Query: 1294 KVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIY 1473
                ++     +   K K+I++K  L + + +      + T+L K K+DL +++S+  + 
Sbjct: 1766 ----KKDSDIAQLKKKIKDIEDK--LSNILEEKAKAAMLMTQLEKDKTDLKNSESE--LK 1817

Query: 1474 MDQQHYKELTTDLQNYKTEIQECKRTIE--------------------------SLTSQN 1575
             + +HY+   + L++     +E K+ +E                          S++  +
Sbjct: 1818 QELEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEISISEMD 1877

Query: 1576 ALLLKDKRTINENNELQR--------IKIQTMNESMKKLYAKIERQQSIENELDGKIQIF 1731
            A+  + +    EN +L+          K+++  + +KK   K++ + +  +ELD  + + 
Sbjct: 1878 AIKKQVELLTKENVDLKSKSNKADNSAKLKSELDELKKENEKLQLKVNDRSELDDLMLLV 1937

Query: 1732 TKTNSKLTKIIDEM 1773
            T+ + K +K  +++
Sbjct: 1938 TELDEKNSKYREKL 1951

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 117/548 (21%), Positives = 231/548 (42%), Gaps = 23/548 (4%)
 Frame = +1

Query: 910  KEGIKLLQKGLKYRQVASTKMND---FSSRSHTIFTITLFKEVKGEIFRLSKMNLVD-LA 1077
            KE IK +Q  L+    A+T+ +     + R      I   +E   E+ R+++ NL D L 
Sbjct: 503  KEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTR-NLADKLE 561

Query: 1078 GSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGN 1257
             +EN +++   N   +      +++LTL      L  K   +     K      D    +
Sbjct: 562  SNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQ-ETS 620

Query: 1258 TKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKS 1437
               ++I  ++  K  LE     L+ A  ++  +   +  S + K+  L+++    + +  
Sbjct: 621  PNNSVIQQLTETKRELESQTQDLQ-ARISQVTRESTENMSLLNKE--LQDLYDSKSSLSI 677

Query: 1438 DLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRT----- 1602
            +L   + K    + ++ +K L+  L   K E  + ++   S+  QNA+  +D +T     
Sbjct: 678  EL--GREKSSRILAEERFKLLSNTLDLAKAENDQLRK--RSINLQNAISKQDSKTQETLN 733

Query: 1603 --INENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMK 1776
              ++  ++L  I+ +  N  +++   KIE +++++ EL       T  +  +T++    K
Sbjct: 734  DYVSCKSKLSAIETELSNLKLERT-LKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQK 792

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENF-KDQGINQNFTVDENLQLIKSEMTNLLS 1953
             RE L++   K+  +   +  + +   + E   KDQ I Q   ++E+         N + 
Sbjct: 793  ERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQ---LEEDNDSKIEWYQNKIE 849

Query: 1954 TARDNFEKFYQEC------ITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD-- 2109
            T R + E            + +F  +   L  EI +N + L     + Y+ + E+++D  
Sbjct: 850  TLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRL-----HTYNVLDESINDDS 904

Query: 2110 LSEEYNNFKQFITDEFYN-QEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNE--H 2280
            L  E    K  +TD +   QE    +E  +K +    + ++ S+    + IQNL +E   
Sbjct: 905  LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTS 964

Query: 2281 LRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMT 2460
            L     L+   +SN     ++NELD     + K  E AE   +   L N  N  +E+  T
Sbjct: 965  LEDKVSLLREQMSN-----LNNELDLQNQAMEK--EKAEFKKKISILQNN-NKEIEAVKT 1016

Query: 2461 TMTDKIKQ 2484
                K+ +
Sbjct: 1017 EYESKLSK 1024

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 119/603 (19%), Positives = 225/603 (37%), Gaps = 61/603 (10%)
 Frame = +1

Query: 826  DNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAST------------K 969
            D D+ TI ++     Y Q LQ+ H   +K   +L ++   Y+    T            K
Sbjct: 1028 DLDQQTIYANTAQNNYEQELQK-HADVSKTISELREQLHTYKGQVETLNLARGQFEKALK 1086

Query: 970  MNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1149
             N+ +  S     +         I  LS  N +     E    +G     AK    +N  
Sbjct: 1087 ENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNND 1146

Query: 1150 LLTLGRVINSLADKNVHVPFRESKLTRL---------------LQDSLGGNTKTALIATI 1284
            +L   R    + D  V V  R++K+ R                L +S   N K + I   
Sbjct: 1147 ILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQ 1206

Query: 1285 SPAKVT-------LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL 1443
                +        L E+ +TL     + N KNK            +  I +EL  +K  +
Sbjct: 1207 HDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSI 1266

Query: 1444 LSTK-----SKDGIY--------MDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA-- 1578
               +     +K+ ++        + ++H +  +TD +  +TEI+  K  +E  T Q A  
Sbjct: 1267 QEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADS 1326

Query: 1579 --LLLKDKRTINENNELQRIKIQTMNESMKKLY-AKIERQQSIEN------EL-DGKIQI 1728
                 + +R   E  +  ++   +  E + +L  AK+  ++S+ N      EL D K+  
Sbjct: 1327 EEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAE 1386

Query: 1729 FTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS--KKLNYQIENFKDQGINQNFT 1902
                 S + K+ ++ +     + +K   L ++++SY S  KKLN +I   K++ + +   
Sbjct: 1387 NRNQLSMIKKLQEDTEENSKELETK---LEENAISYDSTVKKLNEEIGILKEE-LEKQRQ 1442

Query: 1903 VDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYY 2082
            + +  Q       + LS   ++ ++ ++E   KF+ +      E+N  +           
Sbjct: 1443 IQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKT---REVNQKIREF-------- 1491

Query: 2083 SQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQ 2262
             Q A+   +   + +N      DE   Q +   +E ++K I                  +
Sbjct: 1492 -QEAQEAEETGLKPSNIN---IDEIKKQWEAEHNEEVSKKIREA---------------E 1532

Query: 2263 NLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDN 2442
              L + +R   E  I+ +     E +  E D       K EE  + I++S  + + F   
Sbjct: 1533 EALKKRIRLPTEEKISKIIERKKEDLEKEFD------EKVEERLKSISQSGKMEDIFQKQ 1586

Query: 2443 VES 2451
            +ES
Sbjct: 1587 LES 1589

 Score = 38.9 bits (89), Expect = 0.089
 Identities = 78/420 (18%), Positives = 167/420 (39%), Gaps = 13/420 (3%)
 Frame = +1

Query: 1084 ENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 1263
            E  + S       +E   ++  L ++ R ++ L+++   +   + +  ++L + L     
Sbjct: 98   ERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKE--- 154

Query: 1264 TALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL 1443
               +  +  A    +  C  L         K +  + + +     L+  T EL  ++S+ 
Sbjct: 155  ---LEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSN- 210

Query: 1444 LSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL 1623
                 KD +       KEL++  Q Y +  Q+    I  + +    +  D +    NN++
Sbjct: 211  -----KDWLE------KELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDV 259

Query: 1624 QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
             R   Q  NE  K L  K+ + +++ +  + + + F+   +   ++ID ++++   V  +
Sbjct: 260  LR---QKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEE 316

Query: 1804 FKTLLDHSLSYVSKKLNYQIENFKD--QGINQNFTVDENLQLIKSEMTNL------LSTA 1959
                        +++ NY   N  D  Q I++N  + ++LQL K ++         LS+ 
Sbjct: 317  LNN---------TRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSI 367

Query: 1960 RDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEE---YNN 2130
             +   K      +K   D  LL       ++  K    +  +QI   + +L  +    N+
Sbjct: 368  TEEAGKEDGILTSKSNGDFILL----KKQLIKEKRAKEHLQNQIESFIVELEHKVPIINS 423

Query: 2131 FKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL--LNEHLRANKELI 2304
            FK+             + + L   +NN   ++E +SN+  + I+ L   NE L   K+ I
Sbjct: 424  FKE-------------RTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEI 470

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
            to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
            involved in control of spindle dynamics
          Length = 816

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 82/380 (21%), Positives = 171/380 (45%), Gaps = 35/380 (9%)
 Frame = +1

Query: 1453 KSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ-------NALLLKDKRTINE 1611
            K+++   + Q    +   DL+N K +++E +  I +L +Q       N+ LL++K  +  
Sbjct: 406  KAREEYIIIQNEKDKAIEDLRNCKGKVEELESEIITLKTQINENEDWNSKLLQEKTNLEA 465

Query: 1612 N----NELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKN 1779
                  E   +K + + E  KKL   I  Q++   EL  K++   KTNS L K     K 
Sbjct: 466  QVKNIEEKDLLKSEQITELEKKLQDAISSQKNTNTELSLKVEELLKTNSSLEKDAITWKY 525

Query: 1780 REALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL---L 1950
            +      + KT L+     ++   +  +  ++ Q           ++ ++SE+T++    
Sbjct: 526  KLESREIELKTTLEGKEKELANATS-TLSKYESQ-----------IRELRSELTDVEMKY 573

Query: 1951 STARDNFEKFYQECITKFLSDTPLLF--DEINDNVLNLKAL---TSNYYSQIAENLSDLS 2115
            ST + +FE    +   +    T L +  D++ + V NL++      +Y +++ E L    
Sbjct: 574  STLKKSFEDVDDDAKIRSAEVTELNYKIDDLREKVENLESSLQEKDDYINKLKEELQSKK 633

Query: 2116 EEYNNF---KQFITDEFYNQEKGHQHEL--LNKYINNTQTVIESSS---NDVMSTIQNLL 2271
            +E++      + +  +  N EK H  EL  L++ +++ +  ++S +   ND+   I  L 
Sbjct: 634  DEHSKTLLELESVHLKNNNIEKEHLAELEGLHESLSHLEEELKSKTICVNDMKDEISKLE 693

Query: 2272 NEHLRANKELIINSLSNVTTELMSN------ELDRLKPKL--SKWEESAELINRSDALNN 2427
            +E       +   + +++ TE + N      E+D+L+ KL  S+ E++ +L   SD L  
Sbjct: 694  DEKKEYLSSVSKQNTTSINTEGIMNLQNLQREIDQLRDKLNNSEQEKNKQLQQLSDDLYV 753

Query: 2428 EFNDNVESSMTTMTDKIKQT 2487
            +++   E  +  +    + T
Sbjct: 754  QYSSKHEQKVKMLKKNYEAT 773

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 39/111 (35%), Positives = 65/111 (58%), Gaps = 2/111 (1%)
 Frame = +1

Query: 199 NSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 378
           + +T+++DKVF PSA+Q+ +   +  P+  +   G N  M   G + TGKT+TM G + +
Sbjct: 40  HERTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV 99

Query: 379 YNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSF--VELYNEELKDLLH 525
                  S G++ RIL K+F+ + + NE   V+ S   VEL N+++ DLL+
Sbjct: 100 -------SQGLLQRILTKVFQLMNE-NEGVTVQYSLSAVELVNDKVYDLLN 142

>Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..61998)
            [2874 nt, 958 aa]
          Length = 957

 Score = 62.0 bits (149), Expect = 7e-09
 Identities = 132/638 (20%), Positives = 271/638 (42%), Gaps = 72/638 (11%)
 Frame = +1

Query: 793  NNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHIT---TAKEGIKLLQKGLKYRQVAS 963
            NND   K S   N+++ ++SD      I+N  E  ++   T ++   L           +
Sbjct: 98   NNDHTYKQSKELNNENKLESD------IENFDESKLSRKETVEQSTPLASSATSTATSTT 151

Query: 964  T--------KMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQR 1119
            T         + D++ + + +  + +  E+  + + + ++   +L  S+    S  +++R
Sbjct: 152  TVTAAESAADIEDYNEKLNEMNQLIINTEILQKNYNVLELTNKELT-SDVKRLSDLISER 210

Query: 1120 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
              E   +N+ + T    I  L D  +    ++ +++RL  DS   + K   I T+S A  
Sbjct: 211  ELENSRLNEIISTKDGDIKRLNDIFIS---KDQEISRL-NDSF--SLKEQEIKTLSNAFT 264

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLL----STKSKDG 1467
            + ++    L+ A + K+ + K     F+ KD  +K +         ++     S +SKD 
Sbjct: 265  SKDQEIKRLDDALRLKDQEIKRLDDIFLSKDQEIKRLNDTFISKNEEIKRLNDSLRSKDS 324

Query: 1468 IYMDQQHYKELTTDLQNYKTEIQECK----RTIESLTSQNALLLKDKRTINENNELQRIK 1635
               D Q    L  +L+ +K+  QE      +   +L S+  L  +    +NEN +L+ I+
Sbjct: 325  ---DIQTINILVDNLKEFKSLQQENDSNNTKNYSNLISEINLKFEK---LNENIKLKDIE 378

Query: 1636 IQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK----LTKIIDEMKNREALVNSK 1803
            I  +NE++ +L  K  + +  ++ L+ K+++  + N+K    L  +  ++K  E ++N+ 
Sbjct: 379  INKLNETISELKNKDLQGKYDKDLLNEKLRLQVEQNNKDEDDLKILNGKIKEYEEIINNS 438

Query: 1804 FKTLLDHSLSY-----VSKKLNYQIENF-------------KDQGIN--------QNFTV 1905
              T+ +   ++       K LN ++++F             KD+ IN        Q  ++
Sbjct: 439  KCTISELQANFNEANNTIKNLNAKLDSFVKNLEEANSELSNKDKEINELTLKSTQQKLSI 498

Query: 1906 DE-NLQLIK-----SEMTNLLSTARDNFEKFYQECITKFLS--DTPLLFDEINDNVLNL- 2058
            +  N +L+      S M+  L   RD          T   S     L+   +   ++NL 
Sbjct: 499  ETFNEKLVTNTSQISVMSENLKEERDKLSSLNDLLQTSEASVKSKELMVSSLESKLVNLN 558

Query: 2059 ---KALTSNYYSQIAENL------SDLSEEYNNFKQFITD-EFYNQEKGHQHELLNKYIN 2208
               K L     +  AEN        ++ E+ N FK +I D + ++ + G+   L+ K   
Sbjct: 559  DSIKTLDDKIVTMEAENAELKKDNEEMLEKVNKFKNYIQDFKLFDVQVGN---LIMKMFW 615

Query: 2209 NTQTVIESSSNDVMSTIQNLLNEHLR-ANKELIINSLSNV---TTELMSNELDRLKPKLS 2376
            N Q   E S      T    + E+L+ +N + I+   +N      E + +++D L  ++S
Sbjct: 616  NAQHPKEKSGR---YTDAKFIRENLKDSNMQSIVAFKTNEDERNLEELEDKVDSLTYEIS 672

Query: 2377 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 2490
            K ++  E  N  +   ++    +E     +  +I++TN
Sbjct: 673  KMQKDIE--NNWEVKCSQLTTELEKGRIELKKEIEKTN 708

>Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa] {ON}
            YDL058W (USO1) - Integrin analogue gene [contig 72]
            PARTIAL
          Length = 1215

 Score = 62.0 bits (149), Expect = 7e-09
 Identities = 93/494 (18%), Positives = 200/494 (40%), Gaps = 15/494 (3%)
 Frame = +1

Query: 1102 GALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIAT 1281
            G L   + +   +N+ L+T+ +   +LAD+      ++ +   +L+     + K  L A 
Sbjct: 580  GELGMTSTKLDKVNEKLITIEKEKTALADE-----CKKKEEEYILKVESLNSEKLKLEAK 634

Query: 1282 ISPAKVTLEE-------TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            +S  +  L +       T ++LE  S+ + ++      S  M +++LK     L K+K +
Sbjct: 635  VSDLQKCLNDERLNWDRTTASLE--SEIERLREVENTSSSSMNELVLK--VQSLEKVKDE 690

Query: 1441 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 1620
            L+S        M  Q  K L +DL   + +    +  I  L S++A +      +     
Sbjct: 691  LISKNKAIHEEMQDQEAK-LKSDLNATRQDSAGTQARISKLESEHAEVALRAEQLE---- 745

Query: 1621 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 1800
                         KKL    E+Q  +EN L   +    + + K+TK+I+E+   +A +  
Sbjct: 746  -------------KKLAGSKEKQLELENGLKEAVDQGMEKDGKVTKLIEEIAEAKADLKE 792

Query: 1801 KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 1980
            K + +    LS    KL    +   ++      +  +  Q +++E+T L +  +D   +F
Sbjct: 793  KAEEI--RILSLEKSKLEDSYKRSMEELSRYKSSASDERQGLENEVTMLRNKLKDKCLEF 850

Query: 1981 YQECITKFLSD-TPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT-DE 2154
             +E   K L++ +  + ++ ++ V +L+    +  ++ +    D + E N  +  +   E
Sbjct: 851  EKE--RKLLNEGSTSVTEDYSNKVSSLEKKLDSLEAEYSSKRRDFANEQNELRALLAKSE 908

Query: 2155 FYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTE 2334
                +   + +L  + +++ + ++E+  N+V     +  +E    NK L    L     E
Sbjct: 909  KAASKTDAELQLAERKLSDVEKMMETKENEVKELQISKDSEVAEVNKSL--GKLKQTIKE 966

Query: 2335 LMSNELDRLKPKLSKWEESAELINRSDALNNEFND------NVESSMTTMTDKIKQTNDS 2496
              S   +  K    K    +EL   + A   E  +       +E S T    +++   D+
Sbjct: 967  KNSKLQELEKALAEKNHRISELTEETAAQKKELIEKESSLARIEESNTVSRKQLQSEKDA 1026

Query: 2497 XXXXXXXXXEHFKT 2538
                     +++ T
Sbjct: 1027 AIEKIERLQQNYNT 1040

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 127/631 (20%), Positives = 245/631 (38%), Gaps = 18/631 (2%)
 Frame = +1

Query: 655  KKLRNEALLRSRNIASSKRSSMQTIRNXXXXXXXXXXXXXXMFSSGNNDSANKFSPADND 834
            +K R   L  +R    +K   ++   N                   NN S   +    N 
Sbjct: 787  QKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQ---NK 843

Query: 835  KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 1014
               ++ D  + I   N ++  I   +  +K L+K +   ++   +++ ++    TI   +
Sbjct: 844  IEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKI---RLHTYNVIDGTINDDS 900

Query: 1015 LFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKN 1194
            L KE++      SK++L D              Q  KE    N   L           K 
Sbjct: 901  LRKELEK-----SKISLTDAYSQI---------QEYKELYETNAKSL-----------KQ 935

Query: 1195 VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLG 1374
            +H  F ES      +     N K++L   IS  K  +    + L+  +K      K +  
Sbjct: 936  MHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGM----KEEKA 991

Query: 1375 SFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQ---ECK 1545
             F  K  +L+N   E+  +KS+  S  SK    +DQQ     T    NY+ E+Q   +  
Sbjct: 992  EFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQ-NNYEQELQKHADVS 1050

Query: 1546 RTIESLTSQ--------NALLLKDKR---TINENNELQRIKIQTMNESMKKLYAKIERQQ 1692
            +TI  L  Q        N L L   +   T+ EN      + + + E ++   ++IE   
Sbjct: 1051 KTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLT 1110

Query: 1693 SIENELDGKIQIFTKTNSKLTKIIDEMKNREALVN-SKFKTLLDHSLSYVSK--KLNYQI 1863
            S    L  +I+++T  +  +T   D+      L++  + + +LD  ++   +  K+  Q 
Sbjct: 1111 SQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQK 1170

Query: 1864 ENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIND 2043
             +  D  + +  T  +N +L + +   ++    D  EK  Q  + +  + T  L +E+ +
Sbjct: 1171 ISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNIT--LRNELEN 1228

Query: 2044 NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTV 2223
            N    + L S    ++ ++++ +  E    K      +  QEK  +  L  + ++  +  
Sbjct: 1229 NNEEKRVLQSE-LDKLKQDIAPIESELAALK------YSMQEKEQELRLTKEEVHRWK-- 1279

Query: 2224 IESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKL-SKWEESAEL 2400
                        Q++L +H           +S+   E + +E+D LK KL  K  + AE 
Sbjct: 1280 ---------KRSQDILEKH---------RQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEA 1321

Query: 2401 INRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
              R + L  +  + +++S  ++    +Q ND
Sbjct: 1322 EERFNRLRRQAQERLKTSKLSLDTLTEQVND 1352

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 91/444 (20%), Positives = 179/444 (40%), Gaps = 59/444 (13%)
 Frame = +1

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD------ 1479
            ST ++  K    KN+  L      D ++  I  EL  ++SD    K+K+ +         
Sbjct: 209  STNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKNDELS 268

Query: 1480 ---QQHYKE-------LTTDLQNYKTEIQECKRTIESLTSQ-NALLLK------------ 1590
               Q+   E       L+++ Q + TEI   +R ++ L SQ NA+  +            
Sbjct: 269  KSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGLETSND 328

Query: 1591 DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK-----LT 1755
             K+ ++E  +L + ++Q   E + +  ++  R  SI  E D +    T  +S        
Sbjct: 329  SKKHMSEKEDLVK-ELQLTKEELAQCKSECIRLSSIIGETDEESGSSTSRSSSDFILLKK 387

Query: 1756 KIIDEMKNREALVN--SKFKTLLDHSLSYVS----------KKLN------YQIENFKDQ 1881
            ++I E + +E L N    F   L+H +  ++           +LN          N K+ 
Sbjct: 388  QLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNA 447

Query: 1882 GINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK 2061
             I +     E L+  ++++  L+    D   +     IT  +S          D+   L+
Sbjct: 448  KIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVS---------KDSKGPLR 498

Query: 2062 ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYN-------QEKGHQHELLNKYINNTQT 2220
                 +   I +N SD + E ++ ++ +T+           QEK  +   L K + N   
Sbjct: 499  KEEIMFIQNILQNDSDTATETDS-QKIVTERLVEFRSIIELQEKNTE---LLKIVRNLAD 554

Query: 2221 VIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAEL 2400
             +ES+ N+   ++Q + +E +   KE I+          +  E ++L+ K+ + E+  E 
Sbjct: 555  RLESNENESKQSLQKIESETINEAKEAILT---------LKAEKEQLESKVEELEKECE- 604

Query: 2401 INRSDALNNEFNDNVESSMTTMTD 2472
             N    L+NE   ++ S++  + +
Sbjct: 605  -NSKALLSNEETSHLNSTIQQLNE 627

 Score = 37.7 bits (86), Expect = 0.20
 Identities = 117/604 (19%), Positives = 225/604 (37%), Gaps = 55/604 (9%)
 Frame = +1

Query: 1210 RESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC----STLEYASKAKNIKNKPQLGS 1377
            R     RL    L  +T T  +  +  AK+ LE++     + +E    AK  ++  QL +
Sbjct: 1329 RRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDA 1388

Query: 1378 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE 1557
                   +K +  +      +  +   +   + D    K+L  ++   + EI++ +R  +
Sbjct: 1389 -------IKRLQQDAENSSKEFKTKLEEKATFYDST-IKKLNEEIITLREEIEKQRRIQQ 1440

Query: 1558 SLTSQNALLLKDKRTINENNELQRI-----------KIQTMNESMKKLYAKI----ERQQ 1692
             L S+ A         NE N+L +I           KI  + E  K++  KI    ER  
Sbjct: 1441 QLQSEPA---------NEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN 1491

Query: 1693 SIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENF 1872
               N    +++I  K   +  ++++ ++  E  +  + +   +  +S + ++    +E  
Sbjct: 1492 QPSNINIDELKIKWKAEHE-EEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKE 1550

Query: 1873 KDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVL 2052
             D+       V+E ++L+ S+   +  T +  FE   QE   K L D    ++E    + 
Sbjct: 1551 FDE------KVEERIKLL-SQSGQMDVTFQKQFEIRIQEK-QKELEDK---YNEKLKELS 1599

Query: 2053 NLKALTSNYYSQI-AENLSDLSEEYNNFKQFITDEFYNQEKGHQHELL------------ 2193
            +  +++ +   Q+ AE  + + +E +N  Q I  + +  E+G Q  ++            
Sbjct: 1600 HSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSF--EEGKQQAMMKTTLLERKLAKM 1657

Query: 2194 --------------NKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTT 2331
                          +K++N+TQ  +      +     +  N  L   K L +NS S+ + 
Sbjct: 1658 ESQLSETKKITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSG 1717

Query: 2332 ELMSNELDRLKPKLSKWEESAEL-INRSDA---LNNEFN-----DNVESSMTTMTDKIKQ 2484
                           K ++  EL  N++D    L   FN       + SS T  TD    
Sbjct: 1718 GFNPFTSPSPNKSSQKVDDQRELTTNKADPPTHLTPSFNIPAGRGLISSSSTLSTD---- 1773

Query: 2485 TNDSXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVT 2664
            TND          E   ++D                              EF ++   V 
Sbjct: 1774 TNDE----ELTGNEQNNSSD---------------GNTQLEAGIEKAEEKEFAEKKKEVE 1814

Query: 2665 NESMKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNA 2844
             E+      +D  +R  LKD D E   + +N P K     +      +DN++K    N++
Sbjct: 1815 GETTSHKRPID-EVRE-LKDDDDEVSAEFSNEPKKVKTDDEEEEKAKVDNERKDEGENSS 1872

Query: 2845 NDNE 2856
             D+E
Sbjct: 1873 KDSE 1876

>KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}
            Anc_7.21 YAL047C
          Length = 777

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 99/432 (22%), Positives = 185/432 (42%), Gaps = 29/432 (6%)
 Frame = +1

Query: 1060 NLVDLAGSENINRSGALNQ-------RAKEAGS--INQSLLTLGRVINSLADKNVHVPFR 1212
            N++DL     INR   LN        +AK +GS  I   L  L + +  L DK       
Sbjct: 329  NILDLL----INRDMGLNSPMIKDLVKAKTSGSSFIMNKLNVLEKSLTYLFDKI------ 378

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTL--EYASKAKNIKNKPQLGSFIM 1386
            ++K++R + +S   +T+     T       +E     L  EY    K I+ K    S + 
Sbjct: 379  QNKMSRSMDESYEADTERNRENTSQGVDSKMELVIEDLHQEYDKFIKGIRTKLSRSSELE 438

Query: 1387 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 1566
            + ++LK   +    + SD+ S K K+    ++  + +LT  L++Y+ + +     I+SL 
Sbjct: 439  QLLILK--LSRQQDLLSDIAS-KYKE----NESDFNKLTL-LKSYQEQSELLNNLIKSLK 490

Query: 1567 SQNALLLKDKRT--------INENNELQRIKIQTMN-----ESMKKLYAKIERQ--QSIE 1701
              N    KDK          +NE+  L++ +IQ  N       +KKL +K++ Q  +++ 
Sbjct: 491  QSN----KDKDNEIARITYKLNESESLKQDEIQQRNLIKELHDLKKL-SKLKEQNWENLT 545

Query: 1702 NELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQ 1881
            N+LD +I   T TN     ++ ++K     + +  + LLD        K NY     +  
Sbjct: 546  NQLDVQINELTSTNKNFEDLVAQLKTDLNELKTSNEELLD---QLDDNKKNYDTSMNQLN 602

Query: 1882 GINQNFTVDENLQLIKSEMTNLLSTARD-NFEKFYQECITKFLSDTPLLFDEINDNVLNL 2058
             +  N  + E+L L +    + LS   + +F+KF    +    +   +L   I  N +N 
Sbjct: 603  ELKSNNALLEHLLLKQKAQQSRLSDVNEMDFKKFNNNIMIHLTNIFKILSKIIQKNSINQ 662

Query: 2059 KALTSNYYSQIA--ENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIES 2232
                 N  + IA  +N++ +  +Y +   FI     +  + +   +L++  + T    E+
Sbjct: 663  SLNKINSINNIASLKNITSMEAKYESLYTFIETAIESIIESYTRLVLSERDDITTNTSET 722

Query: 2233 SSNDVMSTIQNL 2268
              + +   I+ L
Sbjct: 723  KYDGMQLRIEEL 734

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 106/483 (21%), Positives = 202/483 (41%), Gaps = 42/483 (8%)
 Frame = +1

Query: 1159 LGRVINSLADKNVHVPFRESKLTRLLQDSLG--GNTKTALIATISPAKVTLEETCSTLEY 1332
            + + +++L+ +   +   + KL + +Q+ +    ++K      +   +  + +  S LE 
Sbjct: 836  MNKELSNLSKEKEQLRIEQGKLEKKIQEQISVYEDSKIKFNQELESTEKQITDLQSNLES 895

Query: 1333 ASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKS-DLLSTKSKDGIYMDQQHYKELTTD 1509
             +   +  NK + G       L+K +T    K KS D L  K  + +      YKEL T+
Sbjct: 896  KNTELDNLNKEKSG-------LMKELTEWKAKFKSHDALVPKLTEKLKSLANSYKELQTE 948

Query: 1510 LQNYKTEIQECKRTIESLTS------QNALLLKDK------RTINENNELQ---RIKIQT 1644
              NY +++ E  +   S  S       N  + KDK      + IN+ +EL+       + 
Sbjct: 949  RDNYSSQLIEINKNKTSELSSLSESISNLKIEKDKILDEKSKLINKVSELESQITENCKI 1008

Query: 1645 MNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH 1824
              E  +KL    +  + +  +L+ +++         +K  DE+    A +N++ K   D 
Sbjct: 1009 FEEEKEKLILSKDELEELVIDLNEQLKELETQKETTSKNADELNKSIANLNTQLKQ-KDS 1067

Query: 1825 SLSYVSKKLNYQIENFKDQG------INQNFTVDENLQLIKSEMTNLLS--TARDNFEKF 1980
             L  + + +     N  D        I +   +DE  + +K E+  L +  T   N  K 
Sbjct: 1068 KLIELEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKS 1127

Query: 1981 YQ---ECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITD 2151
             Q   + +   L +T LL     + +L+LK   S+  S   ENL +  ++ +   + +  
Sbjct: 1128 AQKETDTLQTKLDETELLLQSSKEEILSLKNEYSSTLSD-KENLENSEKKSSEKIEELEK 1186

Query: 2152 EFYN-QEKGHQHELLNKYINNTQTVIESSSNDVM-------STIQNLLNEHLRAN----- 2292
             F N QE+       NK +    +  E    DV         TI +L +E  + N     
Sbjct: 1187 NFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDD 1246

Query: 2293 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 2472
            KE II++L N   E +S ++D ++   +  EE  +L   +  LN+  ++N  S + ++ D
Sbjct: 1247 KEKIISNL-NEKLESISEDIDIIEKAKNLLEE--KLATMTSELND--SENGSSELRSLYD 1301

Query: 2473 KIK 2481
             +K
Sbjct: 1302 SLK 1304

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 122/622 (19%), Positives = 242/622 (38%), Gaps = 38/622 (6%)
 Frame = +1

Query: 1138 INQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            +N+ L   G  I+SL+D+       + KL  ++ D      K  +I+ ++    ++ E  
Sbjct: 1219 VNEKLDQYGETISSLSDE-------KDKLNGIIDD------KEKIISNLNEKLESISEDI 1265

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSK-DGIYMDQQHYK 1494
              +E   KAKN+  +            L  +T+EL   ++     +S  D + ++   ++
Sbjct: 1266 DIIE---KAKNLLEEK-----------LATMTSELNDSENGSSELRSLYDSLKIE---FE 1308

Query: 1495 ELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINEN-NELQRIKIQTMNESMKKLY 1671
            EL     +    ++E +    SLT    +LL+DK+ +  + N+  +IK     + ++K  
Sbjct: 1309 ELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESSINDYVKIK-----DDLEKEK 1363

Query: 1672 AKIERQQSIENELDGKIQIFTKTNSKLTKI----IDEMKNREALVNSK---FKTLLDHSL 1830
              +  + ++  +   K++I  + N+   K+    ID +K    +  ++    K  ++ S 
Sbjct: 1364 EDLLNKYNVLEDKKDKLEIILEENNSSIKVLEHSIDALKKENEIYKNEIHDMKLQMESSN 1423

Query: 1831 SYVSKKLNYQ---IENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITK 2001
            S    K   Q   I   K++      + +E ++ ++ E  N LS   D  +K +++ IT 
Sbjct: 1424 SEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKN-LSLGHDTEKKQFEDKITS 1482

Query: 2002 FLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK-QFI--TDEFYNQ-- 2166
               +       I  +    + +  N  + + + L +L +++ N + ++I   D F N+  
Sbjct: 1483 LKQE----IISIEKSKKQDEKVLKNQKNTLQKELEELKDQFTNSENEYIKKLDNFQNEIN 1538

Query: 2167 ----EKGHQHELLNKYINNTQT----------VIESSSNDVMSTIQNLLNEHLRANKEL- 2301
                EK     +LN  I   +           ++E S+ + +  ++ +     + NKEL 
Sbjct: 1539 SVRKEKLDIEAVLNSKIETLKADLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELD 1598

Query: 2302 IINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIK 2481
            I+ +  +  T  ++NE+  LK +++      + I       N  ++N+E  +    D++K
Sbjct: 1599 ILGNEKDTLTMNLNNEIKGLKEEIN---SKVDQIGNLKTELNTVSENME-DIQVRYDQLK 1654

Query: 2482 QTNDSXXXXXXXXXEHFKTN--DIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGY 2655
            +             E  K N   I+                            E      
Sbjct: 1655 EEKSEISDKLIESEEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVKISKQ 1714

Query: 2656 LVTNESMKKLNELDTSIRT---VLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKR 2826
             + N+  K L E     RT    LKD+  E D K                   +  DK+R
Sbjct: 1715 ELDNQKDKLLEEYSIMKRTNESKLKDLRNELDSK------------------IIKFDKER 1756

Query: 2827 SFLNNANDNEMQNQS-KIPRLE 2889
              LN  +DN  Q  S K+  LE
Sbjct: 1757 KLLNEGSDNIAQEYSEKVTSLE 1778

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 78/376 (20%), Positives = 163/376 (43%), Gaps = 14/376 (3%)
 Frame = +1

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA 1578
            L + T ++ K+  DL S  S+  I    +   E   +  + K+E+    +  ES   +N 
Sbjct: 2121 LSSKTIQIEKVNEDLSSKNSE--IEQLNKKLAEKCAEYDSIKSELVASSKLSES--EKND 2176

Query: 1579 LLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTK 1758
            +    K+  +E NEL+  +++  NE++KK+ + ++   +  ++ + ++++   T  ++  
Sbjct: 2177 M----KQLSDEINELKE-QLELKNENLKKVTSDLQIANNTSDKYNDELKVANNTIREIES 2231

Query: 1759 IIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEM 1938
             I  ++ +  L   ++   L        K L+ +++NF  +            +++  E+
Sbjct: 2232 KIPNLQKQLDLKEIEYNDTLSS-----KKDLDKKLDNFSKES-----------EILSKEV 2275

Query: 1939 TNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSE 2118
             +L     D         + K  +D  +  D+  +++++L    +N   +  +N S++  
Sbjct: 2276 KSLKKEKLD---------LEKEKNDLIVELDKYKNDIIDL----NNTLKENEKNGSEVET 2322

Query: 2119 EYNNFKQFITDEFY-------NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNE 2277
            E    K  I  EFY       N+EKG     +   +      ++SS ++++      L  
Sbjct: 2323 EIIGLKDKI--EFYKLNVSQLNEEKGKLESDIKTLVGERDDKLKSSQSEIIE-----LTN 2375

Query: 2278 HLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRS-DALNNE------FN 2436
             L + K++      +V  E    E D LK KLS+ E+S E  N + D+ N E       N
Sbjct: 2376 KLESFKDI------SVAYEESKVESDGLKNKLSEIEKSLEESNENVDSANKEISDLKVMN 2429

Query: 2437 DNVESSMTTMTDKIKQ 2484
            D ++S    + DK +Q
Sbjct: 2430 DKLQSHNLELEDKFQQ 2445

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 82/443 (18%), Positives = 191/443 (43%), Gaps = 46/443 (10%)
 Frame = +1

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIM-KDILLKNITTELTKIKSDLLST-KSKDGIYM 1476
            L+E C+ L+ + + K  K + +  +  +  D   K    ++T +K +++S  KSK     
Sbjct: 1440 LKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDKITSLKQEIISIEKSK----- 1494

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQ---TM 1647
             +Q  K L       + E++E K    +  S+N  + K     NE N +++ K+     +
Sbjct: 1495 -KQDEKVLKNQKNTLQKELEELKDQFTN--SENEYIKKLDNFQNEINSVRKEKLDIEAVL 1551

Query: 1648 NESMKKLYAKIERQQSIENELDG-------KIQIFTKTNSKLTKIIDEMKNREALVNSKF 1806
            N  ++ L A + + +     L+        K+++  K+  K  K +D + N +  +    
Sbjct: 1552 NSKIETLKADLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNEKDTLTMN- 1610

Query: 1807 KTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQ 1986
               L++ +  + +++N +++   +     N TV EN++ I+     L     +  +K  +
Sbjct: 1611 ---LNNEIKGLKEEINSKVDQIGNLKTELN-TVSENMEDIQVRYDQLKEEKSEISDKLIE 1666

Query: 1987 ECITKFLSDTPLLFDEINDNVLNLKALT---SNYYSQIAENLSDLS---EEYNNFKQFIT 2148
                + L +      ++N +V++L+A        Y+ + +   ++    +E +N K  + 
Sbjct: 1667 S--EEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVKISKQELDNQKDKLL 1724

Query: 2149 DEFYNQEKGHQHELLN----------------KYINN-TQTVIESSSNDVMSTIQNLLNE 2277
            +E+   ++ ++ +L +                K +N  +  + +  S  V S  + L N+
Sbjct: 1725 EEYSIMKRTNESKLKDLRNELDSKIIKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQ 1784

Query: 2278 HLRANKELI-----INSLSNVTTELMS------NELDRLKPKLSKWEESAELINRSDALN 2424
             + ++ ++      I S +N  TE  +       E+  L+  LSK++   E   ++  L 
Sbjct: 1785 KIYSDDKISELEENIKSKNNALTEKSNLLQKRLEEIKELESTLSKYKADLEATMKNSDLK 1844

Query: 2425 NEFNDNVESSMTTMTDKIKQTND 2493
            N+  +NV   ++   ++IK+  +
Sbjct: 1845 NDEFENVCKELSVKENEIKKIEE 1867

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 106/485 (21%), Positives = 201/485 (41%), Gaps = 84/485 (17%)
 Frame = +1

Query: 1282 ISPAKVTLEETCSTLEYASKAKN-------IKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            +S   V  E      E ++K+KN       IKN+         DIL  N   +  + +S 
Sbjct: 722  VSKGDVINELELKVEELSNKSKNSISDYESIKNE--------YDILKNNYEEKEGEFES- 772

Query: 1441 LLSTKSKDGIYMDQQHYKELTTD----LQNYKTEIQECKRTIESLTSQNALLLKDKRTIN 1608
               +K  D +  +++    +T++    L+  K+++++CK  IE L ++    LK+ +   
Sbjct: 773  --VSKKLDELLTEREKLNSVTSEQLKKLEQNKSDLEKCKLNIEKLENE----LKEVKERK 826

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI--QIFTKTNSKLTKIIDEMKNR 1782
            +N E     +  MN+ +  L  + E+ +  + +L+ KI  QI    +SK+ K   E+++ 
Sbjct: 827  DNAENG---VNKMNKELSNLSKEKEQLRIEQGKLEKKIQEQISVYEDSKI-KFNQELEST 882

Query: 1783 EALV-----NSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
            E  +     N + K     +L+     L  ++  +K +  + +  V +  + +KS   + 
Sbjct: 883  EKQITDLQSNLESKNTELDNLNKEKSGLMKELTEWKAKFKSHDALVPKLTEKLKSLANSY 942

Query: 1948 --LSTARDNFEKFYQE----------CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQI 2091
              L T RDN+     E           +++ +S+  +  D+I D    L    S   SQI
Sbjct: 943  KELQTERDNYSSQLIEINKNKTSELSSLSESISNLKIEKDKILDEKSKLINKVSELESQI 1002

Query: 2092 AENLSDLSEE-------YNNFKQFITD--------EFYNQEKGHQHELLNKYINNTQT-- 2220
             EN     EE        +  ++ + D        E   +      + LNK I N  T  
Sbjct: 1003 TENCKIFEEEKEKLILSKDELEELVIDLNEQLKELETQKETTSKNADELNKSIANLNTQL 1062

Query: 2221 ---------------VIESSSNDVMSTIQNLLNEHLRANKE-----LIINSLSNVTTELM 2340
                           V +++ ND  S + NL+ +    ++E     L +  L N  TE+ 
Sbjct: 1063 KQKDSKLIELEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIK 1122

Query: 2341 SN------ELDRLKPKLSKWEESAELINRSD-----ALNNEFN------DNVESSMTTMT 2469
            ++      E D L+ KL    +  EL+ +S      +L NE++      +N+E+S    +
Sbjct: 1123 NSHKSAQKETDTLQTKL----DETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSS 1178

Query: 2470 DKIKQ 2484
            +KI++
Sbjct: 1179 EKIEE 1183

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
            YKL079W
          Length = 681

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 87/366 (23%), Positives = 159/366 (43%), Gaps = 35/366 (9%)
 Frame = +1

Query: 982  SSRSHTI--FTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 1155
            S +SH      IT   E+K +  +   +  V+LA   +   S  ++Q   +  S   +LL
Sbjct: 260  SKKSHIFVRMKITQVNELK-DTLKEGIVQFVNLAS--DFKDSPGISQEESKKSSAGVALL 316

Query: 1156 TLGRVINSLA-DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
                V+  L+ D++    ++E+ LT+L+ + L  N KT+ +   S       +T   L++
Sbjct: 317  R--EVVADLSSDESKASRYKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQF 374

Query: 1333 ASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL--LSTKSKDGIYMDQQHYKELTT 1506
             ++ + I+                      T++  ++  L++K K  +Y+     KE   
Sbjct: 375  GAQLQQIR----------------------TQVSGNVFGLNSKRKMELYLSDMKLKE--- 409

Query: 1507 DLQNYKTEIQECKRTIES---LTSQNALLLKDKRTINENNELQRIKIQ------------ 1641
              +NYK  I+  +R +ES   L +  A    +K      + L +I+I+            
Sbjct: 410  --ENYKERIRFLQRQLESSKNLNNGTAGTTSNKPANPVMDRLMKIQIENFKLKEQVKLLH 467

Query: 1642 ----------TMNES--MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNRE 1785
                      T NE   M+ L  K E+  +++ E+D + +  TK N KL K+I+E     
Sbjct: 468  SLKKAKASGETFNEEKIMQTLLEKCEQLATLQIEVDDEGEAITKLNGKL-KLIEEK---- 522

Query: 1786 ALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMT---NLLST 1956
                       DHSL  ++ KL  Q+ NF++Q + +   V E+  ++ SE+    NL++T
Sbjct: 523  -----------DHSLEKMNAKLVEQM-NFQEQSLEK---VIEHNSVLVSELNHWKNLITT 567

Query: 1957 ARDNFE 1974
             +DN E
Sbjct: 568  QKDNIE 573

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 31/138 (22%), Positives = 62/138 (44%), Gaps = 8/138 (5%)
 Frame = +1

Query: 133 DIMGSKEVAINTSEDI----GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIK 300
           DI      A+  S  +        ++  ++++  KV    AT++  F E+A  +  D + 
Sbjct: 60  DIQRDSNEAVGNSNHVQTVNDTVVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLS 119

Query: 301 GYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS---AGIIPRILFKLFETLEK-LNEDH 468
           G NC +  YG      +  M G +   ++E  DS   +G++ +    +F  ++     ++
Sbjct: 120 GINCCVTTYGSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEY 179

Query: 469 IVKCSFVELYNEELKDLL 522
            V  S  E+Y +++ DLL
Sbjct: 180 QVSLSLCEVYVDKVFDLL 197

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 128/625 (20%), Positives = 249/625 (39%), Gaps = 63/625 (10%)
 Frame = +1

Query: 799  DSANKFSPADNDKSTIQSD--------QTAGIYIQNLQEFHITTAKEGIKLLQKGLK-YR 951
            D+  + S + ND S I  D          A   ++  ++ + T+ +E +K L+   +  +
Sbjct: 867  DTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLY-TSTEESLKTLESNFESVK 925

Query: 952  QVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEA 1131
             +   K++   S + T+      K   GE  +       DL   +N        + ++E 
Sbjct: 926  NLMDDKISKLLSENETL------KASTGEYDKRISELSTDLKNEKN--------KYSEEI 971

Query: 1132 GSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 1311
              +N  +  L +     AD       + SKL   L+          L A  +       E
Sbjct: 972  AQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLE----------LKAKFADNAQEKYE 1021

Query: 1312 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY 1491
            +  T + A+     + K Q+     + +++++   +L K K+ LLS    + ++  +Q  
Sbjct: 1022 SLLTKDNANLQSIEEFKEQIEKLNQRIVIIES---DLEK-KTSLLS--ENESLWKKKQ-- 1073

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLY 1671
                     + ++++E K+ I++LT+QN L +     +N+  +   +    ++   K ++
Sbjct: 1074 -------DAFISDLEESKKKIDNLTNQNKLYVDQLELLNK--DFSSMDSSQLSSETKHMF 1124

Query: 1672 AKIERQQSIENELDGKIQIFTKTN----SKLTKIIDEMKNREALVNSKFKTLLDHS---- 1827
             ++   + +   L+ K+ I  + +    SKL  + DE+ N +  + S    LL HS    
Sbjct: 1125 NRLRADRDV---LETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIE 1181

Query: 1828 --------LSYVS--KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK 1977
                    L+ ++  K+ N  + N   +   +N T+   L    S+++NL         K
Sbjct: 1182 NHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMEL-----K 1236

Query: 1978 FYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT--- 2148
              +E +    +D  L+ +E N   L  + L+        +++S LS E +  K       
Sbjct: 1237 SVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKR 1296

Query: 2149 ------DEFYNQEKGHQHELLN----------KYIN-----NTQTVIESSSNDVMST-IQ 2262
                  +E +N  K   HE LN          K IN     NT   +  SS    S  +Q
Sbjct: 1297 KQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQ 1356

Query: 2263 NLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEF--- 2433
            N L++    N+      LSN+ +EL + + +    KLS  +E  EL +  D+L       
Sbjct: 1357 NTLSD----NEVKYTQKLSNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEA 1412

Query: 2434 --------NDNVESSMTTMTDKIKQ 2484
                    +D+ +S+M  M + +K+
Sbjct: 1413 QSKLSAIGSDSTDSTMNAMIESMKK 1437

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 99/433 (22%), Positives = 170/433 (39%), Gaps = 27/433 (6%)
 Frame = +1

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 1392
            ++KLT     SLGG      +AT+   K  L +  +  E       IKN+         +
Sbjct: 87   DNKLT-----SLGGK-----LATVETEKKELIDKVNGYETQFNELKIKNEGL-------N 129

Query: 1393 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 1572
            + + N+  EL   K++       +    ++ +Y      L   ++EIQ  K+ +  L   
Sbjct: 130  LKVSNLNIELENWKNN------SNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFLNEN 183

Query: 1573 NALL----LKDKRTINE-------NNELQRIKIQTMNESMKKLYAKIERQQSIENELDGK 1719
             + L    LK+K   N+       N     IK++    ++K + AK+       N+L  K
Sbjct: 184  KSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKSMEAKVSVLSDKNNDLTKK 243

Query: 1720 IQ--IFTKTNSKLTKII--DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
             +  I+   N K   ++  D+M N+E  + SK   LL   LS   ++L   +E      +
Sbjct: 244  YENSIWEIKNLKDNLLVTKDDM-NKEIAMKSKLIDLLQGQLSSTQEELRQNVE------L 296

Query: 1888 NQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKAL 2067
            N  FT   +L+                      E +   + D  L  +E+ +   NL ++
Sbjct: 297  NSKFTKFPDLE-------------------SQNETLKSDIQDLTLKIEELQNENFNLNSM 337

Query: 2068 ---------TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQT 2220
                      SN  S I  NL  L  + N  K+ +T E    EK H    +  +I   + 
Sbjct: 338  INQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQE--KLEKKHLQTQIESFIIELEN 395

Query: 2221 VIESSSNDVMSTIQ--NLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEES- 2391
             I      ++S+ Q  N   E+   N  L++N  SN     + N+L+    KL  ++ + 
Sbjct: 396  KI-----PIISSFQEKNQALENELTNLTLLLNKTSN-EKNTIQNKLNNYDSKLLTYQSNI 449

Query: 2392 AELINRSDALNNE 2430
             ELI +   L N+
Sbjct: 450  KELIRQRLDLANQ 462

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 118/557 (21%), Positives = 224/557 (40%), Gaps = 46/557 (8%)
 Frame = +1

Query: 964  TKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKE----- 1128
            TK  D  S++ T+         K +I  L+    ++   +EN N +  +NQ + E     
Sbjct: 301  TKFPDLESQNETL---------KSDIQDLTLK--IEELQNENFNLNSMINQMSNEQNNSN 349

Query: 1129 -AGSINQSLLTLGRVINSLADKNVHVPFRESKL-TRLLQDSLGGNTKTALIATISPAKVT 1302
             + SI+ +L TL   IN L  +       +  L T++    +    K  +I++       
Sbjct: 350  NSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQA 409

Query: 1303 LEETCSTLE-YASKAKNIKNKPQ--LGSFIMKDILLKNITTELTKIKSDL---------- 1443
            LE   + L    +K  N KN  Q  L ++  K +  ++   EL + + DL          
Sbjct: 410  LENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLF 469

Query: 1444 LSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL 1623
            ++ K+  G  + ++   E    + N   ++   + T + + S+  +      T +   EL
Sbjct: 470  VAVKNDSGGPLTREEI-EFINKISNNSEDLNGSELTSQHVISERLV------TFSNIEEL 522

Query: 1624 QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
            Q   ++ +N S++ L   +E   +IEN    K +   KT +   + I  ++    ++ SK
Sbjct: 523  QAKNMELLN-SIRSLSENLE---NIENANSHK-EFQNKTIADAKEAILTLQYHNDILESK 577

Query: 1804 ----------FKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLS 1953
                      FK LL++++S  S   N  + +      N+     E LQ +  E+   L 
Sbjct: 578  VKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSI--EKLQTLIEELKAELK 635

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK--ALTSNYYSQIAENLSDLSEEYN 2127
              +D  E           + T  L  E + N L  +  +LT + +  +     +L++ + 
Sbjct: 636  KNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFE 695

Query: 2128 NFKQFITDEFYNQEKGHQHELLNKYIN--------NTQTVIESSSNDVMSTIQNLLNEHL 2283
            N +  I      +++    +++NKYI          TQ  I  S  D +   Q+ LN  L
Sbjct: 696  NLQNIII-----KQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSEL 750

Query: 2284 RANKE------LIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNV 2445
                E      ++++ L ++  E M+   D  K  +SK       I+  +  N +   N+
Sbjct: 751  IKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSK-------IHELENNNLDLIKNL 803

Query: 2446 ESSMTTMTDKIKQTNDS 2496
             S MT +  K+  +N+S
Sbjct: 804  GSKMTEI-QKLSISNES 819

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 61/245 (24%), Positives = 102/245 (41%), Gaps = 19/245 (7%)
 Frame = +1

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 1392
            +SKL+ +  DS    T + + A I   K   EE     E     ++  N+ +    + KD
Sbjct: 1413 QSKLSAIGSDS----TDSTMNAMIESMKKEFEE-----EKLKLLEDKTNELEAQWKLEKD 1463

Query: 1393 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQEC--KRTIESLT 1566
             LLK    ++     DL S ++   I +++          Q+ K E +E   K T+E + 
Sbjct: 1464 KLLKEYEEKI----EDLQSARTDQSIKIEE---------FQSLKKEWEEEYEKATLERIE 1510

Query: 1567 SQNALLLKDKRTINE---NNELQRIKIQTMNESMKKLYAKIERQQSIENELD----GKIQ 1725
                 L K  R  +E   N  +++ K +  NE   KL  K+   ++  N ++    GK++
Sbjct: 1511 EAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLR 1570

Query: 1726 IFTKTNSKLTKII------DEMKNR---EALVNSKFKT-LLDHSLSYVSKKLNYQIENFK 1875
               K   K   +I      +E K +   E    S  KT LL+  +S +  +L+  IEN K
Sbjct: 1571 EEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDK 1630

Query: 1876 DQGIN 1890
                N
Sbjct: 1631 QSDKN 1635

>TBLA0A04410 Chr1 complement(1085213..1087411) [2199 bp, 732 aa] {ON}
            Anc_7.21 YAL047C
          Length = 732

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 106/506 (20%), Positives = 210/506 (41%), Gaps = 43/506 (8%)
 Frame = +1

Query: 1060 NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD------KNVHVPFRESK 1221
            N ++L+  +++N S  LN         + +LL   +V+NS+        KN +     + 
Sbjct: 201  NFLNLSQIDDLNSSKDLN---------SDNLLIKIQVLNSILQTIFYHFKNNNNTNDHNS 251

Query: 1222 LTRLLQDSL---GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 1392
            +  +  D+L     NT   L   I+ +    + + ST   AS   N   K  L +  +  
Sbjct: 252  IEHMNNDALIHHHQNTNNNLDHAIAHSTDN-DVSSSTTAVASNDSN--QKKTLSNHGISS 308

Query: 1393 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQH-YKELTTDLQNYKTEIQECKRTIESLTS 1569
             ++ +  T   K+K  ++    +  I +D Q+  K+    L   + ++ + K  +     
Sbjct: 309  PIINDGMTNWKKLKDQVILNDEQSLIIIDLQNKLKKKDLRLIELQEQVMDLKSDLNEKDL 368

Query: 1570 QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK 1749
            Q   L +D   +  N   + +K+  +   +    ++    QS   + + KI       + 
Sbjct: 369  QLNQLQEDILKLKSNGNDKDVKLIELKSQLNDKDSRFIEIQSNLKDKESKINDLKNNLND 428

Query: 1750 LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFK---DQGINQ--NF----- 1899
                I+E+KN    +N+K K  LD  L  +S + + Q+EN+K   D  I +  NF     
Sbjct: 429  KKLTINELKNN---LNNKNKLFLD--LEKISTETSQQLENYKIKLDDSIKESNNFKLVIN 483

Query: 1900 -------TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNL 2058
                   +++E L L K  +   +S+ + + EK   + +   ++    L   ++DN +NL
Sbjct: 484  DKDREIQSLNEKLNLNKETLNESISSFQSSLEKGTLK-MRDLIAQNDRLKSNLDDNSINL 542

Query: 2059 KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH-------QHELL--NKYINN 2211
            K    N   +  + LS+  +  NN+ Q +  +  N  K +       +H LL  N+ I +
Sbjct: 543  KMRLQNTREE-RDRLSNQLKISNNYNQQLKLQLKNYNKNNFESELFKKHLLLHFNRCIKS 601

Query: 2212 TQTVIESSSND-------VMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPK 2370
              +V E SS D        +S +  + + + + N E I   + +  + L+    D   P 
Sbjct: 602  FISVFEKSSIDHALKKLHQISLMDKISDSNGQHNLEKIYYYIEDALSLLIKTFTDAASPT 661

Query: 2371 LSKWEESAELINRSDALNNEFNDNVE 2448
             S+ ++  +  + S +   E N+N +
Sbjct: 662  TSQQQQQQQTFS-SLSPTTEVNENYQ 686

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_5.414
            YDR356W
          Length = 1009

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 74/343 (21%), Positives = 145/343 (42%), Gaps = 5/343 (1%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
            +++ K L   +Q+ +  I   ++    LTS    L ++   +NE +   + +I  + + +
Sbjct: 495  EENKKTLEIQVQSMQQTIDNLEKASIQLTSDLKKLTREVHDLNEKDVDSQEQISRLQDKI 554

Query: 1660 KKLYAKIERQQSIEN-ELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 1836
            +KL +  + +  I N ELDGK +   +TN ++ ++ +++       N K  T  D +   
Sbjct: 555  EKLKSVHKEELKIVNEELDGKRKELIETNFQIKQLQNQL-----FENVKNSTTSDINEKV 609

Query: 1837 VSKKLNYQIENF--KDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLS 2010
            + +K + QIE+   K   +      D+N  L K ++  +  T     E  Y E + K   
Sbjct: 610  IKEKQD-QIEDLQRKLADLRDAIRTDQNKNLKKFDL-RIKET-----EMKYTEELGKLKE 662

Query: 2011 DTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHEL 2190
            D  LL +E        +A   N    I E+  ++  +++        +F +  K H    
Sbjct: 663  DVRLLKNE--------RAKLKNQLETIKESKVNMETQHDRELNEWISKFNSMSKEH---- 710

Query: 2191 LNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTEL--MSNELDRLK 2364
             N  IN      +S  N++M T+    N+ L A  E + N  S++  E+  +S   D  K
Sbjct: 711  -NNLINRQDNKRDSYRNEIMETLNE--NKRLLAQLEALQNQRSDMEIEITKLSKSRDAYK 767

Query: 2365 PKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
              L     + + I +  +     N N +    +M+D+ +   +
Sbjct: 768  DTLKNTLSNLDSITKEFSEYKRRNKNNDEKNESMSDRYQNMQE 810

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 100/524 (19%), Positives = 215/524 (41%), Gaps = 30/524 (5%)
 Frame = +1

Query: 1012 TLFKEVKGEIFRLSKMNL-VDLAGSENINRSGALNQRAKEAGSINQS----LLTLGRVIN 1176
            T   E+  EI  L + N  ++   S +      LN++ +++  I  S    +  L + I+
Sbjct: 1179 TSINELNSEIVELKETNQELEECVSRHEKTVTELNEKIEKSDPIISSYEAEIKDLKQKIS 1238

Query: 1177 SLADK--NVHVPFRE--SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 1344
            S  DK  +  + ++E   K+T L ++          I T    +   E+T    +    +
Sbjct: 1239 SSEDKITSQELKYKELQEKVTLLEKE----------IETFKTKREDFEKTILQSKELGVS 1288

Query: 1345 KNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYK 1524
             N KNK      +    L +    EL+K KS +   +            ++L+T+ ++ +
Sbjct: 1289 LNEKNKSLSEELVSVHKLQEKCQAELSKKKSKVEGLRGS---------IEKLSTEKESSE 1339

Query: 1525 TEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIEN 1704
             ++++  + IE   S    L  +K+ +N+N  +   KIQ +N+++    ++  R Q   +
Sbjct: 1340 KKVEQLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQKLNKNVADSTSEQVRLQEELS 1399

Query: 1705 ELDGKIQIFTKT---NSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFK 1875
            +L   I +  KT   N+ L K   E   +E       K +L   L   + KL  Q+   +
Sbjct: 1400 QLKETINVNEKTYEQNTALLKTEIEKFQKERTE----KDVLVTELRAKASKLEKQVSETE 1455

Query: 1876 DQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECI--TKFLSDTPLLFDEINDNV 2049
             + + +  T++E ++ +K E     S A +   KF    +       +  L  + +    
Sbjct: 1456 QENVQKVQTLNEQIKSLKEEKNKACSEAGNLQSKFETNNVEFESLRKEHDLACERLESIA 1515

Query: 2050 LNLKALTSNYYSQIAENL----------SDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
             +LK  ++   +   EN+          +DL E+    ++   +E   +   ++ E L  
Sbjct: 1516 NDLKIASAKADASNTENVAAQQRIDILKADLGEQDKKIRE---NEANIETLINEKEKLLL 1572

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL-----IINSLSNVTTELMSNELDRLK 2364
             +   +  +E S  +    +Q L  +     +E      ++N  S+  T+  S+++  L+
Sbjct: 1573 ELKRVKANMEKSGKEHKEEMQKLKTDLKVKTQEFEKERKMLNEGSSSITQKYSDKVTELE 1632

Query: 2365 PKLSKWEESAE-LINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
             KL K +   +  +   + +  +F+  +E+      D++K+  +
Sbjct: 1633 EKLEKSDNDIKSKLEIIEEMKTDFDKRLEAQQKLADDQVKEVEE 1676

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 69/348 (19%), Positives = 160/348 (45%), Gaps = 14/348 (4%)
 Frame = +1

Query: 1396 LLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE----SL 1563
            L KN  TE  +I   L   K+++ +   +    +L ++++  +  I++ K TI     ++
Sbjct: 1075 LEKNAQTEAAQISEKL--KKAEEDVAALENTKAKLFSEIKLQENAIEKSKETITGHEGTI 1132

Query: 1564 TSQNALLLKDKRTINENNELQRIK---IQTMNESMKKLYAKIERQQSIENELDGKIQIFT 1734
               N  +   + TI E N + +     IQ ++ S+      I++  +  NEL+ +I    
Sbjct: 1133 EQLNGRIADYEGTIEELNGIIKSHEETIQELSSSIDDREKNIQKLNTSINELNSEIVELK 1192

Query: 1735 KTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS--KKLNYQIENFKDQGINQNF--- 1899
            +TN +L + +   +     +N K +       SY +  K L  +I + +D+  +Q     
Sbjct: 1193 ETNQELEECVSRHEKTVTELNEKIEKSDPIISSYEAEIKDLKQKISSSEDKITSQELKYK 1252

Query: 1900 TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNY 2079
             + E + L++ E+     T R++FEK   +     +S        +++ ++++  L    
Sbjct: 1253 ELQEKVTLLEKEI-ETFKTKREDFEKTILQSKELGVSLNE-KNKSLSEELVSVHKLQEKC 1310

Query: 2080 YSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTI 2259
             +++++  S +     + ++  T++  +++K  Q   L K I    + I S +++  +  
Sbjct: 1311 QAELSKKKSKVEGLRGSIEKLSTEKESSEKKVEQ---LLKQIEEKDSNIISLTDEKQALN 1367

Query: 2260 QNLLNEHLRANKELIINSLSNVTTE--LMSNELDRLKPKLSKWEESAE 2397
            +NLL  + +  K  +  ++++ T+E   +  EL +LK  ++  E++ E
Sbjct: 1368 KNLLISNQKIQK--LNKNVADSTSEQVRLQEELSQLKETINVNEKTYE 1413

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 74/393 (18%), Positives = 166/393 (42%), Gaps = 25/393 (6%)
 Frame = +1

Query: 1294 KVTLEETCSTLEYASKAKN-----IKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKS 1458
            K + EET + +    K+KN     +++     S + KD+  K+   E T++  +  ++++
Sbjct: 1844 KSSEEETKTEISAMEKSKNQLELLLESFKAKVSGLEKDLSQKDSILEETRLALEKYTSEN 1903

Query: 1459 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
            +      + H K+L ++     +EI+E ++     ++Q  + L+        ++L  +K+
Sbjct: 1904 ESKQKDLEAHVKQLESEKDRLASEIEEERKLATEKSNQKIIELE--------SQLSTLKL 1955

Query: 1639 Q---TMNESMKKLYAKIERQQSIENELDG----KIQIFTKTNSKLTKIIDEMKNREALVN 1797
            Q    +NE   KL  KI +   + +ELD     K+++  K +S LT+  + +K      N
Sbjct: 1956 QYEKDVNEVQTKLETKISQ---LSDELDSITKEKMEVQNKLHS-LTEENESIKEASTTAN 2011

Query: 1798 SKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLI-------KSEMTNLLST 1956
            +K    L   + +  KK     +  +D+   +   + + ++ +       + E+T  L T
Sbjct: 2012 NKEIEKLHEEIKFSEKKAAESRKVLQDEYDAKVKKLADEIKALGKERREREGELTTKLKT 2071

Query: 1957 ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK 2136
            + D                   + DE++  +  L+A  S+  ++  E  S  +++     
Sbjct: 2072 SEDKLNS---------------VQDELSARIEALQAEKSDLAAK-QEKDSKAADDKQAAS 2115

Query: 2137 QFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDV------MSTIQNLLNEHLRANKE 2298
            + I  E   + K     LL K    ++ V + +  +V         + + LN+    ++ 
Sbjct: 2116 ESILKEEIEKLKKENRALLEKSKLESENVAKQACAEVEQLKKKNEELTSKLNDRTEIDEL 2175

Query: 2299 LIINSLSNVTTELMSNELDRLKPKLSKWEESAE 2397
            +++ +  + T      +L+ L  +LS  EE  +
Sbjct: 2176 MLLVTDLDETNTKYREKLEELGVELSSAEEDED 2208

>KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} similar to
            uniprot|P12753 Saccharomyces cerevisiae YNL250W RAD50
            Subunit of MRX complex with Mre11p and Xrs2p involved in
            processing double-strand DNA breaks in vegetative cells
            initiation of meiotic DSBs telomere maintenance and
            nonhomologous end joining
          Length = 1296

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 92/431 (21%), Positives = 175/431 (40%), Gaps = 48/431 (11%)
 Frame = +1

Query: 1345 KNIKNKPQLGS--FIMKDILLKNITTELTKIKSDLLSTKSK------DGIYMD------- 1479
            K IKN   + +  FI  +  L+ I  ++ +I+S++ S +S+      D + +D       
Sbjct: 578  KKIKNDSDIATKEFIQYENQLQGIEEQIYEIESNITSIESRLKESLPDEVEIDTYDEELR 637

Query: 1480 --QQHYKELTTDLQNYKTEIQE----------------CKRTIESLTSQNALLLKDKRTI 1605
              ++ Y+    +L+ +KT ++                 C+R    +TS + L+   K   
Sbjct: 638  DSEESYRIALENLKMHKTTLEFNLKALEVAKNEDCCYLCQRKFNDVTSSSKLIEDLKART 697

Query: 1606 NENNELQ----RIKIQTMNESMKKLYAKIERQQSIENEL----DGKIQIFTKTNSKLTKI 1761
            N+N ++       +++T    +K  Y  +   +  + EL    D   +I   T  K +  
Sbjct: 698  NKNFQIALETTAKEMETYLHDLKSCYDDVLSHRKYQRELSTMKDNYARIKRSTEEKRSNQ 757

Query: 1762 IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQL-IKSEM 1938
             ++    + L  SK  TL +     VSK L+ + E  K     +   V+E L + I  E 
Sbjct: 758  QEKFHTLQNL-ESKLATLTEKLQPNVSKVLDTEEELSKLTSDLRR--VEEELSIYISDEK 814

Query: 1939 TNLLSTARDNFEKFYQE--CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 2112
               + T     ++   E   + K +SD  +  ++ +    NL +L     S I    S L
Sbjct: 815  LETIETLHSKQKRVNNELRALRKDISDLQIQKEDKSKEYNNLLSLIREKNSNINNMESAL 874

Query: 2113 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMS--TIQNLLNEHLR 2286
             E  N  K+   +E   +    + E+L + +N+ +  I S+S  +         L    R
Sbjct: 875  QEYLNITKEVCENESIIESSEKESEILTEEVNDLKLEISSASGSLNEGKAKHRQLEVEAR 934

Query: 2287 ANKELIINSLSNVT--TELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMT 2460
              K+ I + ++NV    EL+ N      P+L + EE    I+ S         ++E S+ 
Sbjct: 935  ERKDKIESQVANVNELVELIQNFEINDAPRLIECEEKLTEISNSVESKTAEIKSIEDSIN 994

Query: 2461 TMTDKIKQTND 2493
                K+K +++
Sbjct: 995  NTVQKLKDSDN 1005

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 60/317 (18%), Positives = 135/317 (42%), Gaps = 7/317 (2%)
 Frame = +1

Query: 1417 ELTKIKSDLLSTKSKDGIYMDQQHYKELTT---DLQNYKTEIQECKRTIESLTSQNALLL 1587
            EL+K+ SDL   + +  IY+  +  + + T     +    E++  ++ I  L  Q     
Sbjct: 791  ELSKLTSDLRRVEEELSIYISDEKLETIETLHSKQKRVNNELRALRKDISDLQIQ----- 845

Query: 1588 KDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIID 1767
            K+ ++   NN L  I+    N ++  + + ++   +I  E+     I   +  +   + +
Sbjct: 846  KEDKSKEYNNLLSLIR--EKNSNINNMESALQEYLNITKEVCENESIIESSEKESEILTE 903

Query: 1768 EMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
            E+ + +  ++S   +L +    +  ++L  +    KD+  +Q   V+E ++LI++   N 
Sbjct: 904  EVNDLKLEISSASGSLNEGKAKH--RQLEVEARERKDKIESQVANVNELVELIQNFEIND 961

Query: 1948 LSTARDNFEKFYQ--ECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEE 2121
                 +  EK  +    +    ++   + D IN+ V  LK  + N +  I  N+  L  +
Sbjct: 962  APRLIECEEKLTEISNSVESKTAEIKSIEDSINNTVQKLKD-SDNEFKNIKLNIDLLGLK 1020

Query: 2122 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL 2301
                 Q I +   + +  H  +  NKY        +  S  + +  + L +E+     E+
Sbjct: 1021 CE--LQRIENAISSMDVTHAEQERNKY--------QEDSLRLRTAYEKLSSENAGKLGEI 1070

Query: 2302 --IINSLSNVTTELMSN 2346
              + N +SN+  +L ++
Sbjct: 1071 KQLQNQISNLKNQLQTD 1087

>KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {ON}
            Anc_5.296 YDR285W
          Length = 872

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 116/577 (20%), Positives = 231/577 (40%), Gaps = 34/577 (5%)
 Frame = +1

Query: 799  DSANKFSPADNDKSTIQ-SDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            DS+  F P  N  S ++  D  +  Y    QE  +   +    ++   L       T  +
Sbjct: 7    DSSLGFKPRSNIFSKLRVKDPISAKYQNGNQEISLMEDEGDSSMINDILFTTNKDDTSFS 66

Query: 976  DFSSRSHTIFTITLFKEVKGEIFRL----------SKMNLVDLAGSENINRSGALN-QRA 1122
            +F+S   +       K+ KG IF+L          S +   DL   E+   +        
Sbjct: 67   EFNSTEPS-------KDAKGNIFQLNTSTPKVSKKSTIKSSDLVDDEDFEITEVRTVPNC 119

Query: 1123 KEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1302
            K AGS            N +  K V  P  ++   R  + +   N  T+    +  A   
Sbjct: 120  KTAGSDGYE--------NQVEKKIVPKPVLDAPTRR--EPTAMSNIDTSSNDVLLEAFTN 169

Query: 1303 LEETCSTLEYA---SKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIY 1473
             +  C +L++     + +N K K  L S+       + I  ++T+    L S + K    
Sbjct: 170  TQRICVSLKHELQNQQTENTKLKSDLKSYQTDT---RKIQDKITEYNDILTSLRDKSKEL 226

Query: 1474 MDQQH-----YKELTTDLQNYKTEIQECKRTIESL-TSQNAL--LLKDK--RTINENNEL 1623
            M+Q+      ++EL    +N++++I+  +  IESL TS N+L  L KD   +   +N E+
Sbjct: 227  MEQKQNDKLKFQELRKTHENFESKIKSYREDIESLKTSLNSLKNLKKDTELQLAKKNQEI 286

Query: 1624 QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
            + ++ +  + S +    KI+    ++N  D K +  T  +   ++   +  +RE +   +
Sbjct: 287  EYLQRELDDCSGQLSEEKIKNDNLLQNISDNKKEFATLLDQHFSEY--KTYDREQIEELQ 344

Query: 1804 FKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDEN-LQLIKSEMTNLLSTARDNFEKF 1980
             +T+ ++  + +  KLN        +  N    + E  L+L+   +  L  T   N    
Sbjct: 345  -RTMAENLKNELQTKLNTLASRSSTEWKNIAIELQEKYLKLVLIPLNLLPKTNNTNIP-- 401

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
                +T +     LL + I +      A     + +    L++ S  + +  + I     
Sbjct: 402  ----VTAYFPTLHLLSESIKEGC----ATQRKAHEETLRKLTEYSVCFTDVHEDIL---- 449

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI--------INSL 2316
             ++K +   +L   +++T   +++ +N++ S I+N+ +  L    ELI        I+ L
Sbjct: 450  -KQKENMLGVLTSSLDSTNESVQNGNNNLSSRIENMTSAILGYKDELIHCKTYEKAISEL 508

Query: 2317 SNVTTELMSNELDRLKPKLSKWEESAELINRSDALNN 2427
             +    L   +++ +     K  +  ELI + +A NN
Sbjct: 509  ESQIAALQQQKMEHITALGMKEAQHEELIEKFEAQNN 545

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 133/636 (20%), Positives = 245/636 (38%), Gaps = 42/636 (6%)
 Frame = +1

Query: 1060 NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVP-----FRESKL 1224
            N +D A       +G+ +++  E   I      L   I +L DK + +      ++ S+L
Sbjct: 117  NNIDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSEL 176

Query: 1225 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMK--DIL 1398
             R  +  L  N +  L+         L +    LE     + + NK Q   F  K  D++
Sbjct: 177  NR--KSELERNAQEILL---------LRKNQEWLE-----QELTNKNQHFMFYRKKTDLM 220

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECK--RTIESLTSQ 1572
            + +  T + K+KSDL   KS   I    +   E T  LQN   E ++ K    +E     
Sbjct: 221  VHDAVTNVEKLKSDLKIEKSSKEIL--SKKLDETTEQLQNNLIENKDLKDVLAVEKQEFD 278

Query: 1573 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQ----QSIENEL---DGKIQIF 1731
              L +KDK      N+++ ++  T+ +  K   A  E      +S++ EL   + K+Q  
Sbjct: 279  KELSIKDKLIKLYENQIKSLE-STLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDM 337

Query: 1732 TKTNSKLTKIIDEMKNREAL-VNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVD 1908
             +   +L  I+D   N  +L    + +T  + S S  S +L     +F D  I+ +  + 
Sbjct: 338  EEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSNSSDELG----SFDDSSISLS-RMQ 392

Query: 1909 ENLQLIKSEMT---NLLSTARDNFEKFYQE------CITKFLSDTPLLFDEINDNVLNLK 2061
             +++++K ++          ++  E F  E       I  F   T +L  E+ D  L L+
Sbjct: 393  GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLE 452

Query: 2062 ALTSNYYSQIAENLSDLSEEYNNFKQFITDE------FYNQEKGHQHELLNKYINNTQTV 2223
              T    +++  N      E  + K+ I+D+         Q     H+L    IN +   
Sbjct: 453  HATKE--NELKTN------ELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINIS--- 501

Query: 2224 IESSSNDVMSTIQNLLNE-HLRANKELIIN---SLSNVTTELMSNELDRLKPKLSKWEES 2391
                   +++   +LLNE  ++  K L+ N   + +N + +++S  L + K      E++
Sbjct: 502  -------IINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKN 554

Query: 2392 AELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXXX 2571
             EL+     L  +  +N E   +T  + + + N+                          
Sbjct: 555  MELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNE-------------------------- 588

Query: 2572 XXXXXXXXXXXXXXXXXXRLHEFVKEGYLV---TNESMKKLNELDTSIRTVLKDI---DY 2733
                               +    KE  L     NE+++K  ++ T  R   K +   D 
Sbjct: 589  -------------------IFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDR 629

Query: 2734 EKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNN 2841
            E++ K +NS  K      YN T+  D + + + L N
Sbjct: 630  ERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTN 665

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 79/346 (22%), Positives = 144/346 (41%), Gaps = 8/346 (2%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
            Q+  K L  D+    TEI+     +E +  Q   L K+K  I++     + + Q+ +  +
Sbjct: 898  QKETKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEHISKELVEYKSRFQSHDNLV 957

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
             KL  K++   +   ++  +       N  L K ++E KN  ++  S  +  +D   S  
Sbjct: 958  AKLTEKLKSLANNYKDMQAE-------NESLIKAVEESKNESSIQLSNLQNKID---SMS 1007

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             +K N+QIE           ++++N++ +K  +++L        E+  +E I+K  S   
Sbjct: 1008 QEKENFQIE---------RGSIEKNIEQLKKTISDL--------EQTKEEIISKSDSSK- 1049

Query: 2020 LLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
               DE    +  LK       +   EN++ +SE         T E    E      L N+
Sbjct: 1050 ---DEYESQISLLKEKLETATTANDENVNKISELTK------TREELEAELAAYKNLKNE 1100

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI-----INSLSNVTTELMSNELDRLK 2364
                 +T  E +  +V    ++L  E ++  KE       +NSL     E +  E + L 
Sbjct: 1101 LETKLET-SEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSL-RANLESLEKEHEDLA 1158

Query: 2365 PKLSKWEESAELINRSDALNNE---FNDNVESSMTTMTDKIKQTND 2493
             +L K+EE  ++ N+    N E    ND + S+     + IK+ ND
Sbjct: 1159 AQLKKYEE--QIANKERQYNEEISQLNDEITSTQQE-NESIKKKND 1201

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 85/467 (18%), Positives = 193/467 (41%), Gaps = 43/467 (9%)
 Frame = +1

Query: 1225 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLK 1404
            +RL    L  +  T  +  I+    ++E+  ++ E+     +  N+ ++ S   + + L+
Sbjct: 918  SRLANQELLVSKLTTKLKDIAEKYKSIEQAKASKEHELAEVSESNQTKILSLQSEIVELR 977

Query: 1405 NITTELTKIKSDLLST--KSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA 1578
                 +   K ++L+   K K  +   ++   E   +++  K+E+    + IE L S + 
Sbjct: 978  QQYDSMKHDKDNMLTETKKLKKSLEDAERSRSEAAYEIKQLKSELDHSSKEIEQLNSSSE 1037

Query: 1579 LLLKDKRTINENNELQRIKIQTMNESMKKLYAKI-----------ERQQSIENELDGKIQ 1725
               K+           R +++++N+++ +   K+           E+ Q ++   D KI 
Sbjct: 1038 EKSKNLADAVNTFNKARNELESLNKTLAEANDKLRSRESTIESLEEKLQELKKSSDEKIA 1097

Query: 1726 IFTKTNSKLTKI--------IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQ 1881
               K+   L K         +++ K ++AL + + K L D   ++  + L  Q +  K  
Sbjct: 1098 SLEKSRKDLEKFQQKFRDLELEKSKTQDALTDLQ-KALQDEKNNH-QESLQLQKDKIKQL 1155

Query: 1882 GINQNFTVDENLQLIKSEMTNLLSTARD------NFEKFYQECITKFLSDTPLLFDEIND 2043
             + +  +  E+ + +KSE++ L  T  D         + Y++ +++    T  L DE + 
Sbjct: 1156 ALEKENSA-ESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQDESSL 1214

Query: 2044 NVLNLKAL------TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYI 2205
             +  + AL      T +   ++ E  +DL E++ N    I  +   QEK     +L    
Sbjct: 1215 RLQEVSALNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSK-VKQEKEKDSRIL---- 1269

Query: 2206 NNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPK----- 2370
                 V++       + + +++++   +N E  I  L  +  E  S EL+  K K     
Sbjct: 1270 -----VLDKEMKSAKTDLSDIVHKLEASNSE--IAKLQEIKAEFESQELEGKKQKEDFDA 1322

Query: 2371 -----LSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
                  +K +E +  + +   + NE + N+E   +    ++++  +S
Sbjct: 1323 EIKTLRAKLKEKSAEVEKERKMLNEGSSNLEQEYSRKISQLEEELES 1369

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 111/550 (20%), Positives = 222/550 (40%), Gaps = 46/550 (8%)
 Frame = +1

Query: 985  SRSHTIFTITLFKEVKGEIFRLSKM--NLVDLAGSENINRSGALNQRAKEAGSINQSLLT 1158
            SRS   + I   K++K E+   SK    L   +  ++ N + A+N   K    +     T
Sbjct: 1007 SRSEAAYEI---KQLKSELDHSSKEIEQLNSSSEEKSKNLADAVNTFNKARNELESLNKT 1063

Query: 1159 LGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE---ETCSTLE 1329
            L    + L  +   +   E KL  L + S         IA++  ++  LE   +    LE
Sbjct: 1064 LAEANDKLRSRESTIESLEEKLQELKKSS------DEKIASLEKSRKDLEKFQQKFRDLE 1117

Query: 1330 YA-SKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLL----STKSKDGIYMDQQHYK 1494
               SK ++     Q      K+   +++  +  KIK   L    S +S + +  +    +
Sbjct: 1118 LEKSKTQDALTDLQKALQDEKNNHQESLQLQKDKIKQLALEKENSAESTEALKSEVSKLR 1177

Query: 1495 ELTTDL--------QNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN 1650
            +   DL        ++Y+ ++ E K+   SL  +++L L++   +N   E  R + + + 
Sbjct: 1178 QTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQDESSLRLQEVSALNTELEETRSRAEKLE 1237

Query: 1651 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
            E    L    E+ ++I NE+  K++   + +S++  +  EMK+ +  + S     L+ S 
Sbjct: 1238 EQATDLK---EKHKNICNEIKSKVKQEKEKDSRILVLDKEMKSAKTDL-SDIVHKLEASN 1293

Query: 1831 SYVSK--KLNYQIENFKDQGINQNFTVDENLQLIKSEMTN----------LLSTARDNFE 1974
            S ++K  ++  + E+ + +G  Q    D  ++ +++++            +L+    N E
Sbjct: 1294 SEIAKLQEIKAEFESQELEGKKQKEDFDAEIKTLRAKLKEKSAEVEKERKMLNEGSSNLE 1353

Query: 1975 KFY-------QECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLS---EEY 2124
            + Y       +E +    S   L   E ++    L  L     S   E   +L    E  
Sbjct: 1354 QEYSRKISQLEEELESLESKHSLKHQESDNEKRKLSGLLKKSESSATEKNRELECVRESM 1413

Query: 2125 NNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 2304
               ++ + D      K  Q E L+         ++ + +D M     L N+ L   +E  
Sbjct: 1414 KKLRESLKD------KEQQSEQLSS--------LQKTQSDKMREELGLANQKLEEAREKG 1459

Query: 2305 INSLSNVTTELM--SNELDRLKPK----LSKWEESAELINRSDALNNEFNDNVESSMTTM 2466
                 N+   L   ++E+ +LK +    LSK +E   +IN S         + +   ++M
Sbjct: 1460 RKHKENLEVALSQKASEVKKLKDQALNYLSKLDEKEAIINESKVQLETAKRDSDELKSSM 1519

Query: 2467 TDKIKQTNDS 2496
              KIK++ ++
Sbjct: 1520 DSKIKKSQET 1529

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 95/514 (18%), Positives = 214/514 (41%), Gaps = 45/514 (8%)
 Frame = +1

Query: 1045 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKL 1224
            RL +++ ++    E  +R+  L ++A +    +++      + N +  K      ++S++
Sbjct: 1215 RLQEVSALNTELEETRSRAEKLEEQATDLKEKHKN------ICNEIKSKVKQEKEKDSRI 1268

Query: 1225 TRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK--AKNIKNKPQLGSFIMKDIL 1398
              L+ D    + KT L   +   + +  E     E  ++  ++ ++ K Q   F   D  
Sbjct: 1269 --LVLDKEMKSAKTDLSDIVHKLEASNSEIAKLQEIKAEFESQELEGKKQKEDF---DAE 1323

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDL-QNYKTEIQECKRTIESLTSQN 1575
            +K +  +L +  ++         +  +++   E +++L Q Y  +I + +  +ESL S++
Sbjct: 1324 IKTLRAKLKEKSAE---------VEKERKMLNEGSSNLEQEYSRKISQLEEELESLESKH 1374

Query: 1576 ALLLKDKRTINENNELQRI-------------KIQTMNESMKKLYAKIERQQSIENELDG 1716
            +L  K + + NE  +L  +             +++ + ESMKKL   ++ ++    +L  
Sbjct: 1375 SL--KHQESDNEKRKLSGLLKKSESSATEKNRELECVRESMKKLRESLKDKEQQSEQLSS 1432

Query: 1717 KIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY-------VSKKLNYQIENFK 1875
                  KT S      D+M+    L N K +   +    +       +S+K + +++  K
Sbjct: 1433 ----LQKTQS------DKMREELGLANQKLEEAREKGRKHKENLEVALSQKAS-EVKKLK 1481

Query: 1876 DQGINQNFTVDENLQLIKSEMTNLLSTARDNFE---------KFYQECITKFLSDTPLLF 2028
            DQ +N    +DE   +I      L +  RD+ E         K  QE ++K  ++   L 
Sbjct: 1482 DQALNYLSKLDEKEAIINESKVQLETAKRDSDELKSSMDSKIKKSQETLSKAENERDQLR 1541

Query: 2029 DEINDNVLNLKALTSNYYSQIA--ENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
             E++ +   L+      +   A    L DL     N    +++   ++     +E  +K 
Sbjct: 1542 LELDLSKEKLEVNNQRLHELDATEAQLKDLKMTIENNLHLLSN---SEAAKRNYEARSKS 1598

Query: 2203 INNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSN-ELDRLKPKLSK 2379
            +      + S+  +V S    + ++   +   L  ++     TEL  N E+ RL+ +++K
Sbjct: 1599 LAQECEKVSSTLKEVASQKDEVESKLRTSENALSTHAKKIAETELQQNTEVKRLEDEIAK 1658

Query: 2380 WEESAE----------LINRSDALNNEFNDNVES 2451
             ++ AE          L+   D  N ++ + +++
Sbjct: 1659 LKKQAEDRSEVDDLMLLVTELDEKNQKYRNKLKA 1692

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 95/421 (22%), Positives = 186/421 (44%), Gaps = 56/421 (13%)
 Frame = +1

Query: 1402 KNITTELTKIKSDLLSTKSKDG-IYMDQQHYKELTTDLQNYK-------TEIQECKRTIE 1557
            +N+ TE++ +K+D   T + +G I   +    +L  ++Q  K       TE++  K   +
Sbjct: 369  ENLKTEISTLKTD---TDNLNGHIQSIKNDNNKLENEIQLVKKENSKLETEVKTSKNETD 425

Query: 1558 SLTSQ-----NALLLKDKRTIN---------ENNELQRIKIQTMNESMKKLYAKIE---- 1683
             L+SQ     N L+ K+K  I          EN E  +  +  +    K+L  +I+    
Sbjct: 426  KLSSQLNQVKNKLIQKEKTVIYLEKQIKEYAENQEPVKQAMDLLKRENKQLSNRIDLLKN 485

Query: 1684 RQQSIENEL---DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH--SLSYVSKK 1848
              +S+ N+L       + + K N KLT+ ID ++ +   + +      DH  S+    ++
Sbjct: 486  ENESLNNDLKKNSSTYEDYLKENGKLTERIDILQEKYDTLQNLKNNSSDHMDSIKKQCEE 545

Query: 1849 LNYQIENFKDQGINQNFTVDENLQLIKSE------MTNLLSTARDNFEKFYQECITKFLS 2010
            LN ++     + I+    + +   +I+ +      M  LLS + ++ +    E  TK  S
Sbjct: 546  LNVKLREANKKIISLEDELSDYTSIIQDKAREADTMRRLLSESNNDEKNKLDEMETKLNS 605

Query: 2011 DTPLLFDEIND--NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQH 2184
                + DE N+  + LNL++  +    Q  ++L+D S+  N  K     +    +   + 
Sbjct: 606  ----MIDENNNLKSELNLQSSRNKIELQNLQSLNDQSQ--NEIKSL---QLNKLQLLSEI 656

Query: 2185 ELLNKYINNTQTVIESSSND---VMSTIQNLLNEHLRANKELIINSLSNVTTELMS--NE 2349
            E LNK   N +   ++  ND   +  TI NL +   R+  +  I  L +   ELMS  N+
Sbjct: 657  ETLNKLNENFKKHKDNDFNDSHNLQKTINNLKDSLSRSESK--ITELQSANDELMSLNND 714

Query: 2350 LDRLKPKLSKWEESAEL-----------INRSDALNNEFNDNVESSMTTMTD-KIKQTND 2493
            +++   ++SK  +S  L           +  S   +++ +D+ ++S  + T+ K+  T+ 
Sbjct: 715  INKKFDRISKNYKSLSLQFNTLKGNVSKLKASPITSSDSSDSFKASSNSATNLKLSDTSQ 774

Query: 2494 S 2496
            S
Sbjct: 775  S 775

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
            YDR356W
          Length = 989

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 83/404 (20%), Positives = 157/404 (38%), Gaps = 33/404 (8%)
 Frame = +1

Query: 1384 MKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESL 1563
            MK   ++N+  EL  +K   L+TK K+ +   +     ++++ + YK + +     ++  
Sbjct: 345  MKLSEIENLELELNDLKD--LNTKLKESLNDKENELTNVSSEYEKYKLDAEAHMGIMKDS 402

Query: 1564 TSQ--NALLLKDKRTINENNELQRIKI--QTMNESMKKLYAKIERQQSIENELDGKIQIF 1731
              +  N ++   K+ I  N++L ++    + +N+ +  L   IE+   +E +   K+Q  
Sbjct: 403  DDKLKNQVIEIRKKNIELNSKLLQMNEVNENLNDELMSLKDIIEK---LEQDKKAKLQEL 459

Query: 1732 TKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDE 1911
                S     I+++K     +  K K  LD          N +I   + Q ++   T   
Sbjct: 460  KSLKSSDISQIEDLKQNNLTLERKLKENLDEK--------NVEINKLRRQHVDMQKTNSA 511

Query: 1912 NLQLIKSEMTNLLSTARD---NFEKFYQECITKFLSDTPLLFDEINDNVLNL-KALTSNY 2079
             +  +  E  +L     D   + E   +  IT   ++  LL  E N  +  L K L  N 
Sbjct: 512  LVDKLTKESQSLRKEYEDKINDLENQLKSNITDLSTNKDLLAVEYNSKMDKLNKELEENK 571

Query: 2080 YS-------------QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQT 2220
            ++             Q+ EN+++ S++     +    E  +        L NKY   T+T
Sbjct: 572  HALKTSEEIIKDLKNQLIENVTNSSQKLAKLTEAKNSEIESL-LSQMESLRNKYRKKTET 630

Query: 2221 VIESSSNDVMSTIQNLLNEHLRANKE--------LIINSLSNVTTELMSNELDRLKPKLS 2376
            +I     +  S I+ L  E L   +E        L  NS  N          D L  K++
Sbjct: 631  LINEQEEERQSYIRKLREEKLSTEREKDNYDKLLLQFNSEKNAIINSKKELEDNLNNKIN 690

Query: 2377 KWEESAELINRSD----ALNNEFNDNVESSMTTMTDKIKQTNDS 2496
              E+  +  + +D     L +E     E  +  +  K+K   DS
Sbjct: 691  SLEKLLQQTSSTDVELETLKSELRGK-ELEIKELYKKVKSVTDS 733

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 108/541 (19%), Positives = 211/541 (39%), Gaps = 21/541 (3%)
 Frame = +1

Query: 1327 EYASKAKNIKNKP-QLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELT 1503
            E AS +  +K +  Q+ S I ++  LK   T L K  + +++               EL 
Sbjct: 111  ENASTSNPLKEQQEQIQSLIKENYNLKAKVTSLLKYLNTVMNKGELQKTLPLLDEINELK 170

Query: 1504 TDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI-----NENNELQRIK-IQTMNESMKK 1665
                    +IQE K   + L +QN +L++  R +     ++N      K I  +N   +K
Sbjct: 171  VLSGKKDRKIQEIKIKCDDLVTQNNILIRKSRELEALVASKNESATNSKEIDIINGKNQK 230

Query: 1666 LYAKIE-----RQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
            +  ++E      ++ + NEL+  I        +  K    +  ++ L+N+K    L  SL
Sbjct: 231  IIEELETKLSNAKEDVANELNMTISELNDLKIRYNKFEKTIMEKDKLINAKDD--LISSL 288

Query: 1831 SYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTAR--DNFEKF--YQECIT 1998
                +++  ++EN +D    +    +E ++  K +   +L      DN E+F   Q+ + 
Sbjct: 289  EGNLEEITTEVENLQDLLRKK----EEVIKEYKDKCNTMLEKNHDDDNNEQFMLVQDELN 344

Query: 1999 KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 2178
              LS+   L  E+ND + +L        +     L+++S EY  +K    +      K  
Sbjct: 345  MKLSEIENLELELND-LKDLNTKLKESLNDKENELTNVSSEYEKYK-LDAEAHMGIMKDS 402

Query: 2179 QHELLNKYINNTQTVIESSSNDV-MSTIQNLLNEHLRANKELIINSLSNVTTELMSNELD 2355
              +L N+ I   +  IE +S  + M+ +   LN+ L + K++I     +   +L   EL 
Sbjct: 403  DDKLKNQVIEIRKKNIELNSKLLQMNEVNENLNDELMSLKDIIEKLEQDKKAKL--QELK 460

Query: 2356 RLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFK 2535
             LK   S   +  +L   +  L  +  +N++     +    +Q  D             K
Sbjct: 461  SLKS--SDISQIEDLKQNNLTLERKLKENLDEKNVEINKLRRQHVDMQ-----------K 507

Query: 2536 TNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRTV 2715
            TN                             + +  KE   +  E   K+N+L+  +++ 
Sbjct: 508  TNSAL--------------------------VDKLTKESQSLRKEYEDKINDLENQLKSN 541

Query: 2716 LKDIDYEKDI--KETNSPLKPSHK--HDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIPR 2883
            + D+   KD+   E NS +   +K   +  H +    +  +   N   +N   +  K+ +
Sbjct: 542  ITDLSTNKDLLAVEYNSKMDKLNKELEENKHALKTSEEIIKDLKNQLIENVTNSSQKLAK 601

Query: 2884 L 2886
            L
Sbjct: 602  L 602

>Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {ON}
            complement(71225..74242) [3018 nt, 1006 aa]
          Length = 1005

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 78/381 (20%), Positives = 165/381 (43%), Gaps = 21/381 (5%)
 Frame = +1

Query: 1417 ELTKIKSDLLS-TKSKDGIYMD-QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLK 1590
            E+  +K DL+  T  K+ +  + +   KEL   + +    + E K+++++  +Q   L +
Sbjct: 501  EIEILKKDLMKLTSEKEKLQAEFESKQKELNISIDSLTKNVSELKKSLDAAETQKNKLQQ 560

Query: 1591 D--------KRTINENNEL--QRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFT-K 1737
            D         +  N+NN L  Q  ++  + +S   L   + +++     L+ +++ +  +
Sbjct: 561  DVLKSNESLSKLKNDNNSLSSQVRELTLLKKSEANLKTNVNQKEKTIAYLEDQVKKYNEQ 620

Query: 1738 TNSKLTKIIDEMKNREALVNS-KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDEN 1914
            +NS  T +    K  E L N        ++ L   + K N   E++    I +N  + E 
Sbjct: 621  SNSNKTSLDIMQKETEQLKNKIDLMKKQNNELQISATKNNDSFESY----IKENGKLSER 676

Query: 1915 LQLIKSE---MTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYS 2085
            L +++ +   + +L S + D  E   ++C      +  +   E N  +L+L+   S Y +
Sbjct: 677  LSVLQEKYDTLQSLKSNSNDQVESIQRQC-----EELTVKLKEANKRILSLEDELSEYAN 731

Query: 2086 QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK--YINNTQTVIESSSNDVMSTI 2259
             I E     + E +  ++ I+D   N +     EL +K  Y+N+ +  +ES      S  
Sbjct: 732  AIQEK----TREASTMRRLISDS-QNDDTTKLKELRDKVSYLNDEKGKLESEIALQASRN 786

Query: 2260 QNLLNEHLRANKELI--INSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEF 2433
               + +  RAN EL   I++L     +L+ +E++ L    +K +      +       + 
Sbjct: 787  NRDVQDLKRANAELSSEIHTLKLRERQLI-DEVETLNSMNAKMKRKTSQDDDDTGELEKL 845

Query: 2434 NDNVESSMTTMTDKIKQTNDS 2496
            N N++ ++     KI+   +S
Sbjct: 846  NSNLKEALANSDKKIRDLIES 866

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 126/608 (20%), Positives = 236/608 (38%), Gaps = 79/608 (12%)
 Frame = +1

Query: 1270 LIATISPAKVTLE---ETCSTLEYASKAKNIKNKPQLGSFIM----KDILLKNITTELTK 1428
            L+A     KV +E   E    L   +   ++ +   L SF      K  +L +    LT 
Sbjct: 59   LLAAYKNEKVKIEKFSEIEKVLMENTPVSDVDDIDSLSSFFTNMNEKTSMLNDEIKRLTS 118

Query: 1429 IKSDLLSTKSKDGIYMDQQHYKELTT------DLQNYKTEIQECKRTIES----LTSQNA 1578
            + S+L + K ++      +   E+TT        +NYK +IQE   +I S    + + N 
Sbjct: 119  LNSELKTKKQEES-----EDKSEITTIDDFKEKEENYKKKIQELTESINSGFSEVNNDNG 173

Query: 1579 LLLKDKRTIN-----------------ENNELQRIKIQTMNESMKKLYAK-IERQQSIE- 1701
            L  K K+ I+                 ++NE  + +I+   E   +L  K IE +Q +E 
Sbjct: 174  LKEKHKKDIDHLTNKIKELEGNLSVHIKDNETLKSEIKDKTEKFIELETKSIEDKQKVEL 233

Query: 1702 -----NELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSK-----KL 1851
                  + +GK+    + N+++   +D +K  E   N+K K +L+       K     KL
Sbjct: 234  LEKELTKSEGKVN---ELNAEVKNQLDLIKMLEEKSNTKDKLILELESEVKDKTDDVLKL 290

Query: 1852 NYQIEN-------------FKDQGINQ---NFTVDENLQLIKSEMTNLLSTARDNFE--- 1974
               IE               K + IN+   +   + N+  +  E TN  +   +N +   
Sbjct: 291  KATIEGKDERLSSLEEEMTAKSEKINKLEHDLEKNSNIGKLVEETTNETNIPTNNVQSTG 350

Query: 1975 --KFYQECITKFLSDTPLLFDEINDNVLNL------KALTSNYYSQIAENLSDLSEEYNN 2130
              K   +   K +S+     +  ND+ L +        L +N     +E  +DL +EYN 
Sbjct: 351  GGKKKNKKNKKKISNNNNAANS-NDDSLQIISPSVESGLDANSSKFTSEKYNDLLKEYNE 409

Query: 2131 FKQFITD------EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 2292
            FK+  T+      E+  +++ ++ E  N   +      E  S     ++ N   +     
Sbjct: 410  FKEKHTECDKLKFEYETEKEKYETETTNNIKDLEVVKKELDSAKEALSVSNSSLKQKSTE 469

Query: 2293 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 2472
             E + + L +V  EL+  + D+LK   SK  E  E++ + D +  +     E        
Sbjct: 470  LEEVKDMLRDVGNELVEAK-DQLKQAGSKQGEEIEIL-KKDLM--KLTSEKEKLQAEFES 525

Query: 2473 KIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEG 2652
            K K+ N S         E  K+ D A                              +++ 
Sbjct: 526  KQKELNISIDSLTKNVSELKKSLDAAETQKNK------------------------LQQD 561

Query: 2653 YLVTNESMKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSF 2832
             L +NES+ KL   + S+ + ++++     +K++ + LK ++ +    TI    D+ + +
Sbjct: 562  VLKSNESLSKLKNDNNSLSSQVRELTL---LKKSEANLK-TNVNQKEKTIAYLEDQVKKY 617

Query: 2833 LNNANDNE 2856
               +N N+
Sbjct: 618  NEQSNSNK 625

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 74/310 (23%), Positives = 136/310 (43%), Gaps = 24/310 (7%)
 Frame = +1

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDI-LLKNITTELTKIKSDLLSTKSKDGIYM 1476
            T+    S L   +K K       LG  I K+   +KNI  E TK+  +++  K K  + +
Sbjct: 651  TIYYKASVLTPENKKKIEDEIAGLGRDIQKEKDEIKNIENENTKLNDEIVVIKRK--LAL 708

Query: 1477 DQQHYKELTTDLQNY---KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK---- 1635
             Q+  K+L +  + Y   + EI   +  ++ L  Q  + + DK    E+  LQ +K    
Sbjct: 709  IQEELKKLNSQREKYFRVENEINSMENKLKDLEKQTQVDVSDKIREIESKLLQSVKEESN 768

Query: 1636 -IQTMNESMKKLY--------AKIERQQ--SIENELDGKIQIFTKTNSKLTKIIDEMKNR 1782
             I  MNE MKK+Y        + +E  +  +IE  +   I +F+    +L  ++  +KN 
Sbjct: 769  LIFRMNEKMKKVYRCQKDVLHSDVEYLEALNIEKSIGDIINLFSNKEKELEDVVASLKNE 828

Query: 1783 EALVNS--KFKTLLDHSLSYVSKK---LNYQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
                N+   ++   + + SY  ++   +   IE  KD+    N TVD     I  E++ L
Sbjct: 829  LRTKNNTEDYERWKEETRSYTEERKKIIEKYIEKCKDK---DNLTVD----FIDREISRL 881

Query: 1948 LSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYN 2127
             ST ++  E   ++     L +       I D + +L+    +  SQIA    +   + +
Sbjct: 882  ESTLKNTNE---EKTSALLLENNNKELKVIEDGMPDLEGKLKSTKSQIAVLRDNTEPKID 938

Query: 2128 NFKQFITDEF 2157
            N  + I++++
Sbjct: 939  NLIKGISNKY 948

 Score = 36.2 bits (82), Expect = 0.56
 Identities = 58/311 (18%), Positives = 140/311 (45%), Gaps = 14/311 (4%)
 Frame = +1

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
            ++ K++  ++     +IQ+ K  I+++ ++N  L       N+   + + K+  + E +K
Sbjct: 662  ENKKKIEDEIAGLGRDIQKEKDEIKNIENENTKL-------NDEIVVIKRKLALIQEELK 714

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
            KL ++ E+   +ENE+          NS   K+ D  K  +  V+ K +         + 
Sbjct: 715  KLNSQREKYFRVENEI----------NSMENKLKDLEKQTQVDVSDKIRE--------IE 756

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
             KL   +++ K++  N  F ++E ++ +     ++L +  +  E      I K + D   
Sbjct: 757  SKL---LQSVKEES-NLIFRMNEKMKKVYRCQKDVLHSDVEYLEALN---IEKSIGDIIN 809

Query: 2023 LFD----EINDNVLNLK-ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQH- 2184
            LF     E+ D V +LK  L +   ++  E   + +  Y   ++ I +++  + K   + 
Sbjct: 810  LFSNKEKELEDVVASLKNELRTKNNTEDYERWKEETRSYTEERKKIIEKYIEKCKDKDNL 869

Query: 2185 --ELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNE--- 2349
              + +++ I+  ++ +++++ +  S    LL E+     ++I + + ++  +L S +   
Sbjct: 870  TVDFIDREISRLESTLKNTNEEKTSA---LLLENNNKELKVIEDGMPDLEGKLKSTKSQI 926

Query: 2350 ---LDRLKPKL 2373
                D  +PK+
Sbjct: 927  AVLRDNTEPKI 937

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 46/206 (22%), Positives = 88/206 (42%), Gaps = 17/206 (8%)
 Frame = +1

Query: 1354 KNKPQLGSFIMKDILLKNITTELT---KIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYK 1524
            KNK ++     +   LK++  E     KIKSDL   K     +   +H + L    ++ K
Sbjct: 240  KNKSRIEELKKEGERLKHLVDEYNTYVKIKSDLKLCKDARPYFYINEHKESL----RSLK 295

Query: 1525 TEIQECKRTIESLTSQNALLLKDKRTINEN--NELQRIKIQTMN-----ESMKKLYAKIE 1683
             +  E K  + S    N  ++  + ++ +   +  +R + +T N      ++K L  +I 
Sbjct: 296  QQFLESKDRLRSFRKDNKPIIAAETSLKQKVISAKERKRQETSNLLAAKAAVKDLVQEIN 355

Query: 1684 RQQSIENELDGKIQIFTKTNSKL-------TKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
              +       GKI+ + + N KL       TK +++ K   AL+N   K           
Sbjct: 356  TAKESMISSKGKIKYYKERNIKLKVQIDETTKDLEDKKQAIALMNVPKK----------- 404

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQ 1920
            +K N ++E+ K++ I + F +   L+
Sbjct: 405  EKFN-EMESEKNKLITEEFDLKSKLK 429

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
            YKL079W
          Length = 667

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 77/380 (20%), Positives = 155/380 (40%), Gaps = 59/380 (15%)
 Frame = +1

Query: 847  QSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDF--SSRSHTIFTITLF 1020
            ++ Q    Y ++L    +T+  E I  +      R   S    ++   S+SH I  I + 
Sbjct: 171  ETKQDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVE 230

Query: 1021 -KEVKGEIFRLSKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINSLAD- 1188
             + +  ++ +   ++  DLA  + I++    +L   + E   +N    TL   I S+++ 
Sbjct: 231  QRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSEL 290

Query: 1189 ---KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK- 1356
                N  +P++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I  
Sbjct: 291  SENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISS 350

Query: 1357 ----NKPQLGSFIMKDILLKN--------------ITTELTKIKSDLLSTKSKDGIYMDQ 1482
                NK  L S    D+++++              + TEL  +++      S+   + ++
Sbjct: 351  NVHMNKHALNSKKKLDLIVEDMKSKEANYMNRIRLLETELNDLRASYGEAISETSSFKEE 410

Query: 1483 QHYK-----ELTTDLQNYKTEIQ----------------ECKRTIESLTSQNALLLKDKR 1599
             + +     +L  +L+ +K  +Q                + +  ++ L  ++A + + K 
Sbjct: 411  MNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSKEMPLTDDEEIMQQLIEKSASVAELKA 470

Query: 1600 TIN-------ENNELQRI---KIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK 1749
            T++       + NE+ +    K+QT+ +    L  +IE+Q+    +L     +       
Sbjct: 471  TLDIEKHKSFKLNEVLKNYVEKLQTLKKMNDNLVTRIEKQEDSIQDLLSSNTVMKSQIKN 530

Query: 1750 LTKIIDEMKNREALVNSKFK 1809
                 D    R  L+ SK +
Sbjct: 531  WNNTADSRTERIKLLESKLR 550

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 22/94 (23%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
 Frame = +1

Query: 256 IFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKL 435
           +++ I   L ++  +GY+  ++ YG   TGK+    G +  Y        G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTY------EGGVVLMFVQDL 128

Query: 436 FETLEKLNED--HIVKCSFVELYNEELKDLLHGD 531
           ++ ++ +  D    V  S +E++ E++ DLL  D
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLLVND 162

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 91/395 (23%), Positives = 166/395 (42%), Gaps = 17/395 (4%)
 Frame = +1

Query: 1333 ASKAKNIKN-KPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 1509
            A+  KNI++ +  L   +M+      +  +  + + + LST+ +D   +++       T+
Sbjct: 950  ANSFKNIQSERDTLQKHLMEITDNNKLDVQNLESQIEALSTE-RDNAILERNDLLNTITN 1008

Query: 1510 LQNYKTEIQECKRT-IESLTSQNALLLKDKRT----INENNE----LQRIKIQTMNESMK 1662
            L++  T+I    R  I  LTS+   L +   T    +NE NE    LQ+   +   E  K
Sbjct: 1009 LESATTQIHNNYREEIARLTSKTDDLQRTVNTQEKQLNEKNEDLIALQKSS-EEQKEDAK 1067

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
            KL  K    +S +NE++   ++F   + KL +  DE+        SK K  L+ +L   S
Sbjct: 1068 KLELKFADVRSSKNEIN---KLFEDVSGKLKEAHDEISGL-----SKRKEGLEKALEEYS 1119

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            KK         D+  N   T ++NLQ  K ++   L+ A++ FEK +    ++       
Sbjct: 1120 KKTT-----ILDEEANSLKTKNDNLQNAKEDLETKLNEAKERFEKEFSSTQSEIEDLKGN 1174

Query: 2023 LFDEIND--NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 2196
            L  ++ D       K    N  +     +S+L ++    +  I   +  +EK        
Sbjct: 1175 LQTKVKDIQRANERKEELENKLTLAQSKISELKKDLEMKETHIQKMYETKEK-------- 1226

Query: 2197 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANK--ELIINSLSNVTTELMSNE--LDRLK 2364
                  Q  + SS ++V    +NL  +  +  K  E   +  S + T +  ++  +D LK
Sbjct: 1227 -----CQNALNSSQSEVEELKKNLETKETKIQKATEACESLRSELETSVQESKRGMDELK 1281

Query: 2365 PKLSKWEE-SAELINRSDALNNEFNDNVESSMTTM 2466
             K+S  E    E    S+ +  E  D  E ++ T+
Sbjct: 1282 EKISALETLKREAEKDSETMKKELEDK-EKNLATL 1315

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 64/345 (18%), Positives = 134/345 (38%), Gaps = 24/345 (6%)
 Frame = +1

Query: 1483 QHYKELTTDLQNYKTEIQEC----KRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN 1650
            + ++EL     N K E+ +     K   + L ++   L  + ++++ N E  +   + + 
Sbjct: 712  EEFEELQGRCANLKKELVQLELDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLE 771

Query: 1651 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
               KK+   +E   +   E+    +  T  N K+T+     K +     SK  TL     
Sbjct: 772  GKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYESKINTLESKLR 831

Query: 1831 SYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLS 2010
               SKK   Q E   ++   + F +++N + I+S    +        E    E   K L 
Sbjct: 832  DITSKK--EQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKELENMKNE--NKKLD 887

Query: 2011 DTPL-------LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT------- 2148
            +T           DE    +  +++L      Q A  L++   ++    + +T       
Sbjct: 888  NTLAKKEKELQSLDEELQKLRKMQSLLETDKDQSARELTEWKSKFQGHDELVTRLTDKLK 947

Query: 2149 ---DEFYN--QEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL-IIN 2310
               + F N   E+    + L +  +N +  +++  + + +      N  L  N  L  I 
Sbjct: 948  SLANSFKNIQSERDTLQKHLMEITDNNKLDVQNLESQIEALSTERDNAILERNDLLNTIT 1007

Query: 2311 SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNV 2445
            +L + TT++ +N  + +    SK ++    +N  +   NE N+++
Sbjct: 1008 NLESATTQIHNNYREEIARLTSKTDDLQRTVNTQEKQLNEKNEDL 1052

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
            YOR216C
          Length = 471

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 87/416 (20%), Positives = 180/416 (43%), Gaps = 20/416 (4%)
 Frame = +1

Query: 1306 EETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ- 1482
            EE  STLE        ++  QL    MKD       TE+ K++++  + +S+    + + 
Sbjct: 77   EENTSTLEKEIARLKEEHAEQLR---MKD-------TEMEKLRTERDAKESQYNTLLSRI 126

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN---E 1653
               K++  +L++ K E++  +  ++   SQN  L     + ++ NE  R  + T+N   +
Sbjct: 127  SSMKDVFQNLRDSKQELENVQEQLQEYESQNLRLKNKVSSTSKENEELRTTVTTLNKEYD 186

Query: 1654 SMKKLYAKIERQ-QSIENELDG---KIQIFTKTNS-KLTKIIDEMKNREALVNSKFKTLL 1818
            SM+  Y  +++Q  S E +++    K++  T+++S +L   I E++N   L   K    L
Sbjct: 187  SMESEYENLQKQVTSYERQIEKCEIKLEHATESHSDELNAYIKEIENL-TLKIQKLTVAL 245

Query: 1819 DHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 1998
            ++S   +S      +++ + +  +   T +  L  +K  + +L +T     E   ++C  
Sbjct: 246  ENSHQSIS-----DLKSERQELAHDLATSESTLSNLKQTIADLEATLNTKEESLREDC-- 298

Query: 1999 KFLSDTPLLFDEIN---DNVLNLKALTSNYYSQIAENLSDLSEEY---NNFKQFITDEFY 2160
                D  L    I    D  L  K       S +   +S + EE      F++ + D+  
Sbjct: 299  ---KDRDLQIKAIRAQLDTALEEKTAQGEQISSLKSQISAMEEEVFLKEKFEKEVKDKTL 355

Query: 2161 NQEK-GHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTEL 2337
               K  H+  +LN ++     +++ SS   M      +++ L +N  L+I+ +S    + 
Sbjct: 356  QIGKLRHEAIILNDHLRKAMGMLKQSSESEM------VDKELISN--LLISFVSIPRADP 407

Query: 2338 MSNELDRLKPKLSKWE----ESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
               E+ +L      W+    + A L+  ++++     ++  SSM+     I    D
Sbjct: 408  KKFEVLQLLSNFLNWDDEKKQQAGLVGGTNSIQKADKNDKGSSMSKTQSFISMWTD 463

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa] {ON}
            Anc_4.46 YLR309C
          Length = 1065

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 130/609 (21%), Positives = 236/609 (38%), Gaps = 54/609 (8%)
 Frame = +1

Query: 817  SPADNDKSTIQSDQ-TAGIYIQN------LQEFHITTAKEGIKLLQKGLKYRQVASTKMN 975
            +PA ND   ++  Q T  + +QN      + E     + + ++L               N
Sbjct: 197  APATNDNHILEDKQKTQELELQNKKLCDEISELSKEISNQKVELQNHEKLISSKEEEIKN 256

Query: 976  DFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 1155
              S     +  IT+      +I +  K +L  +   E+ N     N+   E       +L
Sbjct: 257  GKSELDEKVEMITVINSKLEDISKQCKSHLDSIQNLESDN-----NKLKNENEEKQSKIL 311

Query: 1156 TLGRVIN-----------SLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1302
            TL +V+            S+ +K+  +   E  + + +Q S G +     ++T      T
Sbjct: 312  TLEQVVEKHENKIKDLEESVHEKSKLISSLEEDIKKEIQSSAGQSNTEDQVST------T 365

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
            L  T  T+  +SK KN K K + G+ I +       TT+     SD             Q
Sbjct: 366  LPSTSQTI--SSKKKN-KKKNKKGNNISQPS-----TTQAPVKSSD------------SQ 405

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD----KRTINENNELQRI-----K 1635
            + Y  L  + +  K E ++     + L  Q   + KD    K++ N+N+ L+ I     K
Sbjct: 406  EKYNALLKEYEVLKEEHEKS----DQLALQLEKITKDFDELKKSHNDNSNLKEITENFEK 461

Query: 1636 IQTMNESMKKLYA--KIERQQSIEN-----ELDGKIQIFTKTNSKLTKIIDEMKNREALV 1794
            ++  N+ + + Y   KI  ++SI +     ELD ++Q+   TN +    ID+++      
Sbjct: 462  LKLSNQKLIEEYNEFKINHEKSISDIKHTSELDDELQLLRSTNKEQEDKIDDLE------ 515

Query: 1795 NSKFKTLLD-HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK----------SEMT 1941
              K K L D   L    K  N +IEN +D        + E    IK            + 
Sbjct: 516  AEKNKVLADLGELKAALKSKNEEIENLRDMLRTVGNELVEAKDQIKDAGSLNAKEAESLK 575

Query: 1942 NLLSTARDNFEKFYQECITKFLSDTPLLFDEI---NDNVLNLKALTSNYYSQIAENLSDL 2112
              L   R+      Q   TK ++D    FD +    D +L+  ALT      + + +S +
Sbjct: 576  RELDDLREKNSAVIQTYETK-IADLKKDFDNMKNEKDKLLSNAALTERQRKILDKKISQM 634

Query: 2113 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL------LN 2274
             E   +  QF  ++     K   ++LL K    ++T +++S      TI  L       N
Sbjct: 635  EE---HISQFQKEKVELDTKLKDYDLLVK----SETYLKTSITQKEKTIAYLEKQVKDYN 687

Query: 2275 EHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESS 2454
            E   +NK+ I         +L+  E ++ K ++S  ++    +  +   N   ++N    
Sbjct: 688  EKSASNKQAI---------DLVKKESEQYKLRMSALQKENRDLKENSKKNITSSENYIKE 738

Query: 2455 MTTMTDKIK 2481
               ++++IK
Sbjct: 739  NGILSERIK 747

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 92/441 (20%), Positives = 183/441 (41%), Gaps = 36/441 (8%)
 Frame = +1

Query: 1123 KEAGSIN-QSLLTLGRVINSLADKNVHV-PFRESKLTRLLQDSLGGNTKTALIATISPAK 1296
            K+AGS+N +   +L R ++ L +KN  V    E+K+  L +D    N K      +S A 
Sbjct: 561  KDAGSLNAKEAESLKRELDDLREKNSAVIQTYETKIADLKKDF--DNMKNEKDKLLSNAA 618

Query: 1297 VT------LEETCSTLE-YASKAKNIKNKPQLGSFIMK-DILLKNITTELTKIKSDLLST 1452
            +T      L++  S +E + S+ +  K K +L + +   D+L+K+ T   T I     + 
Sbjct: 619  LTERQRKILDKKISQMEEHISQFQ--KEKVELDTKLKDYDLLVKSETYLKTSI-----TQ 671

Query: 1453 KSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRI 1632
            K K   Y+++Q  K+      + K  I   K+  E    + + L K+ R + EN++    
Sbjct: 672  KEKTIAYLEKQ-VKDYNEKSASNKQAIDLVKKESEQYKLRMSALQKENRDLKENSKKNIT 730

Query: 1633 KIQT-------MNESMKKLYAKIERQQSIENELDGKIQIFTK-----------TNSKLTK 1758
              +        ++E +K L  K +  Q++++  + +++   +           +N ++  
Sbjct: 731  SSENYIKENGILSERIKILQEKFDHAQNLKSNSNEQVESIQRQCEELNVKLKESNKRVMS 790

Query: 1759 IIDEMKNREALVNSK------FKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQ 1920
            + DE+ +   ++  K       + L+  S +  S+KL  ++ +  D   ++N  +    +
Sbjct: 791  LEDELNDYSNIIQEKTREATTMRQLISDSHNGDSQKLR-ELHDKIDYFTDENKRLKSEFE 849

Query: 1921 LIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAEN 2100
            L   +M+  L  A+    K         LS+       +N  + NLK++  +   +   N
Sbjct: 850  LSSGKMSRELQEAQAKNSKLQTSIHALTLSE-----QRLNAEIENLKSVNESIRKKSTVN 904

Query: 2101 LSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEH 2280
              D            TDE          E  N  +    +  ++   D+   I+NL+  +
Sbjct: 905  GED------------TDEL---------EKSNSSLKEALSKADTKVRDLQENIENLMKAN 943

Query: 2281 LRANKEL--IINSLSNVTTEL 2337
               NK+L  I  S   V+ +L
Sbjct: 944  NDTNKKLERITKSYRTVSNQL 964

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 70/321 (21%), Positives = 142/321 (44%), Gaps = 25/321 (7%)
 Frame = +1

Query: 1384 MKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQ-ECKRTIES 1560
            +K+   KNIT+    IK + + ++    +     H + L ++       IQ +C+     
Sbjct: 721  LKENSKKNITSSENYIKENGILSERIKILQEKFDHAQNLKSNSNEQVESIQRQCEELNVK 780

Query: 1561 LTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIE-NELDGKIQIFTK 1737
            L   N  ++  +  +N+ + + + K +    +M++L +      S +  EL  KI  FT 
Sbjct: 781  LKESNKRVMSLEDELNDYSNIIQEKTREAT-TMRQLISDSHNGDSQKLRELHDKIDYFTD 839

Query: 1738 TNSKLT--------KIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFK--DQGI 1887
             N +L         K+  E++  +A  NSK +T + H+L+   ++LN +IEN K  ++ I
Sbjct: 840  ENKRLKSEFELSSGKMSRELQEAQAK-NSKLQTSI-HALTLSEQRLNAEIENLKSVNESI 897

Query: 1888 NQNFTVD----ENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLN 2055
             +  TV+    + L+   S +   LS A D   +  QE I   +          ND    
Sbjct: 898  RKKSTVNGEDTDELEKSNSSLKEALSKA-DTKVRDLQENIENLMKAN-------NDTNKK 949

Query: 2056 LKALTSNYYSQIAENLSDLSEE------YNNFKQFITDEFYNQEKGHQHE---LLNKYIN 2208
            L+ +T +Y + ++  LS L ++       ++    +T   ++  KG       ++ +   
Sbjct: 950  LERITKSYRT-VSNQLSTLRDQRGFASSRSSRSNSVTSTLHDSSKGDSDGNGFIMGQSRP 1008

Query: 2209 NTQTVIESSSNDVMSTIQNLL 2271
            +  T  ++  N+ ++ I+N+L
Sbjct: 1009 SMSTESQAEMNEKIAYIKNVL 1029

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 104/457 (22%), Positives = 177/457 (38%), Gaps = 92/457 (20%)
 Frame = +1

Query: 1402 KNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRT-----IESLT 1566
            K I   L KIK   L  K       +++  K     +++ + EIQ    T     +E   
Sbjct: 153  KQIEDLLEKIKE--LEDKVTSSDEKNKELKKSYEVKIKSLELEIQSAPATNDNHILEDKQ 210

Query: 1567 SQNALLLKDKRTINENNELQRI----KIQTMNESMKKLYAKIERQQSIENELDGKIQIFT 1734
                L L++K+  +E +EL +     K++  N   K + +K E  ++ ++ELD K+++ T
Sbjct: 211  KTQELELQNKKLCDEISELSKEISNQKVELQNHE-KLISSKEEEIKNGKSELDEKVEMIT 269

Query: 1735 KTNSKLTKI-------IDEMKNREALVN----------SKFKTL-------------LDH 1824
              NSKL  I       +D ++N E+  N          SK  TL             L+ 
Sbjct: 270  VINSKLEDISKQCKSHLDSIQNLESDNNKLKNENEEKQSKILTLEQVVEKHENKIKDLEE 329

Query: 1825 SLSYVSKKLNYQIENFKDQ---GINQNFTVDE-------NLQLIKSEMTNLLSTARDN-- 1968
            S+   SK ++   E+ K +      Q+ T D+         Q I S+  N     + N  
Sbjct: 330  SVHEKSKLISSLEEDIKKEIQSSAGQSNTEDQVSTTLPSTSQTISSKKKNKKKNKKGNNI 389

Query: 1969 ----------FEKFYQECITKFLSDTPLLFDEINDN---VLNLKALTSNY---------- 2079
                           QE     L +  +L +E   +    L L+ +T ++          
Sbjct: 390  SQPSTTQAPVKSSDSQEKYNALLKEYEVLKEEHEKSDQLALQLEKITKDFDELKKSHNDN 449

Query: 2080 --YSQIAENLSDLS-------EEYNNFK----QFITDEFYNQEKGHQHELL---NKYINN 2211
                +I EN   L        EEYN FK    + I+D  +  E   + +LL   NK   +
Sbjct: 450  SNLKEITENFEKLKLSNQKLIEEYNEFKINHEKSISDIKHTSELDDELQLLRSTNKEQED 509

Query: 2212 TQTVIESSSNDVMSTIQNLLNEHLRANKEL--IINSLSNVTTELMSNELDRLKPKLSKWE 2385
                +E+  N V++ +  L       N+E+  + + L  V  EL+  + D++K   S   
Sbjct: 510  KIDDLEAEKNKVLADLGELKAALKSKNEEIENLRDMLRTVGNELVEAK-DQIKDAGSLNA 568

Query: 2386 ESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
            + AE + R      E N  V  +  T    +K+  D+
Sbjct: 569  KEAESLKRELDDLREKNSAVIQTYETKIADLKKDFDN 605

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309c IMH1
          Length = 867

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 117/560 (20%), Positives = 223/560 (39%), Gaps = 74/560 (13%)
 Frame = +1

Query: 1081 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 1260
            SE I     +       G+++ ++ +L     +L DKN  +     +LT   + +     
Sbjct: 74   SEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSMLNEEIKRLTMEQKKTDNDEQ 133

Query: 1261 KTALIATISPAKVTLEETC-----STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELT 1425
              A  A I   +  LE        ++ +   K K ++ + Q    +  D L K+  T+L 
Sbjct: 134  NDANEAKIRELEEQLETQNRNSKENSNKLVEKVKLLEEEAQAMK-LENDKLTKSTETQLA 192

Query: 1426 -------KIKSDL--LSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT---- 1566
                   ++K  +  L  KS++      ++  ++T + ++ K+ I E ++ I+SL     
Sbjct: 193  DKQKLIDQLKGQIQELEDKSREAF----ENSNDVTGETESLKSTIDEKQKEIDSLKAQIL 248

Query: 1567 -----SQNALLL--------KDKRTINE------NNELQRIKIQTMNES---------MK 1662
                 SQN  L+        K K+  N+      NN      I+T N S         +K
Sbjct: 249  EISTKSQNTSLISTTTASTGKGKKKKNKKSKGGVNNASLPAPIETANLSVDMDGLQNELK 308

Query: 1663 KLYAKIE----RQQSIENELDGKIQIFTKTNS---KLTKIIDEMKNREALVNSKFKTLLD 1821
             +  K E    R + +++     ++I TK ++   +L K+ D +K +    N + + + D
Sbjct: 309  DIKMKCEEWKARYEELQSSSKSTVEIETKNSALEEELVKVRDSLKQK----NIEIEEVRD 364

Query: 1822 HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLS---TARDNFEKFYQEC 1992
                 + +++   + + +DQ  N N    + ++ +K E+ NL S   T  + +EK   E 
Sbjct: 365  -----MLREVGNDLVDARDQIKNANSNAGKEVEEVKKELDNLRSKNATMIETYEKTQLEL 419

Query: 1993 ITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITD------E 2154
              K  S    L  EI++  LN   +         + +  LS+E    K  + D       
Sbjct: 420  KAKIAS----LNGEISEMKLNQTTILKEKEIASKDAIEKLSDENKTLKAQLKDINAIKLT 475

Query: 2155 FYNQEK--GHQHELLNKYINNTQTVIES----------SSNDVMSTIQNLLNEHLRANKE 2298
               +EK  G+  E + +Y N    V+++          S    ++TIQN  NE L+   +
Sbjct: 476  LTQREKTIGYLEEQVKQY-NEKNAVVQATIEKLEKELKSKESQLTTIQNE-NESLKKEAK 533

Query: 2299 LIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKI 2478
              + SL N        E  +L  +LS  +E  +      + +NE  D+++     +  K+
Sbjct: 534  TNVVSLENYL-----KENGKLSERLSILQEKYDTAQNLKSNSNEQVDSIKRQCNELNVKL 588

Query: 2479 KQTNDSXXXXXXXXXEHFKT 2538
            K++N           E+  T
Sbjct: 589  KESNKRIMSLEDELNEYMNT 608

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 93/467 (19%), Positives = 201/467 (43%), Gaps = 36/467 (7%)
 Frame = +1

Query: 1159 LGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 1338
            L +V +SL  KN+ +      L  +  D +  + +  +    S A   +EE    L+   
Sbjct: 345  LVKVRDSLKQKNIEIEEVRDMLREVGNDLV--DARDQIKNANSNAGKEVEEVKKELDNLR 402

Query: 1339 KAKNIKNKPQLGSFIMKDILLK----NITTELTKIKSDLLSTKSKDGIYMDQQHYKELTT 1506
                 KN   + ++    + LK    ++  E++++K +  +T  K+     +   ++L+ 
Sbjct: 403  S----KNATMIETYEKTQLELKAKIASLNGEISEMKLNQ-TTILKEKEIASKDAIEKLSD 457

Query: 1507 DLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIER 1686
            + +  K ++++      +LT +   +   +  + + NE   +   T+ +  K+L +K  +
Sbjct: 458  ENKTLKAQLKDINAIKLTLTQREKTIGYLEEQVKQYNEKNAVVQATIEKLEKELKSKESQ 517

Query: 1687 QQSIENELDGKIQIFTKTN----SKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN 1854
              +I+NE +  ++   KTN        K   ++  R +++  K+ T  +     +    N
Sbjct: 518  LTTIQNENES-LKKEAKTNVVSLENYLKENGKLSERLSILQEKYDTAQN-----LKSNSN 571

Query: 1855 YQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT--KFLSDTPLLF 2028
             Q+++ K Q    N  + E+ + I S + + L+   +  ++  +EC T  + +SD     
Sbjct: 572  EQVDSIKRQCNELNVKLKESNKRIMS-LEDELNEYMNTLQEKSRECDTMRRLISDQQNEE 630

Query: 2029 DEINDNVLNLKALTSN----YYSQIAENLSDLSEEYNNFKQFITD--EFYNQEKGHQHEL 2190
                  + N  AL ++      S++A   S  + E  N+K    D     NQ +  + +L
Sbjct: 631  SSGRQEIENKLALLTDERNKMESELALQTSRKNREIQNWKNMNDDLKSQLNQLQFREKQL 690

Query: 2191 LNKY--INN-TQTVIESSSND----------------VMSTIQNLLNEHLRANKELI-IN 2310
            L++   +NN +QT+  S++ND                 +      ++E   +N++L+ +N
Sbjct: 691  LSQIEDLNNISQTLKRSTNNDEDESGELKKVAGNLKEALQKADKRISELQESNEQLMKLN 750

Query: 2311 SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVES 2451
            S +N   E +SN    L  +LS   E + +    D L+   N+++ S
Sbjct: 751  SDANKKYERLSNNYRTLSSQLSTLREKSSI----DRLSRPSNESIRS 793

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 129/565 (22%), Positives = 227/565 (40%), Gaps = 50/565 (8%)
 Frame = +1

Query: 910  KEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT-ITLFKEVKGEIFRLSKMNLV------ 1068
            KE   LL+K  K + + S+++N   SR  +I   I L  + + ++    +  LV      
Sbjct: 442  KEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAN 501

Query: 1069 DLAGSEN----------INRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRES 1218
            D AG             I     ++ +  +   +    LT  + I  L  KN+ +     
Sbjct: 502  DSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTR 561

Query: 1219 KLTRLLQ--DSLGGNTKTAL----IATISPAKVTLEETCSTL--EYASKAKNIKNKPQLG 1374
            +L   L+  D +    K+ +    IA    A +TL+   S+L  + A+  K ++    L 
Sbjct: 562  ELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLS 621

Query: 1375 SFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTI 1554
            +            TE +   +D    + +  I   Q   KEL T + +    IQE K   
Sbjct: 622  N------------TEDSSTPADFDKQREQREIEHTQL-VKELETRIASI---IQESK--- 662

Query: 1555 ESLTSQNALLLKDKR-TINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI--- 1722
                 +NA +L DK   ++E N    I I+   E   K  A+ ER + ++  +D  I   
Sbjct: 663  -----ENANILNDKIFALDEKNN--HISIELAREKSAKQLAE-ERLKLLQKSMDMTITEN 714

Query: 1723 -QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNF 1899
             ++  + NS    ++++ K     +NS  KT  +  L+ V  K N      K    ++  
Sbjct: 715  ERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSE--LATVENKWNVSQNEIKLLHSSEEM 772

Query: 1900 TVDE----------------NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFD 2031
              +E                 LQ ++SE  +LLST +D F K   +           L  
Sbjct: 773  LKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELND-----------LEG 821

Query: 2032 EINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINN 2211
              ND    LK    NY S + E  ++L +++   K+ + +E  N EK +  E++ K    
Sbjct: 822  TCNDLRKKLKEAEENYGS-LMEETTELKDDFRQKKKSLKEEMSNVEKRYS-EIVEK---E 876

Query: 2212 TQTVIESSSNDVMSTIQNLLNEHLRA--NKELIINSLSNVTTEL--MSNELDRLKPKLSK 2379
             +T  E++        +  L E  +A  + E  +  +S++  EL  + NEL     +   
Sbjct: 877  RETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTES 936

Query: 2380 WEESAELINRSDALNNEFNDNVESS 2454
            + +  EL+N+S A  N+   N E++
Sbjct: 937  YRKDIELLNQSIADINKQVLNKEAA 961

>Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {ON}
            YLR309C (REAL)
          Length = 910

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 98/421 (23%), Positives = 173/421 (41%), Gaps = 52/421 (12%)
 Frame = +1

Query: 1387 KDILLKNITTELTKIKSDLL-STKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESL 1563
            K+ LL +    LTK  SD    T + + + + ++ + +     Q YK +I   ++ IE+L
Sbjct: 108  KNNLLSDEIKRLTKENSDAAPETVTCETLKVTEERFLKKE---QEYKDDIDGLEKKIEAL 164

Query: 1564 TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQ------SIENELDGKIQ 1725
             S+   L KDK   N+     R KI T  E+M K   + E+Q+       ++ EL     
Sbjct: 165  NSELTSLHKDK---NDTTSGLREKI-TALENMLKEEKETEKQEVEISLAKLKEELIANNL 220

Query: 1726 IFTKTNSKLTKIIDEMKNREALVNSKFKTLL---------DHSLSYVSKKL--------- 1851
                  +K+TK+  E+ +   +V  K   L          +  LS + KKL         
Sbjct: 221  TLEDYKTKVTKLEQELVSNNTIVEEKSSKLAELDVILKEKEQKLSELEKKLKEAPKTVIS 280

Query: 1852 NYQIENFKDQGINQ--------NFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT--- 1998
            N  + N   +  N+        N TVD+  +  +    NL++TA   +EK  ++      
Sbjct: 281  NQNVGNNNRRRKNRNKSKKNKGNATVDDLNE--EESFDNLINTA--EYEKLKEDLQVLQE 336

Query: 1999 --KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEK 2172
              +   D  L ++E+   + N K   ++  ++ AE L  L+ E ++ K+ + ++      
Sbjct: 337  KHENCEDWRLKYEEMEAELKNTKESGASQLAKSAEELKTLNTELSDTKKSLKEK------ 390

Query: 2173 GHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTE---LMS 2343
                               S   +V   ++ + NE + A  E  I   S+  TE    + 
Sbjct: 391  ------------------NSELEEVRDMLRTVGNELVDAKDE--IKGFSSKQTEEAKAVK 430

Query: 2344 NELDRLKPKLSKWEE-----SAELINRSDALNNE------FNDNVESSMTTMTDKIKQTN 2490
             ELD L+ K +   E     +AEL NR D+LN +       +   E   TT+ +K+ + N
Sbjct: 431  LELDNLRHKNATMVEAHEIKNAELKNRLDSLNKKVEHLKALSVEKEKEQTTLKNKVVKLN 490

Query: 2491 D 2493
            +
Sbjct: 491  E 491

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 64/304 (21%), Positives = 118/304 (38%), Gaps = 13/304 (4%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESL------TSQNALLLKDKRTINENNELQRIKIQ 1641
            Q+ Y  L     N    I   KR  E L      +++  L L+D+  +NE   + + K +
Sbjct: 595  QEKYNTLQNVKSNSNEHIDSIKRQCEELNIKLKESTKKILSLEDE--LNEYANIVQDKTR 652

Query: 1642 TMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
              N   + +        +   EL+ +I   T   SKL   ++  K+R A  + ++K    
Sbjct: 653  EANTLRRLVSDSHADDSTARKELENQIAYLTDEKSKLQAELNLQKSRNASESQEWK---- 708

Query: 1822 HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITK 2001
                + + +L  +I   K +       VD  L  + S++        D+ ++   E IT 
Sbjct: 709  ----HAASELKSEIHALKLREKELKSEVDA-LNHVNSDIKRKTQATSDDSDQL--ERITS 761

Query: 2002 FLSDTPLLFDE-------INDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
             L  T    DE        N+N+LNL    +  + ++ +N   LS ++N  K+       
Sbjct: 762  NLKLTLSKADEKNSELQLTNENLLNLNNELNKKFDRLLKNYRSLSAQFNAIKE------- 814

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 2340
                G   E   +   ++ T   ++ N+      N   E +R++  L ++S  N     +
Sbjct: 815  ----GQHGESTGRISRSSSTSSLATGNNNTLPANNAKLERVRSSTPLELDSEKNEKIAYI 870

Query: 2341 SNEL 2352
             N L
Sbjct: 871  KNVL 874

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 85/403 (21%), Positives = 179/403 (44%), Gaps = 34/403 (8%)
 Frame = +1

Query: 1390 DILLKNIT---TELTKIKSDLLSTKSKDG----------IYMDQQHYKELTTDLQNYKTE 1530
            +I LK+IT    E+TK++ D L TK KD           I+  ++  + L  +L+   ++
Sbjct: 794  EIELKSITESLNEMTKLR-DALETKDKDNSFALQEYKSTIHKQEEAIRTLEKELETISSQ 852

Query: 1531 IQECKRTIESLTSQNALLLKDKRTINENNE-LQRIKIQTMNESMKKLYAKIERQQSIENE 1707
             ++ +  I  +      L ++K+ + E    LQ+ K ++ ++  K+        +S+++E
Sbjct: 853  KKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKDKSNSDHQKET-------KSLKDE 905

Query: 1708 LDGKIQIFTKTNSKLTKI------IDEMKNREALVNSKFKTLL---DHSLSYVSKKLNYQ 1860
            +  KI      N  L K       + E K + +    ++K+     D+ ++ +++KL   
Sbjct: 906  ITKKIIEIKTLNENLVKTKTQHSALSEEKEQISKELVEYKSRFQSHDNLVAKLTEKLKSL 965

Query: 1861 IENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIN 2040
              N++D       ++ +++++ KSE    LS  +D F+   +E    F ++   L D+I 
Sbjct: 966  ANNYRDLQAKHE-SLMQSIEVTKSENDTQLSNLQDKFDSLSRE-KESFQTEKEHLTDDIK 1023

Query: 2041 DNVLNLKAL-------TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
            +    +  L       TS Y S   +  S +++     +   T +  N +K  +   L+K
Sbjct: 1024 ELKETISRLEHKNEETTSRYTSAKDDYESQINQLKEQLETATTTQDDNMDKISE---LSK 1080

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRL-KPKLS 2376
             I N + ++E+  +      ++ L   L A+++ +     N   E +  E  +L K  ++
Sbjct: 1081 NIRNLEMLLETCKSS-----KHDLQTKLEASEKTLAEMHEN--EERLKEEKAQLEKEVVN 1133

Query: 2377 KWEESAELINRSDALNNEFNDNVE---SSMTTMTDKIKQTNDS 2496
              +E + L    ++L  E  D+V         +TDK K+ N++
Sbjct: 1134 TKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDKAKEYNEN 1176

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 82/391 (20%), Positives = 171/391 (43%), Gaps = 34/391 (8%)
 Frame = +1

Query: 919  IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE-VKGEIFRLSKMNLVDLAGSENIN 1095
            ++LL++  + ++    + N+  ++S  I  +   +E  + E+ RL K +  + +  E   
Sbjct: 1290 LELLKELEEDKRELEIRTNEVKNQSEKIANLDKLREKTEAELCRLKKTSTDEKSNLEE-- 1347

Query: 1096 RSGALNQRAK---EAGSINQSLLTLGR--VINSLADKNVHVPFRESKLTRLLQDSLGGNT 1260
            + G L    K   +A    + LL  G   +    ++K   +   E +L +L  ++    +
Sbjct: 1348 QLGKLRNEIKIKSQAFEKERKLLNEGSSTITQEYSEK---INMLEDQLNKLENEN---ES 1401

Query: 1261 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILL---KNITTELTKI 1431
            KT LI T   +K  LE+  +TL +    +  +N+ +     MKD +L   + I    TK+
Sbjct: 1402 KTRLIDT---SKNELEK--ATLSHDEILEEKRNEIKS----MKDEILSYKEKINEANTKL 1452

Query: 1432 KSDLLSTKSKDGIYMDQ------------QHYKELTTDLQNYKTEIQECKRTIESLTS-- 1569
             S     +S+     +Q            +   E+  +  +YK+E+ + K  +E+L S  
Sbjct: 1453 LSTERDHESRSNSLKEQLEAVQESKAEVERKMNEMEEESAHYKSELNKSKEIVENLKSDI 1512

Query: 1570 -----QNALLLKDKRTINEN----NELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI 1722
                 +  LL++  +  +E      +  +I I+ +      L ++I   +    EL GK+
Sbjct: 1513 ENNEKKLELLVESGKESDEKLKQYTKNSQIDIKELQNEKTDLESQIIEFKKKIEELHGKL 1572

Query: 1723 QIFTKTNSKLTKIIDEM--KNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQN 1896
            +   ++NSK   I  E+   + +  VN + K LL+  L  +   L    E  +     +N
Sbjct: 1573 KDEAESNSKTEAIQQELTSAHEKIRVNEEEKLLLNSKLKDLECNLRDNQEEAQSTK-EKN 1631

Query: 1897 FTVDENLQLIKSEMTNLLSTARDNFEKFYQE 1989
             +++ +L+ ++ ++T+    A++  EK   E
Sbjct: 1632 DSLNSHLKELEQKLTDAQQKAKECDEKSKME 1662

>Suva_4.378 Chr4 complement(664404..665681) [1278 bp, 425 aa] {ON}
            YBR130C (REAL)
          Length = 425

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 74/312 (23%), Positives = 138/312 (44%), Gaps = 19/312 (6%)
 Frame = +1

Query: 1564 TSQNALLLKDKRTINENNE-LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKT 1740
            +SQNA   K   ++++  + L +  +Q   +S + L +K+E  QS E++L   + +    
Sbjct: 36   SSQNATSSKVIESLHDQIDMLTKANLQLTTQS-QNLLSKLELAQSKESKLLENLNLLKNE 94

Query: 1741 NSKLTKIIDEMKNREALVNSKFKTLLDHSLSY-VSKKLNYQIENFKDQGINQNFTVDENL 1917
            N  L+ I  E KN++  +    K   D S  Y V K+   ++    +       T  E L
Sbjct: 95   NENLSSIF-ERKNKK--LKEVEKNFSDLSTDYNVQKEKLAELNKVMENSSVMEKTSSEKL 151

Query: 1918 QLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAE 2097
            Q ++    +LL  +++ ++  Y   I+K       L  E+++  LN  +  S+  S +  
Sbjct: 152  QNLEVNYDSLLE-SQNFYKDHYSNEISKLNEKISFLELELSNQNLNFGSDASS-NSDMEI 209

Query: 2098 NLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL--- 2268
            NL+  S+  N+ K   T++     K     L    + N  ++ E++ N + S  + +   
Sbjct: 210  NLTKFSDSVNDLKAMETEKNSKLSKIIGQTLNELNLENWLSLYETNENLISSFAEKMDLN 269

Query: 2269 ----LNEHLRANKELIINSL-SNVTTELMS---------NELDRLKPKLSKWEESAELIN 2406
                 N+  R NK+ ++ +L  NV T++ S         NE D L  K+ K  ++    N
Sbjct: 270  DILEKNDDKRNNKDTVLQNLKKNVQTQIESNNANNMNNGNESDILPIKMVKLRKTP---N 326

Query: 2407 RSDALNNEFNDN 2442
             +D  +N  N N
Sbjct: 327  PNDPSSNSSNSN 338

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 97/505 (19%), Positives = 199/505 (39%), Gaps = 43/505 (8%)
 Frame = +1

Query: 1108 LNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
            L+   KE+  ++ +   L   +  + +K  ++  +     +LL   +  N     + T+ 
Sbjct: 98   LSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKEL-TLK 156

Query: 1288 PAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDIL--LKNITTELTKIKSDLLSTKSK 1461
                  E T    +   + +++K    L    M  +   LK+I+    +++++L +   K
Sbjct: 157  LTNQYRESTAKCHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKK 216

Query: 1462 DGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQ 1641
               Y     Y     ++Q  + +I   +     + S+N  L K+ R ++ N   +  K+Q
Sbjct: 217  MSEY-----YSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQ 271

Query: 1642 TM--------NESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKII--DEMKNREAL 1791
             +         ES K+L  K E    ++ ++      +T+  +    I+  DE +N E  
Sbjct: 272  ELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEV- 330

Query: 1792 VNSKFKTLLDHSLSYVSKKL----NYQIENFKDQGINQNFTVDENLQLIKSEMTN---LL 1950
               + K  L  + + ++K+L    N  ++       NQ     E+L  IK E+       
Sbjct: 331  --EELKQKLIETETQLNKELEERRNITMQTESSTLSNQQ---QEDLDTIKKELIQERYQK 385

Query: 1951 STARDNFEKFYQE------CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 2112
               ++  E F  E       I  F   T +L  E+ D  L L+ L     +Q+   L  L
Sbjct: 386  EKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRRE-KNQVTNELDAL 444

Query: 2113 SEEYNNFK---QFITDEFYNQEKGHQHELLNKYINN-------------TQTVIESSSND 2244
             + + + K   + +T +  +     Q+ L++  + N              Q ++++ SN+
Sbjct: 445  RQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNE 504

Query: 2245 VMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALN 2424
              S  Q +++E L   + ++     N+       EL R      + ++S   +    A++
Sbjct: 505  ESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAID 564

Query: 2425 --NEFNDNVESSMTTMTDKIKQTND 2493
               E   +++S  T + DKIK  ND
Sbjct: 565  EAKEAIISLQSYNTKLEDKIKTLND 589

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 103/466 (22%), Positives = 200/466 (42%), Gaps = 12/466 (2%)
 Frame = +1

Query: 1135 SINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEET 1314
            S+  S L L    +SL  +   +    +K+T+L +D+L    K    A I   K T+++ 
Sbjct: 780  SLTSSHLLLKESFSSLEIELGTIKESLNKMTQL-RDALETKDKENQ-ALIQECKSTIQKQ 837

Query: 1315 CSTLEYASK----AKNIKNKPQLG-SFIMKDI--LLKNITTELTKIKSDLLSTKSKDGIY 1473
               +E   K      + K K   G + + KD+  L + +   + K KS L   KSKD   
Sbjct: 838  EEAIEILEKELDNVSSQKKKADDGINKMSKDLFALSREMQAIVEKYKS-LQKEKSKD--- 893

Query: 1474 MDQQHYKE---LTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQT 1644
             D  H KE   L  ++    TEI+     +    +Q+  LLK+K  I++     +++ Q+
Sbjct: 894  -DNNHQKEAKLLKEEIARKTTEIKSLNENLGKTKTQHDDLLKEKEHISKELVECKLRFQS 952

Query: 1645 MNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH 1824
             +  + KL  K++   +   +L         T+  L   ++E+K    +  S  ++  D 
Sbjct: 953  HDILVAKLTEKLKSLANNYRDLQA-------THESLIASMEEIKKENTMQMSNLESKFD- 1004

Query: 1825 SLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKF 2004
                    L+ + E+F+    ++   ++EN++ +K  ++ L  T  +   KF       +
Sbjct: 1005 -------SLSQEKESFQ----SERELLEENIRKLKETISTLELTKEEAITKF-NSSKEDY 1052

Query: 2005 LSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQH 2184
             S   LL +++ + V      + N  S+++ N+ DL  E    K F            + 
Sbjct: 1053 ESQIGLLKEQL-ETVATENGESVNKISELSHNIDDLKGELETQKNF------------KD 1099

Query: 2185 ELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL--IINSLSNVTTELMSNELDR 2358
            +L  K   + + + E+ +N+     Q+L  E L+   E+  I   L N+   L S E + 
Sbjct: 1100 DLEAKLEASKKVLKETQANE-----QHLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKEN 1154

Query: 2359 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
             K  +++ EE  + I+  +    E+N  + S +    + ++Q N++
Sbjct: 1155 -KESVAQVEEYKKQISDKE---KEYNGKL-SELNNEINSVQQKNET 1195

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 82/465 (17%), Positives = 194/465 (41%), Gaps = 27/465 (5%)
 Frame = +1

Query: 1171 INSLADKNVHVPFRESKLTRLLQDSLGG-----NTKTALIATISPAKVTLEETCSTLEYA 1335
            + ++A +N     + S+L+  + D  G      N K  L A +  +K  L+ET +  ++ 
Sbjct: 1063 LETVATENGESVNKISELSHNIDDLKGELETQKNFKDDLEAKLEASKKVLKETQANEQHL 1122

Query: 1336 SKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL--LSTKSKDGIYMDQQHYKELTTD 1509
             +      K QL   I K      I  +L  ++ +L  L  ++K+ +   +++ K+++  
Sbjct: 1123 KE-----EKLQLEGEITK------IKEQLDNLRDNLKSLEKENKESVAQVEEYKKQISDK 1171

Query: 1510 LQNYKTEIQECKRTIESLTSQNALLLKDKRTIN-----------ENNELQRIKIQTMNES 1656
             + Y  ++ E    I S+  +N  + ++   +            + + L+  KI+ +N  
Sbjct: 1172 EKEYNGKLSELNNEINSVQQKNETICQNNEKLKGEIEEIEKASEDQSNLKGSKIEALNAQ 1231

Query: 1657 MKKLYAK--------IERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKT 1812
            +++L           ++  ++++ E++   ++  ++++K+ KI +  + +EAL +   + 
Sbjct: 1232 IEELEESKQITETKLLDSVKNMKTEMEKMRELQKESDAKMVKINELEEKQEALKHIGIQN 1291

Query: 1813 LLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS-EMTNLLSTARDNFEKFYQE 1989
            L       + K      +  +D+    N  +++   L KS E T   ST     +K Y E
Sbjct: 1292 L------ELQKGAEEARKELEDKKTEVNGLLEKITSLNKSNEKTETEST---RLKKTYAE 1342

Query: 1990 CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQE 2169
              T        L +E+   +   +         + E  S +++EY+     + ++    E
Sbjct: 1343 EKTILEGQLEKLRNEMQTKIQAFE----RERKLLNEGSSTITQEYSEKINMLEEKLIKIE 1398

Query: 2170 KGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNE 2349
              +++E  +K I+ +++ +E +++          NE L AN+                NE
Sbjct: 1399 --NENESKSKMIDTSRSELEKATSTC--------NELLEANR----------------NE 1432

Query: 2350 LDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
            +  +K K+  +EE  +  N       + N+   +S+    + +++
Sbjct: 1433 MKSMKDKILSYEEKIKEANEKLLSTEQGNEQELNSLRKQLEVVQE 1477

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 95/421 (22%), Positives = 177/421 (42%), Gaps = 22/421 (5%)
 Frame = +1

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDI-LLKNITTELTKIKSDLLSTKSKDGIYM 1476
            +L ET +TL      K++K+         K+I  LKN TT++ +I + L   K K     
Sbjct: 938  SLNETNNTL-----TKDLKSMTDKMETREKEIETLKNDTTKIDEINTQLKEAKEKI---- 988

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRI--KIQTMN 1650
              Q  KE+ T L+N  +   + +  ++ L  Q  L+ KDK++ ++ + +  +  KI  + 
Sbjct: 989  -LQKDKEIIT-LKNDTSAADKLESQLKDL--QANLISKDKKSKDDKSLIDSLNTKITKLE 1044

Query: 1651 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD--- 1821
            ES+ K      R + I       ++  TKTN  LT  + +++   +     +K L D   
Sbjct: 1045 ESLTK------RDKEIIT-----LKTNTKTNDDLTNKLKKLETELSTKEKSYKLLFDSNK 1093

Query: 1822 ------HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSE----MTNLLSTARDNF 1971
                  HS+  V    + QI+N  D    +   +D  L L++ E    +T + +   DN 
Sbjct: 1094 SLETEIHSIKKVVASKDSQIKNLNDTLSKKENNLDGKLSLLEKECHSALTKMKTLLLDNS 1153

Query: 1972 E-KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFIT 2148
            + K   E +T+  +       + +D + NLK ++  +  ++    ++        ++ IT
Sbjct: 1154 KLKNQIEQLTESNNSLEKKLSKKDDELENLKGISKIHSDELTTITNERDSFIEENEKLIT 1213

Query: 2149 DEFYNQEKGHQHEL---LNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLS 2319
            +      +    EL    NK     + +  +SS+D     ++L NE L    + +  +L+
Sbjct: 1214 E--LKSSRASYSELNKNFNKLSEKMKKLQSASSDD-----ESLSNEELHVKIKSLEKNLA 1266

Query: 2320 NVTTELMSNELDRLKPKLSKW--EESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            N             +  L+K+  E+  E I  S   N+  +     S  +M D +K   D
Sbjct: 1267 N-------------EVSLNKYLNEKLFEKIEESKRHNSFSSSRFIKSEKSMQDLLKINED 1313

Query: 2494 S 2496
            S
Sbjct: 1314 S 1314

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 94/458 (20%), Positives = 194/458 (42%), Gaps = 11/458 (2%)
 Frame = +1

Query: 1417 ELTKIKSD--LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLK 1590
            +L KI  D  L+  + K  ++  Q+  K+L + L   +T +      +++ +SQ    L 
Sbjct: 1306 DLLKINEDSELIVEEYKKKLHELQEDKKDLMSRLTFTETRLASSSFELQTKSSQ----LN 1361

Query: 1591 DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDG-KIQIFTKTNSKLTKIID 1767
              +TI     L    + T++  +K+        + I  E++  K Q+  +T +K+     
Sbjct: 1362 TLKTIVSGLNLPHDTMMTIDRELKESKPSDINVEKILLEIEHLKRQLEIETKAKI----- 1416

Query: 1768 EMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
            + +N  A ++ KFK +     S    KL Y+    K + +    +  E L+ + +  +N 
Sbjct: 1417 DAENSVAALHDKFKRIQRSDSSSEIYKLKYEASAEKIRTLESKLS-REPLKPLSNVSSND 1475

Query: 1948 LSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYN 2127
            L   R++  K+ ++     L             +LNLK +  N    +A     L E+  
Sbjct: 1476 LFNKRESISKYDEDLRAYRLE------------ILNLKEIMKNSDKGVATLQKRLEEKSL 1523

Query: 2128 NFKQFITDEFYNQEKG-----HQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 2292
            N +  + D     EK      HQ+ELL+K + + +  IE++ N++    +  L ++  A 
Sbjct: 1524 N-ENLLLDRIKILEKDLDTTEHQNELLSKTLTSQKQQIENNLNEI-HQYELQLKDYAYAL 1581

Query: 2293 KELIINSLSNVTTELMSNELDRLKPKLSKWEESA-ELINRSDALNNEFNDNVESSMTTMT 2469
            K+      S+   + M + ++ LK ++   E++  +  N  ++L  E ND         +
Sbjct: 1582 KQ------SDEDIQQMVSNINFLKDQIKDNEQALFDHENEKNSLIMELNDT--------S 1627

Query: 2470 DKIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKE 2649
             ++K++ D+             T++I+H                        +L   +K+
Sbjct: 1628 LELKKSQDAI---------KLYTSEISH-----LKERIVDAQDRTKEYEEIDQLRSQLKQ 1673

Query: 2650 GYLVTNESMKKLNELDTSIRTVLKDIDY--EKDIKETN 2757
               + +E  K+++ L+  + T+ KD +Y  E+ +K+TN
Sbjct: 1674 YMKIESELNKEISVLNFKLNTLTKDSEYKIEELLKQTN 1711

>NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496 bp,
            831 aa] {ON} Anc_5.296 YDR285W
          Length = 831

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 70/332 (21%), Positives = 133/332 (40%), Gaps = 53/332 (15%)
 Frame = +1

Query: 1552 IESLTSQN---ALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI 1722
            +E+ TS     A L ++ +T    N+  +++I+       K++ K+E+   +   L  K+
Sbjct: 169  LEAFTSTQRICATLKQELQTQQLENKKLKVQIRNFEVDSGKIHTKVEKYHQLLKALQEKL 228

Query: 1723 QIFTKTNSKLTKIIDEMKN------------REALVNSK--------FKTLLDHSLSYVS 1842
            +I      K ++   E+K             R A+ + K         K   +  L    
Sbjct: 229  KILLSERDKNSQDCAELKKTYETFQEKITCYRNAISDMKGSISNLKSLKKDTELELMKKE 288

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSD--- 2013
            K++ Y      D     +    +N  L++ E T    T ++NFE   ++   K  S    
Sbjct: 289  KEIEYLKREVDDTSGQLSEEKIKNCSLLQ-EFTKTRETLKENFESQKEDLKEKTTSMENC 347

Query: 2014 -TPLLFDEINDNVLNLKALTS-NYYSQIAENLSDLSEEYNN-FKQFITDEFYNQEKGHQH 2184
               L  DE+   +  ++ +++ N+ + + EN   L+ E+ N F+    +EF    K H+ 
Sbjct: 348  LRTLFKDEMTKQLTEIEKISNQNFEAYLEENSKSLTTEFKNMFETHEGEEFSKMAKHHEE 407

Query: 2185 EL-------------LNKYINNTQTVIESSSNDVMSTIQNLL---NEHLRANKELIINSL 2316
            EL             LN +  N  +  ES++N ++  +  ++    +    N +L+ N  
Sbjct: 408  ELEQFLEQKINVSQILNAFEKNWTSSNESNNNQILELLTKVITKVKDSDEGNHQLLTNID 467

Query: 2317 SNVTT--------ELMSNELDRLKPKLSKWEE 2388
             N+T         E   N +  L+ KLS  EE
Sbjct: 468  ENITKYKEALTKGEEYENRIKHLENKLSALEE 499

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 86/442 (19%), Positives = 185/442 (41%), Gaps = 54/442 (12%)
 Frame = +1

Query: 1387 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 1566
            K+ LL +    LTK  S++  + S + +   +   +E     QNYK +I + K+ +E+L 
Sbjct: 108  KNNLLNDEIKRLTKQNSEIPESASSETL---KDKEEEFLKKEQNYKNDIDDLKKKMEALN 164

Query: 1567 SQNALLLKDK---------------RTINENNELQR----IKIQTMNESMKKLYAKIERQ 1689
             +   + K+K                 + E  E ++    + I  + E +      +E  
Sbjct: 165  IELDTVQKEKNDTVSGLREKIVALENILKEEREAKKQKEEVSISELKEELAIKNHSLEDS 224

Query: 1690 Q----SIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTL--LDHSLSYVSKKL 1851
            +     +E  L  K  I  + +S+L ++   +K +E  ++   K +  L  ++S+ +   
Sbjct: 225  RMKITELEQNLSSKSTIMEEKSSELAELNITLKEKERKLSELEKKMKELPKAISHQNVGN 284

Query: 1852 NYQIENFKDQG-----------INQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 1998
            N + +  +++G           I++  TVD +   I +E  + L       ++ Y++C  
Sbjct: 285  NNRRKKNRNKGKKNKGGITTGDISEEETVDNS---INTEEYDKLKENLQELQEKYKDC-- 339

Query: 1999 KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 2178
                D    +++I   + + K L ++   + A+ L  L+ E  + K+ + ++  N E   
Sbjct: 340  ---EDWKQKYEDIEAELKDAKELENSQLEKSAKELETLNTELIDTKKSLKEK--NSELEE 394

Query: 2179 QHELL----NKYINNTQTVIESSS--NDVMSTIQNLLNEHLRANKELI-----INSLSNV 2325
              ++L    N+ ++    + ESSS  N+ + T++  L++    N  +I      N+    
Sbjct: 395  VRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLRHKNATMIEAYEAKNTELRS 454

Query: 2326 TTELMSNELDRLKPKLS-KWEESAELINRSDALNNEFN------DNVESSMTTMTDKIKQ 2484
              EL+S +++ LK   + K +E     N+   LN E +       N+   +T++    KQ
Sbjct: 455  KIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEISQLTYEKSNITKELTSLRTSYKQ 514

Query: 2485 TNDSXXXXXXXXXEHFKTNDIA 2550
               +         +  +  D+A
Sbjct: 515  KEKTVSYLEEQVKQFSEQKDVA 536

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 88/431 (20%), Positives = 175/431 (40%), Gaps = 68/431 (15%)
 Frame = +1

Query: 1402 KNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNAL 1581
            KN+T EL K  +D +S    +         +++  D      EIQ   R  E    +  L
Sbjct: 10   KNLTDELAKGLADDMSPTPSE---------QQIEDDKSGLPKEIQAKLRKFEKYEQKYPL 60

Query: 1582 LLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI 1761
            LL    +  +N +L+  K+    E+++K+ A+     +I++ +D     F   N+K   +
Sbjct: 61   LL----SAYKNEKLKSEKL----EAVEKILAENTPISNIDDAVDTLPAFFQDLNNKNNLL 112

Query: 1762 IDEMK-----NREALVNSKFKTLLDHSLSYVSKKLNYQ--IENFKDQGINQNFTVDENLQ 1920
             DE+K     N E   ++  +TL D    ++ K+ NY+  I++ K +    N  +D  +Q
Sbjct: 113  NDEIKRLTKQNSEIPESASSETLKDKEEEFLKKEQNYKNDIDDLKKKMEALNIELD-TVQ 171

Query: 1921 LIKSE-----------MTNLLSTARDNFEKFYQECITKF----------LSDTPLLFDEI 2037
              K++           + N+L   R+  ++  +  I++           L D+ +   E+
Sbjct: 172  KEKNDTVSGLREKIVALENILKEEREAKKQKEEVSISELKEELAIKNHSLEDSRMKITEL 231

Query: 2038 NDNVLNLKALTSNYYSQIAE----------NLSDLSEEYNNFKQFITDEFY--------N 2163
              N+ +   +     S++AE           LS+L ++     + I+ +          N
Sbjct: 232  EQNLSSKSTIMEEKSSELAELNITLKEKERKLSELEKKMKELPKAISHQNVGNNNRRKKN 291

Query: 2164 QEKGHQHE--LLNKYINNTQTVIESSSNDVMSTIQNLLNE-------------------- 2277
            + KG +++  +    I+  +TV  S + +    ++  L E                    
Sbjct: 292  RNKGKKNKGGITTGDISEEETVDNSINTEEYDKLKENLQELQEKYKDCEDWKQKYEDIEA 351

Query: 2278 HLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSM 2457
             L+  KEL  + L     EL +   + +  K S  E+++EL    D L    N+ V++  
Sbjct: 352  ELKDAKELENSQLEKSAKELETLNTELIDTKKSLKEKNSELEEVRDMLRTVGNELVDAK- 410

Query: 2458 TTMTDKIKQTN 2490
                D+IK+++
Sbjct: 411  ----DEIKESS 417

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 53/239 (22%), Positives = 93/239 (38%), Gaps = 19/239 (7%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESL------TSQNALLLKDKRTINENNELQRIKIQ 1641
            Q+ Y  L     N    I   KR  E L      +++  L L+D+  +NE   + + K +
Sbjct: 593  QEKYNTLQNVKSNSNEHIDSIKRQCEELNVKLKESTKKILSLEDE--LNEYANIVQDKTR 650

Query: 1642 TMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
              N   + +        S + EL+ K+   T   +KL   +D   +R+A    ++K  + 
Sbjct: 651  EANTLRRLVSDSQTDDSSKQKELENKLAYLTDEKNKLEAELDLQTSRKATELQEWKHTVT 710

Query: 1822 ------HSLSYVSKKLNYQIENFK----DQGINQNFTVDENLQL--IKSEMTNLLSTARD 1965
                  H+L    + L  +++  K    D       T D++ QL  I S +   LS A +
Sbjct: 711  ELKSEIHALKLREEGLKSEVDALKHVNNDIKRKTQATSDDSDQLEQITSNLKLSLSKADE 770

Query: 1966 -NFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQ 2139
             NFE                     N+ +LNL    +  + ++ +N   LS + N  K+
Sbjct: 771  KNFE-----------------LQSANEKLLNLNNELNKKFDRLLKNYRSLSSQLNALKE 812

>KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5.267
            YHR023W
          Length = 1891

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 69/340 (20%), Positives = 140/340 (41%), Gaps = 7/340 (2%)
 Frame = +1

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 1482
            L E    L+  S+    K K    +   + IL K +  EL     +L  TK K  +    
Sbjct: 870  LREVRQLLQQESENLEEKEKLLADNETKRIILEKELEKELEL--KELHETKQKKSV---- 923

Query: 1483 QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMK 1662
            Q Y+ L   + + K  + E +  I +LTS+N +LL D   +   +  +  + + +    +
Sbjct: 924  QEYESLQEQIISTKNLLSEKEDCISNLTSKNKVLLDDIAKLKSLSSSKTSEYENLISENE 983

Query: 1663 KLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS 1842
            KL  K+E  + IE E   +I    K                  +NS  K  LD  L  + 
Sbjct: 984  KLVKKLEELERIEQEKQSEIDTLQKK-----------------LNSS-KQNLDIKLVTLE 1025

Query: 1843 KKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            K  N  +   +   +N+N ++  ++  +K E   +               ++K +++   
Sbjct: 1026 KNCNAAMSRLQGL-VNENISLRSDIDSLKKEKQKI------------DLLLSKKVTEVER 1072

Query: 2023 LFDEINDNVLNLKALTS------NYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQH 2184
            L ++I +N   ++A++       + + ++ + L + +++Y + KQ      Y + +G   
Sbjct: 1073 LSNKIENNYKEMEAVSKQRDTVVSEHDKLGKELKEANQKYLDMKQ-----KYEELEGSFT 1127

Query: 2185 ELLNKYINN-TQTVIESSSNDVMSTIQNLLNEHLRANKEL 2301
             L  ++ N+  Q      ++  + T++N LN+ +  N  L
Sbjct: 1128 ALQKRFSNDEKQNEQSKGASSKIETLENRLNQEISLNTYL 1167

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 77/372 (20%), Positives = 159/372 (42%), Gaps = 26/372 (6%)
 Frame = +1

Query: 1438 DLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTI-ESLTSQNALLLKDKRTINE- 1611
            D  + +S   I+ +++ Y ++  +L+ YK E  + +  + ES    N L  + K+  ++ 
Sbjct: 1353 DRTNLQSSGEIFRNRKEYSKIDEELKAYKFENYKLQEHVDESYNLINKLNFEMKQASSKE 1412

Query: 1612 ---NNELQRI-KIQTMNESMKKLYAKIERQQSI------------ENELDGKIQIFTKTN 1743
               N ++Q + K     E  K+L+A   +QQ              E +L   I    +  
Sbjct: 1413 ALLNEQIQMLAKDLEGTERQKELFANTVKQQKAQYESCLNDLHENEKQLKDYINALMQAE 1472

Query: 1744 SKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQ---IENFKDQGINQNFTVDEN 1914
              +  + + ++  +A    K K + +   +    ++  Q   +E  + QGIN+  T D  
Sbjct: 1473 EDIKSMTEIIEKLKAQNKQKDKAIWEKETAKNDLEMKLQECELELKRIQGINKMLTSD-- 1530

Query: 1915 LQLIKSEMTNLLSTAR-DNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQI 2091
            L   K  +     T++ +N  K  ++ +         L  EI+     L+ L ++Y ++I
Sbjct: 1531 LSHFKERVAEATDTSQYENEIKELKDQLDMGFKTESSLRKEISTLNYKLETLNNDYEAKI 1590

Query: 2092 AENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLL 2271
            ++ L   +E Y    + + +E  ++    + EL  +Y       +   SND+ S ++ L+
Sbjct: 1591 SDLLKQ-NEHYARVTETLNNE-KDETIASKVELSKEY-----QALLLRSNDLSSNVELLI 1643

Query: 2272 NEHLRANKEL--IINSLSNVTTEL--MSNELDRLKPKLSKWEESAELINRSDALNNEFND 2439
            NE+ R   EL    ++++  + E   +S E + +  K+   EE+ EL       N E   
Sbjct: 1644 NENGRLKSELESSRDAITKSSAEFGELSQEKEDILNKMKYLEETLELQKEQSERNEELVQ 1703

Query: 2440 NVESSMTTMTDK 2475
            N++  +    +K
Sbjct: 1704 NLQKDINYFREK 1715

 Score = 33.1 bits (74), Expect = 5.1
 Identities = 56/292 (19%), Positives = 123/292 (42%), Gaps = 16/292 (5%)
 Frame = +1

Query: 1123 KEAGSINQSLLTLGR----VINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISP 1290
            KE  ++N  L TL       I+ L  +N H       L     +++   +K  L      
Sbjct: 1570 KEISTLNYKLETLNNDYEAKISDLLKQNEHYARVTETLNNEKDETIA--SKVELSKEYQA 1627

Query: 1291 AKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITT--ELTKIKSDLLSTKS-- 1458
              +   +  S +E     +N + K +L S   +D + K+     EL++ K D+L+     
Sbjct: 1628 LLLRSNDLSSNVELLIN-ENGRLKSELES--SRDAITKSSAEFGELSQEKEDILNKMKYL 1684

Query: 1459 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
            ++ + + ++  +     +QN + +I   +   ++   +N  L ++ +T+   +E    K+
Sbjct: 1685 EETLELQKEQSERNEELVQNLQKDINYFREKYDNEKQKNINLFEENQTLVRQSEQLGSKL 1744

Query: 1639 QTMNESMKKLYAK-------IERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVN 1797
            Q++NE +     K        E ++ + +E D K  +     S+  + I E++ +    N
Sbjct: 1745 QSLNEKLSDTREKDAWLSKISELEEMLSSETDEKYNLLKGLKSQ-ERAIQELEEK----N 1799

Query: 1798 SKFKTLLDHSLSYVSKKLNYQIENFKDQ-GINQNFTVDENLQLIKSEMTNLL 1950
             K   +++ + +   K+    +  + +Q G  +N    + LQ+ K+   N L
Sbjct: 1800 MKQADVINLA-NEDRKQFEISVVQYNEQLGQLENLVSQQELQMKKATRENTL 1850

>Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {ON}
            YLR309C (REAL)
          Length = 913

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 83/409 (20%), Positives = 169/409 (41%), Gaps = 43/409 (10%)
 Frame = +1

Query: 1387 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 1566
            K+ LL      LTK  S+++          D++  +E     Q+YK EI   ++ I +L 
Sbjct: 108  KNSLLNEEIKRLTKQNSEVVPESVSGDTLRDKE--EEFLKKEQDYKNEIDVLEKNINALN 165

Query: 1567 SQNALLLKDKR-TINENNEL-----QRIKIQTMNESM--KKLYAKIERQQSIEN-ELDGK 1719
            +++A+L KDK  TI++  E       ++K +  N     K+ ++K++   + +N  L+GK
Sbjct: 166  NESAILQKDKDITISDLREQVAALESQLKEERENRKRDDKEFFSKLKEDLAAKNHSLEGK 225

Query: 1720 --------------IQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNY 1857
                            I  + +SKLT++   +K +E  +N     L D S +      N 
Sbjct: 226  QLKITELEERLTSNNAIMEEGSSKLTELNTTLKKKEEKLNDLENRLKDASNTMA---FNQ 282

Query: 1858 QIENFKDQGINQN---------FTVDENLQ-----LIKSEMTNLLSTARDNFEKFYQECI 1995
             + N   +  N+N            D N +     +I  E    +       ++ Y++C 
Sbjct: 283  NVGNNNRRKKNRNKGKKNRGSASVYDANKEETPDNVINFEEYEKIKEDLQALQEKYEDC- 341

Query: 1996 TKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKG 2175
                 D    ++EI   + N K L ++   + A+ L +L+ +    K+ + ++  N E  
Sbjct: 342  ----EDWKQKYEEIEREIKNAKELENSQLEKSAKELENLNVKLTETKKSLKEK--NSELE 395

Query: 2176 HQHELL----NKYINNTQTVIESSSN--DVMSTIQNLLNEHLRANKELIINSLSNVTTEL 2337
               ++L    N+ ++    + ES++   + +  ++  L+     N  +I         E 
Sbjct: 396  EVRDMLRVVGNELVDAKDQIKESTNKQFEEVKAVKLELDNLRHKNASMI---------EA 446

Query: 2338 MSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
               ++  LK K+    + AE +  S A   E +  ++  +  + ++I Q
Sbjct: 447  YETKIIELKNKIDSLNKEAEHLKTSSAEKEEEHAVLQKKVAKLNEEISQ 495

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 51/237 (21%), Positives = 100/237 (42%), Gaps = 17/237 (7%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESL------TSQNALLLKDKRTINENNELQRIKIQ 1641
            Q+ Y  L     N    I   KR  E L      +++  L L+D+  ++E   + + K +
Sbjct: 595  QEKYNTLQNVKSNSNEHIDTIKRQCEELNVKLKESTKKILSLEDE--LSEYTNIVQDKTR 652

Query: 1642 TMNESMKKLYAKIERQQS-IENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 1818
              N ++++L +  +   S  + EL+ KI   T   SKL   ++   +R+A    ++K   
Sbjct: 653  EAN-TLRRLVSDSQVDDSGKQKELENKIAYLTDEKSKLEAELNLQTSRKASELQEWKHNA 711

Query: 1819 D------HSLSYVSKKLNYQIE--NFKDQGINQNF--TVDENLQLIKSEMTNLLSTARDN 1968
                   H+L    K+L  +++  N  +  I +    T D++ QL +  +   L+ AR +
Sbjct: 712  AELKSEIHALKLREKELKSEVKALNLANSNIKRKTQATSDDSTQLEQITLNLKLALARAD 771

Query: 1969 FEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQ 2139
             EK  +                 N+N++NL    +    ++ +N   LS + +  K+
Sbjct: 772  -EKNSE-------------LQSTNENLMNLNNELNKKLDRLLKNYRSLSSQLSTLKE 814

>NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {ON}
            Anc_4.268 YDL074C
          Length = 712

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 91/498 (18%), Positives = 214/498 (42%), Gaps = 61/498 (12%)
 Frame = +1

Query: 1186 DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKP 1365
            D NV V ++ ++   L+  ++ GN  +   A +      L    S +E +     +KNK 
Sbjct: 103  DINVFVKYK-TQFINLISKAVSGNNGSTSNADLGVNVERLLNKLSEMEASKTELFLKNKT 161

Query: 1366 QLGSFIMK----DILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK----ELTTDLQNY 1521
                        +IL+K    E +   S + +   KD + ++++       E   D +  
Sbjct: 162  LQSELTSLKKYYEILIKKYDREDSATVSRVFN---KDTLKLEEEKENSDSNEFLNDNRKD 218

Query: 1522 KTEIQECKRTIESLTSQNAL--LLKDKRTINENNELQR----------IKIQTMNESMKK 1665
            K ++QE + +  +L   ++   L  +K +  E+N+ +           +KI  +   ++K
Sbjct: 219  KIKVQEDEPSTNALKKDDSAVDLKNEKESPLESNQEEEDKEKQNLKYELKISDLEAQIQK 278

Query: 1666 LYAKIERQQSIENELDGKI-----QIFTKTNSKLTKIIDEMKNREALVNS------KFKT 1812
            L + I   +  +N  + K+     Q+   T++        +++R+ L+N       + + 
Sbjct: 279  LQSTITELEKFKNANEEKLLNLNAQLSNITSNNTIPENGNVEDRDTLLNKIQYLTQENRE 338

Query: 1813 LLDHSLSYVSK--KLNYQIENFKDQGINQNFTVDENL----QLIKSEMTNLLSTARDNF- 1971
            L + + ++++K  KL+ + E F ++  +Q     ENL    Q+++ ++  +  TARD+  
Sbjct: 339  LAETNEAFLNKFQKLSSEQEIFNNKVKSQFKETHENLLKNNQILEKDLVRI-RTARDDLL 397

Query: 1972 --------EKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQ-IAENLSDLSEEY 2124
                    E    + I    +   +L ++ N      K++T+   S+ + + + D+ + +
Sbjct: 398  SKIAILEKETTKSKMIKDLQTANEILTEQWNRVEERSKSITTATSSESLLKEIQDMEKGF 457

Query: 2125 NNFKQFITDEFYNQEKGHQHELLNKYINNTQT-----VIESSSNDVMSTIQNLLNEHLRA 2289
                  +  + Y++   H+  +    +  T+          S + ++   +NLL +  + 
Sbjct: 458  KELSSLVNKK-YSEYLNHESVISKLSVEKTKADQKYFAAMRSKDSILIENKNLLKKFNKT 516

Query: 2290 NK---------ELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDN 2442
            N+         +L++  L N+ T+L+ ++ +  +   S    S+++IN +  LNN     
Sbjct: 517  NELILQYKDTEKLLLQKLENINTQLIFSQNNEKRLISSNKSTSSKIINLNSELNNV---- 572

Query: 2443 VESSMTTMTDKIKQTNDS 2496
             +S+     +K++QTN++
Sbjct: 573  KKSNYRLQEEKLQQTNEA 590

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
            YLR309C (REAL)
          Length = 916

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 110/513 (21%), Positives = 206/513 (40%), Gaps = 56/513 (10%)
 Frame = +1

Query: 1120 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL--LQDSLGGNTKTALI---ATI 1284
            A+E G + + L TL        D        ++K+     L+DS  G  +  L      +
Sbjct: 324  AEEYGKLKEDLQTLQEKHKDCEDWKHQYDEIKTKIENANGLEDSQLGKLEKELEKLNVEL 383

Query: 1285 SPAKVTLEETCSTLE--------YASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 1440
            S  K +L+E  S LE          ++  + KNK      I +    +N   +  K++ D
Sbjct: 384  SATKKSLKEKNSELEEVRDMLRTVGNELVDAKNK------IKESTSQQNEEVKAVKLELD 437

Query: 1441 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRT-INENN 1617
             L  K+   I   +    EL   L +   E+ EC +T  +   +   LL++K   +NE+ 
Sbjct: 438  DLRHKNATMIEAYETKNSELRNKLDSLNKEV-ECLKTSSTEKEKEQALLQNKLVKLNEDI 496

Query: 1618 ELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVN 1797
                ++   + + +  L    ++++     L+ +++ F +      K  +++K      N
Sbjct: 497  SQLALEKSIITKELTSLKISYKQKEKTVGYLEEQVKQFNEQKDAAEKSTEQLKKE----N 552

Query: 1798 SKFKTLLDHSLSYVSKKLNYQIEN-FKDQG------INQNFTVDENLQLIKSEMTNLLST 1956
            SK    LD     + KK N  + N  K  G      + +N  + E L +++ E  N L  
Sbjct: 553  SKISNRLD-----LLKKENETLHNDIKKNGNSYETYLKENGKLSERLNILQ-EKYNTLQN 606

Query: 1957 ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK 2136
             + N  + + + I +   +  +   E N  +L+L+   + Y    A  + D + E N  +
Sbjct: 607  VKSNSNE-HMDSIKRQCEELNVKLKESNKKILSLEDELNEY----ANIVQDKTREANTLR 661

Query: 2137 QFITDEFYNQEKGHQHELLNK--YINNTQTVIESSSNDVMSTIQNLLNE--HLRANKELI 2304
            + ++D   + +   Q EL +K  Y+ + ++ +ES  N   S   + + E  H  A  +  
Sbjct: 662  RLVSDS-QSGDLSKQKELEDKLAYLTDEKSRLESELNLQTSRKASEIQEWKHTAAELKSE 720

Query: 2305 INSLSNVTTELM-----------------------SNELDRLKPK----LSKWEE-SAEL 2400
            I++L     EL                        SN+L+++K      LSK EE ++EL
Sbjct: 721  IHALKLRERELKSEVKALDSANSDIRRKTQATSDDSNQLEQIKANLKLALSKAEERNSEL 780

Query: 2401 INRSD---ALNNEFNDNVESSMTTMTDKIKQTN 2490
             + ++    LNNE N   +  +        Q N
Sbjct: 781  QSTNENLLNLNNELNKKFDRLLKNYRSLSSQLN 813

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 84/409 (20%), Positives = 166/409 (40%), Gaps = 43/409 (10%)
 Frame = +1

Query: 1387 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 1566
            K+ LL +    LTK  S ++     + I  D++ + +     Q YK++I   ++ I++L 
Sbjct: 108  KNGLLNDEIKRLTKENSGMVPETVSENISNDKEEFLQKE---QEYKSDILGLEKKIDALN 164

Query: 1567 SQNALLLKDKRT------------------------------INENNELQRIKIQTMNES 1656
            ++ A L KDK +                              +++  E   IK  +  ES
Sbjct: 165  NELATLQKDKDSTVLEFEKKLAALENVLKVEKDTKEQEDNACLSKLKEELAIKDHSFEES 224

Query: 1657 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTL-----LD 1821
              K+    +   S ++ +       T+ N+ L +  +++++ E   N   KT+     L+
Sbjct: 225  QLKIRELEQELASYKDTMKENTLTLTELNTSLKEKEEKLRDLEKQANEVSKTITSNGSLN 284

Query: 1822 HSLSYVSKKLNYQIENFKDQGINQNFTVDENL---QLIKSEMTNLLSTARDNFEKFYQEC 1992
             ++   +++   + +  K++G      V+E      LI +E    L       ++ +++C
Sbjct: 285  QNVGGNNRRKKNRNKAKKNKGSTSADGVNEEEIFDNLISAEEYGKLKEDLQTLQEKHKDC 344

Query: 1993 ITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEK 2172
                  D    +DEI   + N   L  +   ++ + L  L+ E +  K+ +      +EK
Sbjct: 345  -----EDWKHQYDEIKTKIENANGLEDSQLGKLEKELEKLNVELSATKKSL------KEK 393

Query: 2173 GHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNEL 2352
              + E                  D++ T+ N L +     KE    S  N   + +  EL
Sbjct: 394  NSELE---------------EVRDMLRTVGNELVDAKNKIKE--STSQQNEEVKAVKLEL 436

Query: 2353 DRLKPK----LSKWE-ESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
            D L+ K    +  +E +++EL N+ D+LN E    VE   T+ T+K K+
Sbjct: 437  DDLRHKNATMIEAYETKNSELRNKLDSLNKE----VECLKTSSTEKEKE 481

 Score = 35.8 bits (81), Expect = 0.71
 Identities = 60/279 (21%), Positives = 114/279 (40%), Gaps = 17/279 (6%)
 Frame = +1

Query: 1354 KNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD--QQHYKELTTDLQNYKT 1527
            KN     +++ ++  L      L +  + L + KS    +MD  ++  +EL   L+    
Sbjct: 575  KNGNSYETYLKENGKLSERLNILQEKYNTLQNVKSNSNEHMDSIKRQCEELNVKLKESNK 634

Query: 1528 EIQECKRTIESLTSQNALLLKDKRTINENNELQRI-------KIQTMNESMKKLYAKIER 1686
            +I     ++E   ++ A +++DK    E N L+R+        +    E   KL    + 
Sbjct: 635  KIL----SLEDELNEYANIVQDKT--REANTLRRLVSDSQSGDLSKQKELEDKLAYLTDE 688

Query: 1687 QQSIENELD-------GKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSK 1845
            +  +E+EL+        +IQ +  T ++L   I  +K RE  + S+ K L D + S + +
Sbjct: 689  KSRLESELNLQTSRKASEIQEWKHTAAELKSEIHALKLRERELKSEVKAL-DSANSDIRR 747

Query: 1846 KLNYQIENFKDQGINQNFTVDEN-LQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            K              Q  + D N L+ IK+ +   LS A +   +               
Sbjct: 748  K-------------TQATSDDSNQLEQIKANLKLALSKAEERNSEL-------------- 780

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQ 2139
                 N+N+LNL    +  + ++ +N   LS + N  K+
Sbjct: 781  --QSTNENLLNLNNELNKKFDRLLKNYRSLSSQLNAMKE 817

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 118/587 (20%), Positives = 227/587 (38%), Gaps = 28/587 (4%)
 Frame = +1

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA------KNIKNKPQLG 1374
            +S L R  +D   G     +   +      LE+   TLE  SKA      + +KN  +  
Sbjct: 682  QSALRRGPEDETSGKISFEIFDDLKQQYSALEKELKTLEGGSKATITELEEKVKNLDKKC 741

Query: 1375 SFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTI 1554
              +  D  L   TTE T++     S K       D +   E    L N K ++   K   
Sbjct: 742  KELEAD--LNKSTTEHTQLNERYESVKK------DLELTAEKVAALNNEKRDLLSLKEKY 793

Query: 1555 E-SLTSQNALLLKDKRTI--------NENNELQRIKIQTMNESMKKLYAKIERQQSIENE 1707
            E +LT   A L K+K  I        N  +E Q+ +   +N+  ++L+   + +Q +ENE
Sbjct: 794  EDTLTDNEASLSKNKDLIQRLKADLGNMTSEKQKAE-DGINKMSRELFTLTKEKQDLENE 852

Query: 1708 L-------DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIE 1866
            +       + ++Q F K   +L++ + + K+ E     +F T L + +  +        +
Sbjct: 853  INKSGKENEQRLQKFKKDEKRLSEGLAQ-KDAEVKKLQEFVTRLQNQIQELETS-----K 906

Query: 1867 NFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIND- 2043
            N     +N      E+   +  ++T  L +   NF++  QE   + +S   +   + ND 
Sbjct: 907  NELSSELNSLRPRFESHNALIPKLTEKLKSLAKNFKQLEQE--KELISQELVSKGKFNDE 964

Query: 2044 NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELL--NKYINNTQ 2217
             + +LK+  S   S+I E L    E++      +  E  ++ K  Q   +  +  +++ Q
Sbjct: 965  EISSLKSEISTLASEI-ETLVGQKEDFEKKVTHLGQEVASKVKLLQDSKIDHDSEVSSLQ 1023

Query: 2218 TVIESSSNDVMSTIQNLLNEHLRANK-ELIINSLSNVTTELMSNELDRLKPKLSKWEE-- 2388
              I+S +  V +  ++ L+   R  + E  I SL     +L  +     K  +SK EE  
Sbjct: 1024 KTIDSLNAQVKTISESQLHHSSRREQAEKKIASLDGEFEKLELSVTKLNKLLISKDEELQ 1083

Query: 2389 SAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXX 2568
            S +++        + N  + S   T  D++++  D          E  K           
Sbjct: 1084 STKVVISGIEGERDANQMLLSETKTKLDELQKKFDDLQTKHLDTSEKMK----------- 1132

Query: 2569 XXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDYEKDIK 2748
                               ++ + +KE  +  ++  K + EL T + TV  +++  K+ +
Sbjct: 1133 -EVQKEQRIQCDEHQKMIKKMEKQLKEISIERDQKEKVVTELRTKLETVCAELNASKEDR 1191

Query: 2749 ETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIPRLE 2889
            +       S    +   I    ++K S   + +    Q Q+    L+
Sbjct: 1192 KEELVQLMSEIDTFKSKILALEEEKSSIERSCDSYRTQRQNNEAELK 1238

 Score = 38.1 bits (87), Expect = 0.15
 Identities = 47/196 (23%), Positives = 85/196 (43%), Gaps = 20/196 (10%)
 Frame = +1

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKS------KDGIYMD 1479
            STL  ++KA    NK  +         LK    EL    SDL  T +      K+ + ++
Sbjct: 1475 STLNMSAKA----NKESIDD-------LKKQLEELQARYSDLEETSTRELQSLKETLRLE 1523

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLL----KDKRTINENNELQ------R 1629
             ++ +     L   K  + +   TIESLTS+ + L     K ++T  E  EL+       
Sbjct: 1524 YENKETQKKQLDEMKDSVNQKDETIESLTSKCSELKFEKEKSEKTSLELKELESKHNRYM 1583

Query: 1630 IKIQTMNESMKKLYAKIERQQSIENELDGKI----QIFTKTNSKLTKIIDEMKNREALVN 1797
              ++T N++   L  +IE  ++ +N L  ++    + + +    L KI DE   +  L+ 
Sbjct: 1584 NDLETCNKAKTSLLTEIETIRNQKNNLSEELLKNQKQYKENEDSLQKIADENARKINLLE 1643

Query: 1798 SKFKTLLDHSLSYVSK 1845
             +   L + ++ + SK
Sbjct: 1644 EELANLKEDAMLWKSK 1659

>TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {ON}
            Anc_8.331 YDR150W
          Length = 1795

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 93/434 (21%), Positives = 178/434 (41%), Gaps = 37/434 (8%)
 Frame = +1

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFI------------MKDILLKNITTELTKIKSDLL 1446
            +E++   ++++S  KN  N P L S +            +KD  L     +L    S L+
Sbjct: 41   IEDSIDDIKHSSN-KNNTNNPILNSLLSQLDTTDISPSFLKDFNLNTSNLDLQHNMSILM 99

Query: 1447 STKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINEN---N 1617
               SK  + ++    ++L  D  NY+       ++I  +T +N  L+  K+ I +N   N
Sbjct: 100  EINSK--LILEN---RKLLNDNINYE-------KSINDITFENEKLVDSKKKIIDNYYSN 147

Query: 1618 ELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVN 1797
            E Q IK++ +N               +EN+L    + +     K+ K+ DE+ ++ + + 
Sbjct: 148  ETQLIKLKDLN-------------WDLENKLKSINKDYNSMKMKMLKLNDELDSKNSSIE 194

Query: 1798 SKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK 1977
            ++ K+L D  L+     L   I   K    N+   ++E +  +  E   L S   +   K
Sbjct: 195  NQIKSLND--LNLKKNNLEKDINKIKFNYNNEINNLNERISNLNDENDALQSKLNNQNSK 252

Query: 1978 FYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYN--NFKQFITD 2151
                   K   +TP              + +++  +Q+ +  S L EE     FKQ   +
Sbjct: 253  -------KLSINTP-------------PSSSNSIITQLQDTNSQLKEEIEKLRFKQ-QNE 291

Query: 2152 EFYNQEKGHQHELLN----KYINNTQTVIESSSNDVMSTIQ--------NLLNEHLRANK 2295
            +  +Q K  +   ++    K+ +N + VI S  +  + ++         N + + +  N 
Sbjct: 292  QINSQTKSSRSSSISQDSLKFDSNGELVINSMDSSSIKSLSQSNCPLTLNEVEKFVELND 351

Query: 2296 ELII-----NSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMT 2460
             +++     NSL N+ T L  N+L  +            LI R   L  + N     S++
Sbjct: 352  MILLPKERYNSLENL-TNLNFNQLKDI------------LIKRDFVLLTKDNYKTLKSLS 398

Query: 2461 TMTDKI---KQTND 2493
            T++DK+   + TND
Sbjct: 399  TLSDKVIINRLTND 412

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 76/289 (26%), Positives = 131/289 (45%), Gaps = 23/289 (7%)
 Frame = +1

Query: 1630 IKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFK 1809
            +K++  N+ +  L+AKI+ Q+   ++L   I      N   TK+ DE+K   +  +SK +
Sbjct: 426  LKLKLENDIIATLHAKIDLQEL--HDLSIIIAENIDPNFVTTKLEDELKIIMSSSDSK-E 482

Query: 1810 TLLDHSLSYVSKKLNYQ---IENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 1980
            T    +L+++    N     ++NF +  IN     D     I+ E+ N+ S   ++  +F
Sbjct: 483  TKFLKNLTFLLINCNNNENPVKNFLENLINILTNSDLKSNQIQLEILNIYSYFFESKLQF 542

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
              + + KF+ + P+L +EI+  V + K L     SQ A   SD +   N+   FIT    
Sbjct: 543  IGDNLQKFIDEIPILVEEISIEVYS-KILLKYSKSQYA---SDNNTFINSLNDFIT---A 595

Query: 2161 NQEKGHQHELLNKYINNTQTVI-----ESSSNDVMSTIQNLLNEH--------LRAN--- 2292
            +   G     L  ++N+  + I     E S + V+  + N ++ +        L  N   
Sbjct: 596  STSLGIPSSKLIPFLNSFSSDILKLLKEESDSSVIELVDNWISTYRFEDNGAILHGNLFD 655

Query: 2293 ----KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNN 2427
                 +L  N+ SN TTEL+S  L  LK  L K+     LI+ +  L N
Sbjct: 656  EQIIAKLYKNAESNNTTELLSINLSSLKLPLQKY-----LIDNTAILEN 699

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 91/418 (21%), Positives = 181/418 (43%), Gaps = 17/418 (4%)
 Frame = +1

Query: 1279 TISPAKVTLE-ETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTK 1455
            T S  ++T E +T   L+  ++ K  KN+  L  +  K   L+NI T+L  I   L   K
Sbjct: 773  TTSLKQITEERDTLDALKKENENKIEKNEELLKEYKEK---LQNIETQLQTII--LAKQK 827

Query: 1456 SKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK 1635
            +++G+    +    L+ + Q  +      K  ++ L  + A+L K+KR +++    +   
Sbjct: 828  AEEGVNKMNRELFALSREKQELEGNQ---KIALKDLQKKTAVLEKEKRQLSDKLNEKEKD 884

Query: 1636 IQTMNESMKKLYAKIERQQSIENELDGKIQ----IFTKTNSKLTKIIDEMKNREALVNSK 1803
            I  +NE +  L   ++  +S +NE   +++     F   ++ + K+ D++K+        
Sbjct: 885  ITRLNEELATLENTVKSLESEKNEKRKEVEEWKSKFQNHDNLVPKLTDKLKSLATSFKEL 944

Query: 1804 FK---TLLDHSLSYVSKKLNYQIE---NFKDQGINQNFTVDENLQLIKSEMTNLLSTARD 1965
             K   +L +      S  L+++ E   N K    N      EN  LI S+++NL  T  D
Sbjct: 945  EKERDSLQEQLTELESANLSHETELKNNIKQMTENNVTLTTENKGLI-SKISNLELTI-D 1002

Query: 1966 NFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFI 2145
            N +K       +F  D     +E+ +++++L            E L+++  E     + I
Sbjct: 1003 NLKKSNDAKSAQFSDDK----NELEESIMHLN-----------EQLNEIEAE-----KEI 1042

Query: 2146 TDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLS-- 2319
             +   N  +G  + + ++   N   +       ++ T  + +NE L  +K+ +I S +  
Sbjct: 1043 NERKVNDLEGQLNSVKSELTKNMDEI------TLLKTKLDTVNEDLTTSKQKLIESENEK 1096

Query: 2320 NVTTELMSNELDRLKPKLSKWEESA----ELINRSDALNNEFNDNVESSMTTMTDKIK 2481
               ++L+ N  + +    +K EES      L+ + D+L      N E S     D++K
Sbjct: 1097 RELSKLLENSKNAMIDSNNKLEESTLKYDTLLKKYDSLEKNGQAN-EKSFHDQVDELK 1153

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 102/495 (20%), Positives = 205/495 (41%), Gaps = 12/495 (2%)
 Frame = +1

Query: 1048 LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLT 1227
            +++  + DL G  N  +S  L +   E   +   L T+   + +   K +     + +L+
Sbjct: 1042 INERKVNDLEGQLNSVKS-ELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELS 1100

Query: 1228 RLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKN 1407
            +LL+     N+K A+I + +     LEE  STL+Y +  K   +  + G    K     +
Sbjct: 1101 KLLE-----NSKNAMIDSNNK----LEE--STLKYDTLLKKYDSLEKNGQANEK-----S 1144

Query: 1408 ITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLL 1587
               ++ ++K  L   + +         Y  L T ++  +  IQ  +  +ESL +      
Sbjct: 1145 FHDQVDELKLQLQEKELQ---------YTTLETSIEEKEKNIQSIQTQLESLAA------ 1189

Query: 1588 KDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIID 1767
                   E   +Q I     N S +++ +   R + +  +LD   +++ K+  +L K  +
Sbjct: 1190 -------EKERIQGI----ANTSSEEVVSLENRIKDLNEQLDSVRELYEKSKQELNKKNE 1238

Query: 1768 EMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNL 1947
            E ++  A    K+++ L  SL+      +  +E      + +N      L L K + T  
Sbjct: 1239 EHQSMLA----KYESDLADSLAKADTATSTNVELESQIKVMKN-----ELDLNKEKHTEA 1289

Query: 1948 LSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNY------YSQIAENLSD 2109
            L   +   +   +EC     SDT +  +E   +   LK L  ++        ++   L +
Sbjct: 1290 LEILKKEIKNIEEEC-ESTKSDTVVAKNEFAKSQKELKKLQESFSINEKKSEELQNELQE 1348

Query: 2110 LSEEYNNFKQF----ITDEFYNQEKGHQHEL-LNKYINNTQTVIESSSNDVMSTIQNLLN 2274
            L       K++    +      + K  + EL L+K     Q V E S   V+S ++++  
Sbjct: 1349 LQRSVQTMKEWEEAMVKKSTDLETKISKTELELSKEKKKLQNV-EESKRKVVSELESVKK 1407

Query: 2275 EHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINR-SDALNNEFNDNVES 2451
            E     K+L+         E++  + D LK K+  +E+  +L+N  S ++  E+++ + S
Sbjct: 1408 ESGEEKKKLV--------QEIIQIKAD-LKIKIHDFEKERKLLNEGSSSITQEYSEKI-S 1457

Query: 2452 SMTTMTDKIKQTNDS 2496
             +    D+ K  N+S
Sbjct: 1458 KLEERLDEAKFENES 1472

 Score = 40.8 bits (94), Expect = 0.023
 Identities = 118/621 (19%), Positives = 247/621 (39%), Gaps = 49/621 (7%)
 Frame = +1

Query: 778  MFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQV 957
            M +   +D A+  + AD   ST    ++    ++N  + +     E +++L+K +K    
Sbjct: 1243 MLAKYESDLADSLAKADTATSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIK---- 1298

Query: 958  ASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGS 1137
             + +    S++S T+     F + + E+ +L +   ++   SE +           E   
Sbjct: 1299 -NIEEECESTKSDTVVAKNEFAKSQKELKKLQESFSINEKKSEELQN---------ELQE 1348

Query: 1138 INQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 1317
            + +S+ T+     ++  K+  +       T++ +  L  + +   +  +  +K    +  
Sbjct: 1349 LQRSVQTMKEWEEAMVKKSTDLE------TKISKTELELSKEKKKLQNVEESK---RKVV 1399

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            S LE   K    + K  +   I     LK    +  K +  L      +G     Q Y E
Sbjct: 1400 SELESVKKESGEEKKKLVQEIIQIKADLKIKIHDFEKERKLL-----NEGSSSITQEYSE 1454

Query: 1498 LTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRI------KIQTMNESM 1659
              + L+     + E K   ES  ++   + K  +  N   E Q+I      +I T+ E++
Sbjct: 1455 KISKLEE---RLDEAKFENESKGAEVEKIKKASK--NSEMETQKIIEEKDTQITTLRETI 1509

Query: 1660 KKLYAKI-ERQQSIENELDGKIQIFTKTNSKL-------TKIIDEMKNREALVNSKFKTL 1815
                  + ER Q+I+N +  K Q  + +N  L       ++I +E+K+ +  +  K   L
Sbjct: 1510 TSKEKDLDERSQTIKNLISEKEQELSASNQNLEELKNQISEIKEELKSSKEEMAKKDMML 1569

Query: 1816 LDHSLSYVSKKLNYQIENFKDQGINQNFT------VDENLQLIKSEMT-NLLSTARDNFE 1974
            +D + +  S K + + +    + +N+          D++L + K E T N L     + +
Sbjct: 1570 IDLNKTLASLKGDVKDKVLAIEKLNETLASLKGNIKDKDLAIEKLEKTLNSLKDDIKDKD 1629

Query: 1975 KFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDE 2154
            +  ++   K  S+       I      L  L +   +Q+ +    L ++     + I   
Sbjct: 1630 QTIEDLKKKKASEESEFKITIEGKDKELTDLKNKLQTQLEKEKDSLKKQKEQDDKLIEKS 1689

Query: 2155 FYNQE----KGHQHELLNKYIN-------NTQTVIESSSNDVMST---IQNLLNEHLRAN 2292
               +E    K + +E L + +        N +T I      + ST   ++ L +EH    
Sbjct: 1690 SKLEEELRNKSNNYEDLKEQLEKCQMTKLNLETEIVQLKESISSTDADMKRLSSEHDEDK 1749

Query: 2293 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDAL------------NNEFN 2436
            ++  IN+L  V  E     + + +  ++K+EE+  ++ + + L             ++ N
Sbjct: 1750 EK--INTLEKV-IESQKTNMKKSQSTITKFEEA--ILQKDEELAAIKTKITEIENRDKNN 1804

Query: 2437 DNVESSMTTMTDKIK--QTND 2493
             NV   +   T+K+K  QTND
Sbjct: 1805 SNVIEQLKLETEKLKQEQTND 1825

>KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|P33420 Saccharomyces cerevisiae
            YPL174C NIP100 Large subunit of the dynactin complex
            which is involved in partitioning the mitotic spindle
            between mother and daughter cells putative ortholog of
            mammalian p150(glued)
          Length = 821

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 93/447 (20%), Positives = 196/447 (43%), Gaps = 45/447 (10%)
 Frame = +1

Query: 1273 IATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKN--ITTELTKIKSDLL 1446
            + TIS  +  L ET  TL+   +  +  +     + I++ +  +N  ++TEL  +KS+LL
Sbjct: 250  LRTISALESKLFETTKTLDELKQHFSANSN---SNNIIESLTTENHQLSTELDCLKSELL 306

Query: 1447 STKSKDGIYMDQQH-YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL 1623
              K       + +  YKE+ ++L +   ++QE   T ES+   NAL   +K   NE   L
Sbjct: 307  KLKQTQLADEELEALYKEVESELNSQIAKLQETLSTDESII--NALKENNKTLKNELQSL 364

Query: 1624 QRIK---IQTMNESMKKLYAKIERQQSIENEL----------------DGKIQIFTKTNS 1746
            Q       Q M+  +++L A++   Q   NEL                D K+++ ++   
Sbjct: 365  QNKSGQYSQEMSPEVEELQAELTSLQLRNNELQFQNEVSSAKLSHLKVDNKVELLSQI-- 422

Query: 1747 KLTKIIDEMKNREALVNSKFKTLL---------DHSLSYVSKKLNYQ--IENFKD-QGIN 1890
            K+  + D++ +++A+     + +L         D  ++Y+ +K+N    +E+ K+   I 
Sbjct: 423  KIIYLRDQLLSQDAVSICTSQLILFIYYAMIKYDAGVTYLKEKINLDLLLESVKNSHPIK 482

Query: 1891 QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVL------ 2052
               ++ EN  +  S+   +L TA    + F +  + + LSDT  L  E +   +      
Sbjct: 483  VQLSLLENADITLSD-PRVLFTA---IQMFLEASVERLLSDTEHLSKESDQQRIRSLYNT 538

Query: 2053 --NLKALTSNYYSQIAENLSDLSEEYNNFK---QFITDEFYNQEKGHQHELLNKYINNTQ 2217
               +    +    ++ E    L  + N F     F T     QEK ++  +  + I    
Sbjct: 539  FHTINTFVTTKLEELYEFNGTLKSDVNLFSIYVHFATSVLSLQEKPNELSVCLEEIKQIP 598

Query: 2218 TVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAE 2397
              +  +     S  +N++    +A  E++  ++S    +++ + + +++   SK+  + E
Sbjct: 599  VDMLENKERNTSVEKNVIQS--QAQVEVLQQTISE-KDQIIQDLILKIEVLESKYARNKE 655

Query: 2398 LINRSDALNNEFNDNVESSMTTMTDKI 2478
            +     +L NE  + V+S  +++ D++
Sbjct: 656  MEGSLSSLKNELLE-VKSRNSSLQDEL 681

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
            YNL225C
          Length = 1081

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 87/369 (23%), Positives = 154/369 (41%), Gaps = 27/369 (7%)
 Frame = +1

Query: 1459 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNEL---QR 1629
            K+ IY  + +Y EL  +L  ++T+++   + I+ L   NA L     T++E  E    ++
Sbjct: 267  KNDIYSLESNYDELHRELNEWETKVKTLNKDIQYLQGTNAQLSATNATLSEEKEALTKEK 326

Query: 1630 IKIQTMNESMKK-----------LYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMK 1776
              +   N+S+ K           L ++ E   S +  L  +I++  K N  +TK+     
Sbjct: 327  EILLNNNDSVTKSNNNLIAEKELLVSERELLISEKEALTKEIEVLLKNNDNITKL----- 381

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLST 1956
               +L+  K +TLL H    ++K  N  I    D  I +   +  N   + SE+  L+  
Sbjct: 382  -NNSLILEK-ETLL-HENEEITKAYNNLISERDDLLIKER-ELHHNNSTLSSEVGELIKK 437

Query: 1957 ARDNFEKFYQECIT--KFLSDTPLLFDEIN-----DNVLNLKALTSNYYSQIAENLSDLS 2115
              D   +  ++C T     S       E N       V     + S   + I  N  D++
Sbjct: 438  QTDLETELQEKCTTIKNMTSQVKYFLSEFNHFKKSSEVQETSNIESTDLNDIEVNDDDMT 497

Query: 2116 --EEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA 2289
              E  + FK+  T EF    K HQ E   +Y  +T +   + + +     Q +LNE L  
Sbjct: 498  VLEMQSLFKR--TLEFI---KNHQTEY--RYQISTLSTTIAQNMEKKDLEQKILNEKL-I 549

Query: 2290 NKELIINSLSNVTTELMSN--ELDRLKPKLSKWEESAELINRSDALN--NEFNDNVESSM 2457
            +K+  +    +  +  MS   EL+    +++K +ES       D LN  N+ N  ++   
Sbjct: 550  DKDNTLEEFKSRLSNYMSKLAELEARLDEINK-KESITTNKLIDELNIKNDLNIKIKELE 608

Query: 2458 TTMTDKIKQ 2484
              +T+K  Q
Sbjct: 609  KYVTEKQDQ 617

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 93/430 (21%), Positives = 180/430 (41%), Gaps = 45/430 (10%)
 Frame = +1

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            +T+    + K+++ K      I KD  L+   + L+   S L   +++    +D+ + KE
Sbjct: 528  TTIAQNMEKKDLEQKILNEKLIDKDNTLEEFKSRLSNYMSKLAELEAR----LDEINKKE 583

Query: 1498 LTT-----DLQNYKTE----IQECKRTIESLTSQNALLLKDKRTINEN--NELQRIKIQT 1644
              T     D  N K +    I+E ++ +     Q   L KD + +NE    ++ RIK   
Sbjct: 584  SITTNKLIDELNIKNDLNIKIKELEKYVTEKQDQIDSLSKDAKELNEKIVEKVARIKALE 643

Query: 1645 MN--------ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDE-------MKN 1779
             N        E+M++   ++E ++    EL  K+   +     L   ++E       +K+
Sbjct: 644  ANLDTSTNNYENMQQRVNELEDEEKYNIELSSKVAHLSSELEGLRNQLNEEKITATKLKS 703

Query: 1780 REALVNSKFKTLLDHSLSY----------VSKKLNYQIENFKDQGINQNFTVDENLQLI- 1926
             +   N KF  LL     +          + K    + +   D   N+  + DEN   I 
Sbjct: 704  EKETQNEKFTELLSFITGFEIFNLTIGALIMKAYKDKEKKLSDAKFNEYISNDENHSYII 763

Query: 1927 ---KSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAE 2097
                 E  + +   ++N  +  +E     L DT  +  E+   + +L + + +   +  E
Sbjct: 764  GFKNREDEHTMHELQNNLTESEKE--VSRLRDT--IDTELKTKINDLTSKSRDLEIETKE 819

Query: 2098 NLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQ-NLLN 2274
              +++ ++ N   + I +      K    +L+N+    TQ  I+ S+   ++T++ N+++
Sbjct: 820  LKTEIEKKNNRIDEGICE--IRDLKTQTTQLMNERKLLTQKNIDLSTE--LTTVKGNIID 875

Query: 2275 EHLRANKELIINSLSNVTTELMSNELDRLKPKLS-KWEESAEL---INRSDALNNEFNDN 2442
             H    +EL   SL+ ++T       D L+ +LS K EE  EL   I   + +NNE  D 
Sbjct: 876  NHEIKLQEL-AESLNKIST-----RSDSLQNQLSTKDEEIVELKKNITAIELINNEQKDK 929

Query: 2443 VESSMTTMTD 2472
             ES  T + +
Sbjct: 930  FESQTTVLNN 939

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
            complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 89/449 (19%), Positives = 188/449 (41%), Gaps = 67/449 (14%)
 Frame = +1

Query: 1351 IKNKPQLGSFIMKDILLKNITTELTKIK-SDLLSTK--SKDGIYMDQQH--------YKE 1497
            I+ K       M  I+  N+  +LT++K S L S+K   K+ +  +Q+         Y +
Sbjct: 792  IEEKLSTSVTFMNAIIKGNLIRQLTQMKLSKLNSSKLIGKNFVVYEQEMANNPWFRLYIK 851

Query: 1498 LTTDLQNYKTEIQECK--RTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM---- 1659
            L   L + +  +++ K    ++ L  +   L K+K  +   NEL+  +++ + E +    
Sbjct: 852  LLPLLNSSQDIVRQKKYSENVKRLEHKIDDLEKNKTELINTNELKNNELEQIRELLKVET 911

Query: 1660 KKLYAK---IERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 1830
            KKL  K   ++  ++ E EL  K++     N KL      +++  + +N K K + +   
Sbjct: 912  KKLEGKNQLLQTSKNAELELSEKLEKLKLINDKLEISKIAIEDENSRINDKIKIISEEIE 971

Query: 1831 SYVSKKLNYQIENFKDQGINQNFTVD-ENLQLIKSEMTNLLSTARDNFE----------K 1977
             Y+ +  N + +N       ++ T   E+L +   ++ N +    DN +          K
Sbjct: 972  KYLKENKNLKEDNGNLLKNVEDLTEQKESLSVDNQKLLNTVKDLEDNLKNKEINLRKEFK 1031

Query: 1978 FYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEF 2157
              +E ++  L    ++ +          A    +  +I ENLS L    ++  + +  + 
Sbjct: 1032 LEKEHLSSELESLQIIAESRKKEEEEYMAQNEKFKLEI-ENLSKLKNSQSDEIKILRSQI 1090

Query: 2158 YNQEKGHQHELLNKYINNTQTV-----IESSSNDVMSTIQNLLNEHLRANKEL------- 2301
               E     +L     N TQ +     + + ++++ S I +L NE L  NK++       
Sbjct: 1091 KTSEVTLDGKLEELEKNCTQALDRLSKLVNENSELRSQISSLKNEQLALNKQVKSREEDN 1150

Query: 2302 --IINSLSNVTTEL------MSNELDRLKPKLSKWEE-----------SAELINRSDALN 2424
              ++NS++N   ++       +NE+++ +  + K  E           +  L  + + L 
Sbjct: 1151 TKLLNSITNYENDIKKLTHDKTNEIEKSQTTIQKLSEVQRELETFKKSNHNLTEKYEDLK 1210

Query: 2425 NEFNDNV--ESSMTTMTDKI---KQTNDS 2496
            N FN     E  +++++D +   K  N+S
Sbjct: 1211 NNFNSRSVDEEKLSSLSDALIEQKAKNES 1239

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 91/423 (21%), Positives = 174/423 (41%), Gaps = 40/423 (9%)
 Frame = +1

Query: 1291 AKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGI 1470
            +K+ +E+  S +    K K I    ++  ++ ++  LK     L K   DL  T+ K+ +
Sbjct: 948  SKIAIEDENSRIN--DKIKIISE--EIEKYLKENKNLKEDNGNLLKNVEDL--TEQKESL 1001

Query: 1471 YMDQQHY----KELTTDLQN--------YKTEIQECKRTIESLTSQNALLLKDKRTINEN 1614
             +D Q      K+L  +L+N        +K E +     +ESL        K++      
Sbjct: 1002 SVDNQKLLNTVKDLEDNLKNKEINLRKEFKLEKEHLSSELESLQIIAESRKKEEEEYMAQ 1061

Query: 1615 NELQRIKIQTMNE--SMKKLYAKIERQQSIENE--LDGKIQIFTKT-------------- 1740
            NE  +++I+ +++  + +    KI R Q   +E  LDGK++   K               
Sbjct: 1062 NEKFKLEIENLSKLKNSQSDEIKILRSQIKTSEVTLDGKLEELEKNCTQALDRLSKLVNE 1121

Query: 1741 NSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQ-----IENFKDQGINQNFTV 1905
            NS+L   I  +KN +  +N + K+  + +   ++   NY+     + + K   I ++ T 
Sbjct: 1122 NSELRSQISSLKNEQLALNKQVKSREEDNTKLLNSITNYENDIKKLTHDKTNEIEKSQTT 1181

Query: 1906 DENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDT--PLLFDEINDNVLNLKALTSNY 2079
             + L  ++ E+     +  +  EK Y++    F S +        ++D ++  KA   + 
Sbjct: 1182 IQKLSEVQRELETFKKSNHNLTEK-YEDLKNNFNSRSVDEEKLSSLSDALIEQKAKNES- 1239

Query: 2080 YSQIAENLSDLSEEYNNFK-QFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMST 2256
               +A+ L  ++ E    K Q   D+     +    EL+ K        IE  +  V+ T
Sbjct: 1240 ---LAQKLLQVTNENLKIKEQKDRDQVVIVSETANIELMGK--------IEELNEKVVQT 1288

Query: 2257 IQNLLNEHLRANKELIINSLSNVTTELMSN--ELDRLKPKLSKWEESAELINRSDALNNE 2430
             + L  E     K+ +I  L    T+L S   EL     K+ K +E  +  N +  L+ E
Sbjct: 1289 SERLKAE--IEQKKNLIAKLRFTETKLASTMFELQHSAGKIKKMKEIIKNANITIDLDKE 1346

Query: 2431 FND 2439
              +
Sbjct: 1347 LGN 1349

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 53/302 (17%), Positives = 129/302 (42%)
 Frame = +1

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLY 1671
            KE++  L N KT+ +     I+ L ++ +LL+ +  T+N + +  R  + ++ E      
Sbjct: 1699 KEISMQLDNLKTDQKSLNENIDRLLNEKSLLISETETLNSSLQKTREDLDSVME------ 1752

Query: 1672 AKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL 1851
               ER + + N+    +    K   +  +  +++  +  L +++FK     S  Y  K  
Sbjct: 1753 ---ERSELLNNK--NHLGEALKLQQEQVRRNEDLIGKLELESAEFK-----SGYYEEKDK 1802

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFD 2031
            N  +       ++ N  + E ++ +++++ +  ++ ++ +    QE      S+T + ++
Sbjct: 1803 NISLIEENQSVLSSNNILKEKIKSLEAKLAD--TSDKEAWLSKIQEFEELVQSETEMKYE 1860

Query: 2032 EINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINN 2211
            E+  N             Q  E + +  +E+N+ KQ +T E  NQ++    E ++++   
Sbjct: 1861 EMKKN-------------QTLEKIIEELKEHND-KQTVTIENANQDRQQFEEEMHQFSER 1906

Query: 2212 TQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEES 2391
              T  +  +   +      LN+ +R N                 N+++ L+ ++  W++ 
Sbjct: 1907 ITTYEKQITKQKLD-----LNQMVREN-------------SYFENKVNELESEVDYWKKR 1948

Query: 2392 AE 2397
             E
Sbjct: 1949 FE 1950

>Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar to
            Ashbya gossypii ABL193C
          Length = 850

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 67/289 (23%), Positives = 134/289 (46%), Gaps = 25/289 (8%)
 Frame = +1

Query: 1396 LLKNITTELTKIKS------DLLSTKSKDGIYMDQQHY-----------KELTTDLQNYK 1524
            LL NI +EL  +K+      + L +K KD     + HY           KEL  D++ + 
Sbjct: 533  LLNNIKSELEPLKALNLKLKEELESKLKD----TKDHYVTKESNMKENIKELQEDVKVHL 588

Query: 1525 TEIQECKRTIESLTSQNALLLKDK-RTINENNELQRIKIQTMNESMKKLYAKIERQQSIE 1701
              I++ +  IESL    A L+K+K   +N+N EL + +I  + ES      +++R +S  
Sbjct: 589  ANIKKSQDVIESLHKDIAALIKEKEELLNKNAELSK-RISELQES------QLQRDRSTF 641

Query: 1702 NELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQ 1881
             +L  K Q   ++N +L     +++      NS ++  L+  +S     L  + +   D 
Sbjct: 642  LDLCEKNQDLLQSNHELITKSRDLEAELVAANSNYQE-LESKISEKDSLLKDKQQTISDL 700

Query: 1882 GINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIND-NVLNL 2058
             +N N  + +NL+ +K     ++S   ++ +K YQ    K  ++  L+ +++N  +++ L
Sbjct: 701  QLNLN-QLRKNLEKLKGNPAEMISF--ESAQKIYQNLDRKTYNN--LMVEQVNQLDLVEL 755

Query: 2059 KALTSNYYSQIAENLSDLSEE------YNNFKQFITDEFYNQEKGHQHE 2187
            + +  N    +    S LS++      Y  +++ +   F N+   H ++
Sbjct: 756  QNVVKNVILLLETPFSKLSKKMPLVSIYLRYEKSLCFHFANKLHYHVYQ 804

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
            similar to uniprot|P33420 Saccharomyces cerevisiae
            YPL174C NIP100 Large subunit of the dynactin complex
            which is involved in partitioning the mitotic spindle
            between mother and daughter cells putative ortholog of
            mammalian p150(glued)
          Length = 869

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 65/340 (19%), Positives = 151/340 (44%), Gaps = 16/340 (4%)
 Frame = +1

Query: 1291 AKVTLEETCSTLEYASKAKNIKNKP--QLGSFIMKDIL-LKN----ITTELTKIKSDLLS 1449
            +K +LE+  + LE++ +   I+N+   +    +  D+L LK     +  EL  +K +L+ 
Sbjct: 125  SKKSLEDRITELEHSVELATIENETLEEHNELLGHDLLSLKKRHEAVVEELEGVKEELIL 184

Query: 1450 TKSKDGIYMDQQHYKELTTDLQNYKTE--IQECKRTIESLTSQNALLLKDKRTINENNEL 1623
             +  +   + ++    +T   ++   E  + + + ++E+    N  L  +K  +   N+ 
Sbjct: 185  RRVIEDEELKKEDVDPVTLWKRSKLVEHALVKLQSSLEASRKVNKSLEGEKHEVEVENKK 244

Query: 1624 QRIKIQTMNESM---KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALV 1794
             + +I  +   +   KK+   +  Q + E   +  + + T+ N +LT+ I+E+K  +AL 
Sbjct: 245  LKSEIFELTNQLDDAKKIITDLTSQLAAEGSYNNIVDMLTEKNIQLTEEIEELK--QALE 302

Query: 1795 NSKFKTLLDHSLSYVSKKLNYQIENFKD---QGINQNFTVDENLQLIKSEMTNLLSTARD 1965
             +K K + D  L  + K++  ++ N  +   + +  +      LQ   +++ NLLS A  
Sbjct: 303  KTKDKQMFDEKLERMYKEVEEELSNEVEDLQRAMESHKYALNTLQNENAKLKNLLSHAET 362

Query: 1966 NFEKFYQECITKFLS-DTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQF 2142
              +    E   + LS +   L  +   N    + +  +   + +  L +LS +     + 
Sbjct: 363  IEKDNNSESQAQSLSIEISRLKFQNYQNTFEKEMMEKSLMYRGSVTLKELSAQLEYLSKK 422

Query: 2143 ITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQ 2262
            + D+  N+ KG       KY++    ++  +  D++  +Q
Sbjct: 423  VIDDSINEPKG------KKYLSQVTLMLLRAVTDILEELQ 456

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 120/617 (19%), Positives = 238/617 (38%), Gaps = 52/617 (8%)
 Frame = +1

Query: 787  SGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKY------ 948
            +  ++S N+ S    +   ++++     ++++  E  I T ++ + +++K  ++      
Sbjct: 1069 NAKDESVNRISELIQNSKNLEAELETCRHLKDGLEAKIETFEKALDVIKKSEQHLKEEKM 1128

Query: 949  ---RQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQR 1119
               ++V  TK      RS+     +L KE +  I  + K           I++ G  N+R
Sbjct: 1129 QLEKEVTDTKQQTEILRSNLK---SLEKEHEDSIALIEKYK------KHIIDKEGEYNER 1179

Query: 1120 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1299
            A E          L   INSL         +E +  RL  D L G+ K  +  T+     
Sbjct: 1180 ASE----------LNDEINSLQ--------QEKETIRLKSDKLEGDIKE-MKNTLGVQSN 1220

Query: 1300 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDG-IYM 1476
            + E     L    K    K++    + +     L++ TT++ +++ +    + K G +  
Sbjct: 1221 SKESEIRALNMQIKELEEKSQKNEANLLQSVKSLESETTKVRELQEECDLKRKKIGELEK 1280

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 1656
              +  ++  + +   + E +E KR +E+ T++    L+    +NE  E   I+   + ++
Sbjct: 1281 KIKASEDKNSQISELQKESEETKRELEAKTAEVKNQLEKISNLNELKEKSDIEFTRLKKT 1340

Query: 1657 -------MKKLYAKIERQQSIENE--------------------------LDGKIQIFTK 1737
                   M++   K++ +  I+N+                          L+ K+ I   
Sbjct: 1341 WSEDKKNMEEQLDKVKNEMQIKNQAFEKERKLLNEGSSTITQEYSEKINMLEDKLMILQN 1400

Query: 1738 TNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENL 1917
             N   TK ID ++N           LL+   + + K LN +I ++K++        + N 
Sbjct: 1401 ENESKTKQIDAVRNDLERATLSKDELLEEKRNEI-KILNDEILSYKEK------LSETNK 1453

Query: 1918 QLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAE 2097
             L+  E  N     + N E   ++  T  L ++    +E       LK +     +Q AE
Sbjct: 1454 GLLSKEREN-----KQNIESLREQLRT--LKESKTKVEE------GLKVIEQKSATQKAE 1500

Query: 2098 NLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN--KYINNTQTVIESSSNDVMSTIQNLL 2271
             L    E     +  I        K ++ EL +  K +  +   +E         I+NL 
Sbjct: 1501 -LEKSKETVKTLESTI--------KCNEKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQ 1551

Query: 2272 NE------HLRANKELIINSLSNVTTELMSN-ELDRLKPKLSKWEESAELINRSDALNNE 2430
            NE       ++ +K+ I      +  E  S  EL+ ++ +LSK  E   +  + DAL   
Sbjct: 1552 NEKSTLETQIKESKKEIEELERKLKIEAKSTTELETIEQQLSKANEKLNVNRKEDALLKS 1611

Query: 2431 FNDNVESSMTTMTDKIK 2481
               ++E  +     KIK
Sbjct: 1612 KLKDLERELKEKQVKIK 1628

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 71/350 (20%), Positives = 139/350 (39%), Gaps = 12/350 (3%)
 Frame = +1

Query: 1480 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 1659
            Q+  K L  D     TEI+     +    +++  L K+K  I+      R + Q+ +  +
Sbjct: 899  QKEVKLLKEDTVKKMTEIKILNENLIKTKTEHNNLSKEKENISRELTEYRSRFQSHDSLV 958

Query: 1660 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
             KL  K+   +S+ N+           N  L K ++E K+ + +  S  +  +D SLS  
Sbjct: 959  TKLTDKL---KSLANDYKN----MQSENESLIKAVEETKSEKTMQLSALQDEID-SLSRQ 1010

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             +    + E+  +Q I Q       ++  K E  +  ++++DN+E           S   
Sbjct: 1011 KENFLTERESL-EQSIKQLRETISAIEKAKEEAISRFNSSKDNYE-----------SQLG 1058

Query: 2020 LLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNK 2199
            LL +++ +N  N K  + N  S++ +N  +L  E    +             H  + L  
Sbjct: 1059 LLREQL-ENTRNAKDESVNRISELIQNSKNLEAELETCR-------------HLKDGLEA 1104

Query: 2200 YINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPK--- 2370
             I       E + + +  + Q+L  E ++  KE+   + +   TE++ + L  L+ +   
Sbjct: 1105 KIE----TFEKALDVIKKSEQHLKEEKMQLEKEV---TDTKQQTEILRSNLKSLEKEHED 1157

Query: 2371 ----LSKW-----EESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
                + K+     ++  E   R+  LN+E N   +   T      K   D
Sbjct: 1158 SIALIEKYKKHIIDKEGEYNERASELNDEINSLQQEKETIRLKSDKLEGD 1207

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 58/303 (19%), Positives = 124/303 (40%), Gaps = 18/303 (5%)
 Frame = +1

Query: 1300 TLEET--CSTLEYASKAKNIKNKPQLGSFIMKDIL--LKNITTELTKIKSDLLSTKSK-D 1464
            TLE T  C+  E  S  K +K   +      K     +KN+  E + +++ +  +K + +
Sbjct: 1510 TLESTIKCNEKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQNEKSTLETQIKESKKEIE 1569

Query: 1465 GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQT 1644
             +    +   + TT+L+  + ++ +    +     ++ALL    + +    + +++KI+ 
Sbjct: 1570 ELERKLKIEAKSTTELETIEQQLSKANEKLNVNRKEDALLKSKLKDLERELKEKQVKIKN 1629

Query: 1645 MNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH 1824
              E  + L +++   +++E ELD   Q       K  K  +E K     + ++ KT  D 
Sbjct: 1630 NIEEKELLTSQL---KTLEQELDNAQQ-------KTQKCEEESKIEVRKLQAE-KTESDE 1678

Query: 1825 SLSYVSKKLNYQI---ENFKDQGINQNFTVDE----------NLQLIKSEMTNLLSTARD 1965
             +  +  K N  +   EN+K      N T D            L+ +K+E + L    +D
Sbjct: 1679 RVVQLETKYNNLVAKEENWKKDEDAINKTTDSQKTEIEKLVIELEKLKTENSKLKEVNKD 1738

Query: 1966 NFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFI 2145
              E          + D  LL  ++++     ++   +   +I+ +  D  +E +   +  
Sbjct: 1739 RSE----------IDDLMLLVTDLDEKNTKYRSKLKDLGVEISSDEEDEEDEEDEEDEEE 1788

Query: 2146 TDE 2154
             DE
Sbjct: 1789 EDE 1791

>TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8.604
            YOR195W
          Length = 804

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 70/337 (20%), Positives = 153/337 (45%), Gaps = 7/337 (2%)
 Frame = +1

Query: 1405 NITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALL 1584
            N   ++ K K+D ++ K  + I        +L  +++NYK ++++    +++   +    
Sbjct: 306  NYQYQIIKNKNDTINKKFDNKIL-------QLNKEIENYKIKVEKLNNKLQTNKKRLLET 358

Query: 1585 LKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQI-----FTKTNSK 1749
              + + +N+N  + + K    +  + +L    + ++  + EL+ K+++      +KTN +
Sbjct: 359  RDEVKMLNQNQSILQEKFDKQSHEILELRNIDDSKEKYKFELENKLKVKDDENLSKTN-E 417

Query: 1750 LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK 1929
            +  + D+++  +  ++ K K L ++SL    ++LN  IE  KD  I +   ++E  Q   
Sbjct: 418  INLLTDDLQKLQEQLDLKLKELSNNSLKL--EELNDLIER-KDLEIKE---INEKYQ--- 468

Query: 1930 SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD 2109
                NL     D+  K  +E I K +     L  +  D        T     QI + L+ 
Sbjct: 469  -GTINLNEGKHDDLVKQVEELIMKRIELETQLDQQDKD--------TKEIIEQIKKELNK 519

Query: 2110 LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL--LNEHL 2283
            + E+ N+ K++   EF             K I+  Q  I + +++++   ++   +N++ 
Sbjct: 520  MEEDKNS-KEYQIIEF------------EKKIDELQGKINNQNDELLKLKESYDKINDNF 566

Query: 2284 RANKELIINSLSNVTTELMSNELDRLKPKLSKWEESA 2394
                  +I  L+    EL SNE++ LK K+S  E+++
Sbjct: 567  EIKNAEVI-QLNEEIKELRSNEIN-LKEKISNDEKNS 601

>KNAG0B06780 Chr2 complement(1338912..1340945) [2034 bp, 677 aa] {ON}
            Anc_4.364 YJR134C
          Length = 677

 Score = 52.4 bits (124), Expect = 5e-06
 Identities = 97/498 (19%), Positives = 201/498 (40%), Gaps = 26/498 (5%)
 Frame = +1

Query: 1066 VDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDS 1245
            +D  GS      G L++  +   +++Q    L R ++   D+ +     +++L + LQ +
Sbjct: 150  IDSLGSMLKRCRGELSETRRGTDALSQQNSQLQRKLDDSLDE-IKQYSGQTELVQRLQLA 208

Query: 1246 LGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT---T 1416
            L   T  A   ++      L+   S L+   + + +K+  +L   ++K+   + I    T
Sbjct: 209  LSEKTDEA--DSVRNESSRLQNELSKLQETLETEKVKSTHELN--LLKESSCEQINSLET 264

Query: 1417 ELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECK---RTIE-SLTSQNALL 1584
            +L +++  L +   +     D +  ++ +T     + +    K    +IE SL S+ A L
Sbjct: 265  KLEQLRIQLENVTLQGSAETDSKSNEDWSTQYAMLQEQFNSSKSNWNSIEFSLNSKLAKL 324

Query: 1585 LKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKII 1764
              +  ++ E N     +++   ES++ +  K+   +S        I    +  + L K  
Sbjct: 325  KSEMESLQEENSKLSTQLKQTKESLRDVQVKLGDTESERVVAQSTITKLRENVNALNKNC 384

Query: 1765 DEMKNREALVNSKFK--------TLLD-------HSLSYVSKK--LNYQIENFKDQGINQ 1893
            D++++  AL+  K+         T+L        HS+    +   L  ++EN     ++Q
Sbjct: 385  DDLRDDYALLQKKYALQRSQLEGTILQPAAKTTTHSMPPFEEDQDLLKKLENEWASSVSQ 444

Query: 1894 NFTVDE-NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALT 2070
            +      N +L+ S  T  LS  R   ++ +    +  +  TP+L D  N++  N     
Sbjct: 445  DVHESPINEELLMSTGTPDLS--RVETQELFMNNGSSSMPTTPVLTDSRNNSFFN----- 497

Query: 2071 SNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVM 2250
                      L D+ EE +  K           K     LLN   +  ++ +    N+  
Sbjct: 498  ---------GLGDIPEEASALKSL-------NNKKSSASLLNLAASRRKSSLTQMVNNGP 541

Query: 2251 STIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAE-LINRSDALNN 2427
            S    ++NE    +       ++      + +E+ RL+ +LS  +++ E L    DA N+
Sbjct: 542  SENNTVINETNAVSNAASAQQINTQLVSRLGSEVRRLESELSSLQQAYETLQEEKDASNS 601

Query: 2428 EFNDNVESSMTTMTDKIK 2481
            E    +E +  T   K+K
Sbjct: 602  EILKLMEENDETKKIKLK 619

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
            Anc_8.604 YOR195W
          Length = 732

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 84/446 (18%), Positives = 182/446 (40%), Gaps = 18/446 (4%)
 Frame = +1

Query: 1606 NENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNRE 1785
            +EN +  ++ I+ +N+   +L  ++  + S  NE+               K ID +   +
Sbjct: 213  DENYDFNKV-IELVNKRNNELNKEVYDKNSKINEISLNFDRLNNEYVNQKKEIDNLMTEK 271

Query: 1786 ALVNSKFKTL--LDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTA 1959
              + +K   +  +++ L   ++KL  ++  FK++ IN   T++ N  L+KS+  NL+S  
Sbjct: 272  NEIVTKLNEMQVVNNELVSKNEKLKVKVTEFKNE-IN---TLNANQSLLKSKYDNLIS-- 325

Query: 1960 RDNFEKFYQECITKFLSDTPLLFDEIND------NVLNLKALTSNYYSQIAENLSDLSEE 2121
             ++  K  +E +     +   L ++  +       + N K      ++QI E  S+L+  
Sbjct: 326  ENDALKKNKELLNNLSIENEKLINQGKNWETRFSELENEKDSADEKFAQIKEQFSELTSR 385

Query: 2122 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL 2301
              + +  IT+             LN+ ++  +   E+ ++D+++ + +L  E     K+L
Sbjct: 386  NESLENQITE-------------LNELLSVAKE--ENKNSDLLNEVNSLQEERKELQKKL 430

Query: 2302 IINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFND---NVESSMTTMTD 2472
                L         NE+  L+ K+S   E+   +          N    N+E+ +T +  
Sbjct: 431  EKIELDK------ENEVSILESKISALNETISSLQSCQKEIENLNSTKTNLENDLTALKS 484

Query: 2473 KIKQTNDSXXXXXXXXXEHFKTNDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEG 2652
            K ++ ND+            +T ++                           + E +K  
Sbjct: 485  KFEEVNDN---------SSIRTAEVTELNSQIESLRESNDQLQELNSKLDEEI-EILKSE 534

Query: 2653 YLVTNESMKKLNELDTSIRTVLKDIDYEKD-----IKETNSPLKPSHKHDYNHTIPLD-- 2811
             L  +E  KK++    SI+   K+++ E++     + +T   L+ S K  Y+    L   
Sbjct: 535  SLKQDEEYKKVSIELESIQLKNKNVEVERNDELESLHKTVDSLEKSLKGGYDEITQLKKV 594

Query: 2812 NDKKRSFLNNANDNEMQNQSKIPRLE 2889
            N++ +S L +   N  ++ S +  L+
Sbjct: 595  NEQLKSQLESFEQNTHEDHSAVETLK 620

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 82/343 (23%), Positives = 150/343 (43%), Gaps = 18/343 (5%)
 Frame = +1

Query: 1516 NYKTEIQECKRTIESLTSQNALLLK---DKRT-INE--------NNEL--QRIKIQTMNE 1653
            N + E  +  + IE +  +N  L K   DK + INE        NNE   Q+ +I  +  
Sbjct: 210  NGEDENYDFNKVIELVNKRNNELNKEVYDKNSKINEISLNFDRLNNEYVNQKKEIDNLMT 269

Query: 1654 SMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLS 1833
               ++  K+   Q + NEL  K +      ++    I+ +   ++L+ SK+  L+  + +
Sbjct: 270  EKNEIVTKLNEMQVVNNELVSKNEKLKVKVTEFKNEINTLNANQSLLKSKYDNLISENDA 329

Query: 1834 YVSKK---LNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKF 2004
                K    N  IEN  ++ INQ     +N +   SE+ N   +A + F +  +E  ++ 
Sbjct: 330  LKKNKELLNNLSIEN--EKLINQG----KNWETRFSELENEKDSADEKFAQI-KEQFSEL 382

Query: 2005 LSDTPLLFDEIND-NVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQ 2181
             S    L ++I + N L   A   N  S +   ++ L EE    ++ +  E    +K ++
Sbjct: 383  TSRNESLENQITELNELLSVAKEENKNSDLLNEVNSLQEERKELQKKL--EKIELDKENE 440

Query: 2182 HELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRL 2361
              +L   I        S+ N+ +S++Q+   E         I +L++  T L  N+L  L
Sbjct: 441  VSILESKI--------SALNETISSLQSCQKE---------IENLNSTKTNL-ENDLTAL 482

Query: 2362 KPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 2490
            K   SK+EE  +  +   A   E N  +E S+    D++++ N
Sbjct: 483  K---SKFEEVNDNSSIRTAEVTELNSQIE-SLRESNDQLQELN 521

>NDAI0J02550 Chr10 (629573..631012) [1440 bp, 479 aa] {ON} Anc_4.300
            YLR423C
          Length = 479

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 75/363 (20%), Positives = 153/363 (42%), Gaps = 39/363 (10%)
 Frame = +1

Query: 1378 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE 1557
            FI+ D L++ +T    +I   +      D + + + + K    + +  +   +  ++  +
Sbjct: 85   FILVD-LVEEMTLWQNRISKQIEKLDDLDNVLLFKGNEKNQEEEEEEEEPGSESVQKLGD 143

Query: 1558 SLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIE------RQQSIENELDGK 1719
             ++ +N  +LK++  + E   +QR +I+ +     K+Y K++      + + +E E   K
Sbjct: 144  YVSRENIFILKER--LQEIPTIQR-QIENIRSQYTKMYVKVKDNLIDSKLKDLEKEYQNK 200

Query: 1720 IQIFTKTNSKLTKIIDE-MKNREALVNSKFKTLLDHS------LSYVS--KKLNYQIENF 1872
            + I  K   +LT I  + +K+ E  +     +L DH        SYV+   KL+   +  
Sbjct: 201  LNIQDKQVFELTNISPQVLKSFEIELVDFLSSLTDHFDKCQLLESYVTGQNKLDTNPDGK 260

Query: 1873 KDQG---INQNFTVDENLQLIK--SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEI 2037
             D+    +  + TVDE  +  K  S   +L  +  D   +   E +TK  +D   +   +
Sbjct: 261  PDETRDRVGDDLTVDELEEKKKDISAPNDLSKSETDADYEMLLEIVTKDNNDLEFVLKTL 320

Query: 2038 NDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQ 2217
            N+ +    +  S+Y   ++E +    E +N  K+ I +    QE    + ++ K I++  
Sbjct: 321  NETIELGTSRLSSYKELLSEKIGMKDELHNQVKKLIEEVLKYQE----YLMIFKDISDLL 376

Query: 2218 TVIESSSNDVMSTI--------------QNLLNE-----HLRANKELIINSLSNVTTELM 2340
            T  +    D +  +              QNLL E      +R   E+I+N   N   +L 
Sbjct: 377  TTFKEGCMDDIRVVEDLCEFYTNFEKSYQNLLKEVERRKQVRNKMEIILNECDNKLQKLN 436

Query: 2341 SNE 2349
            S +
Sbjct: 437  SRD 439

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
            ZIP1Transverse filament protein of the synaptonemal
            complex; required for normal levels of meiotic
            recombination and pairing between homologous chromosome
            during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 85/499 (17%), Positives = 195/499 (39%), Gaps = 28/499 (5%)
 Frame = +1

Query: 1357 NKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQ 1536
            N   L +F     +  N+  EL K + D  + K K  +     +  ++   +  YK+ ++
Sbjct: 177  NDVLLEAFTNTQRICSNLKQELQKQQQD--NAKLKVRLQSYASNSDKINEKVGKYKSCLE 234

Query: 1537 ECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDG 1716
              +  I +LTS         + + +N++L + +I     S++ L   I      + E D 
Sbjct: 235  TLQERIATLTSHKNNQETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADA 294

Query: 1717 KIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENF----KDQG 1884
            ++    K    L + +D+   + +    K  +L+   +    +++   IENF    K   
Sbjct: 295  ELMKKGKEIEYLKRELDDCSGQLSEEKIKNSSLI-QEMGKNREEMIKSIENFFSEDKAHH 353

Query: 1885 INQNFTVDENL-QLIKSEMTNLLSTARDNFEKFYQECITKFLSDT-PLLFDEINDNVLNL 2058
            + Q    +E +  L + ++      A+D      +    +  S+T  +L  +  D   NL
Sbjct: 354  LLQFNKFEERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTETMLKQQYEDIKENL 413

Query: 2059 KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSS 2238
            +   S+   ++A+ +++LS         + +E        Q  L+++  N  Q +++ +S
Sbjct: 414  EQKMSSSKDEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDAS 473

Query: 2239 NDV--MSTIQNLLN----------------EHLRANKELIINSLSNVTTELMSNEL---D 2355
                  ++++NL+                 +HL + +  + +  + + + L + E    D
Sbjct: 474  QTAKNYASLENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYED 533

Query: 2356 RLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSXXXXXXXXXEHFK 2535
             +K   +K  E +++  +  +L  E N+N+ + +  + D++++ N+              
Sbjct: 534  LVKKLEAKNIEISQISGKEQSL-TEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKIS 592

Query: 2536 T-NDIAHXXXXXXXXXXXXXXXXXXXXXXXXRLHEFVKEGYLVTNESMKKLNELDTSIRT 2712
            + N+I                          + H    E +   NE ++KLN     ++ 
Sbjct: 593  SQNEIVKALVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKA 652

Query: 2713 VLKDIDYEKDIKETNSPLK 2769
                  +E +++E N  LK
Sbjct: 653  ------HELELEEQNRHLK 665

 Score = 35.4 bits (80), Expect = 0.93
 Identities = 50/216 (23%), Positives = 98/216 (45%), Gaps = 7/216 (3%)
 Frame = +1

Query: 1177 SLADKNVHVPFRESKLTRLLQ--DSLGGNTKTALIATISP----AKVTLEETCSTLEYAS 1338
            SL +KN ++     K+   L+  ++L   TK+     IS      K  + E  +  +   
Sbjct: 554  SLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENKISSQNEIVKALVSENDTLKQRIQ 613

Query: 1339 KAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQN 1518
            +   IK   Q       +   KN   +L K+  +++  K+ + + +++Q+ + L   L+ 
Sbjct: 614  QLVEIKENEQKDHTTKLEAFQKN-NEQLQKLNVEVVQLKAHE-LELEEQN-RHLKNCLEK 670

Query: 1519 YKTEIQECKRTIESLTSQNALLLKDKRTIN-ENNELQRIKIQTMNESMKKLYAKIERQQS 1695
             +T ++E    +++L  Q  +L  +K+ I  E  ELQ   ++++ E  K L  K++ Q+ 
Sbjct: 671  KETGVEESLSDVKTLKQQVIVLKSEKQDITAEKLELQD-NLESLEEVTKNLQQKVQSQK- 728

Query: 1696 IENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSK 1803
               EL+ KI           K ++E+KN +    SK
Sbjct: 729  --RELEQKI-----------KELEEIKNHKRNEPSK 751

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 92/448 (20%), Positives = 180/448 (40%), Gaps = 35/448 (7%)
 Frame = +1

Query: 1255 NTKTALIATISPAKVTLEETCSTLE----YASKAK-NIKNKPQLGSFIMKDILLKNITTE 1419
            + KTAL +     ++ L +    L     YA+KA+ N + + Q  + + K I    +  E
Sbjct: 1008 SNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTI--SQLREE 1065

Query: 1420 LTKIKSDLLS-----TKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALL 1584
              K K+ + S     T+ K  +  ++  +       Q Y+T+     + IE L++QN LL
Sbjct: 1066 AQKHKNKVHSLEASITELKKSLEENESCW---AAQKQEYETQASLSSQRIEDLSTQNRLL 1122

Query: 1585 -----LKDKRTINENNELQ---RIKIQTMNESMKKLYAKIERQQSIENELDGKI----QI 1728
                 LKD  +I  N+EL+   R  I T+      L  K+E  +  E+ L  K+    Q 
Sbjct: 1123 FDQISLKDTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQE 1182

Query: 1729 FTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVD 1908
             +   S++ K       R  ++    K L   +   + ++ N  + N   +   +N  ++
Sbjct: 1183 LSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLE 1242

Query: 1909 ENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIN-------DNVLNLKAL 2067
             N++ ++  +  L     +N     Q  +        L+ +E+N       D +L  + +
Sbjct: 1243 RNVEELQEALKPL-----ENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297

Query: 2068 TSNYYSQIAENLSDL-SEEYNNFKQ--FITDEFYNQEKGHQHELLN-KYINNTQTVIESS 2235
                + ++AE LS   +E   N +Q   + D F   +K  +  L N +   NT     + 
Sbjct: 1298 DPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTE 1357

Query: 2236 SNDVMSTIQNLLNEHLRANKEL--IINSLSNVTTELMSNELDRLKPKLSKWEESAELINR 2409
            + +    +++ L++     + L   I +      E  S   D+L+  L K E++   IN 
Sbjct: 1358 ARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINE 1417

Query: 2410 SDALNNEFNDNVESSMTTMTDKIKQTND 2493
                 ++    +   +      +KQ  +
Sbjct: 1418 MSTAPSQEEQTLREELERTRQHVKQLEE 1445

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 93/402 (23%), Positives = 164/402 (40%), Gaps = 39/402 (9%)
 Frame = +1

Query: 1396 LLKNITTELTKIKSDLLST--KSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTS 1569
            LL     EL + KS+L+    K K    + ++  K   + L   K E +E  +    L  
Sbjct: 658  LLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNK--RGLVL 715

Query: 1570 QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK 1749
            +N L  +D RT    +EL   K Q     +  L A+++   + EN L+   Q   +TN +
Sbjct: 716  ENNLAKQDTRTQETISELIDCKSQ-----LATLSAELKNSIAKENLLNTSHQKLKETNEQ 770

Query: 1750 LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKK----LNYQIENFKDQGINQNFTVDENL 1917
            LTK  +E+            T+L   L  + K+    L    +NFK +  +    + +  
Sbjct: 771  LTKERNEL------------TILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLR 818

Query: 1918 QLIK---SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQ 2088
             L+    +E+++ +ST+ D+  ++YQE I            ++N     ++ L S   S 
Sbjct: 819  TLLSQKATELSDFMSTS-DSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQ-QSL 876

Query: 2089 IAENLSDL---SEEYNNFKQFITDEFYNQEKGHQHELLNKYIN----------------- 2208
            +   L D    S+ Y+   Q  TD+   Q    + EL    IN                 
Sbjct: 877  LTSKLRDAETKSQSYSVLNQ--TDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYAS 934

Query: 2209 ------NTQTVIESSSNDVMSTIQNLLNEH--LRANKELIINSLSNVTTEL--MSNELDR 2358
                     T +E S  D    ++ L  E   L  +  ++ + L+N+ +EL    N L+ 
Sbjct: 935  TKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLET 994

Query: 2359 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
            LK + +K EE  E+ +   AL +   D  +  ++ +T+ + Q
Sbjct: 995  LKHEHNKCEE--EVKSNKTALAS-MKDQYQLELSKLTEDLNQ 1033

>KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1301

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 121/626 (19%), Positives = 234/626 (37%), Gaps = 115/626 (18%)
 Frame = +1

Query: 943  KYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG---SENINRSGALN 1113
            ++ +  S K+ D   +   +      +  K + ++  K  L+D      SE I    + +
Sbjct: 404  RFEETESQKIKDQEEKLSKVIYSDTVQAQKLDYYKADKNKLLDEISNMESEIITSEYSED 463

Query: 1114 QRAKEAGSINQSLLTLGRVINS---------LADKNVHVPFRESKLTRLLQDSLGGNTKT 1266
               KE   + ++ L L     S         L +KN  +   E+ L  +       N + 
Sbjct: 464  DLEKEKKILAETTLKLEEWEKSDVIKQMGAQLKEKNEQILLAENDLEEIQDKIKKTNQQA 523

Query: 1267 ALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSF----------------IMKDIL 1398
             L A +   K ++ E    LE AS +    +K +  +                 + K I 
Sbjct: 524  DLFAKLGLLKKSIAEKSQALENASTSLENNSKAKSWNLMSNDDLDIDFKKIYINLQKQIA 583

Query: 1399 LKN------------ITTELTKIKSDLLSTKSKDG----------------------IYM 1476
            L N             +  LT +++DL++ +  +                       I  
Sbjct: 584  LSNRELHECEKKFTESSYNLTTLQNDLVTNQKTENDIKRNLENALPEDCPLGEYDKIIEE 643

Query: 1477 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA--LLLKDKRTINENNE-LQRIKIQT- 1644
             +  Y+    +L+ ++T +   ++ +E     N+  L L+   T+   NE LQ +K +T 
Sbjct: 644  AELSYRTALENLKMHQTTLDFNRKALEVAEYDNSCYLCLRSFDTVEFKNEILQNLKAKTE 703

Query: 1645 ------MNESMKKLYAKIERQQSIENELD---------GKIQIFTKTNSKLTKII----- 1764
                  + E +K+    ++  +S+E +            KI+I +K   +LT  +     
Sbjct: 704  AKFETALKEVVKEEKEFLDSLRSLEKDFTLLNSSWERINKIKIDSKKAQELTTSLREQLL 763

Query: 1765 ------DEMKNREALVNSKFKTLLD------HSLSYVSKKLNYQIENFKDQGINQN--FT 1902
                  +E+K  + LV  + +  ++        L  +  + +  +E  K  G +    FT
Sbjct: 764  TMETKNNELKEDQVLVEKELRAYVETIITLKKELKQLDAESSQILEQLKIYGSSDGEVFT 823

Query: 1903 VDENLQLIKSEMTNL---------LSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLN 2055
            VDE  QL K++  +L         L  AR+   + +   IT     T +  +E+  +++ 
Sbjct: 824  VDELQQLQKNKSDHLRGLRKAINELQMAREGKIRGHSALITTIKKKT-MAINEMERSLVR 882

Query: 2056 LKALTSNYYS------QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQ 2217
             +   +N  S      +I   L  L+ E +         F  QE  +     N  +++ +
Sbjct: 883  KQNTENNMKSKRNRIKEIESKLGQLTSEVDELHS--QRIFLEQETNNVKAEFNSKMSSKR 940

Query: 2218 TVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAE 2397
              +   +ND+ +T+ ++ NE  + ++ L    LS  T EL  +EL           E AE
Sbjct: 941  DTLNKINNDI-NTVSSIWNEITQYDESL----LSQCTRELERSEL-----------ELAE 984

Query: 2398 LINRSDALNNEFNDNVESSMTTMTDK 2475
            L  + D  NNE ND  +    +  +K
Sbjct: 985  LNQQIDFKNNELNDQKQKLKDSNNEK 1010

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 67/332 (20%), Positives = 145/332 (43%), Gaps = 38/332 (11%)
 Frame = +1

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 1788
            E+ ++ R + +    S+  L AK    Q     ++ K+   T+ + +L K   + +  E 
Sbjct: 210  EHLKVDRDRSKNTKRSLHNLEAKYAEYQEDVKAIEVKLNDITRRSDELFKSNQDFQ--EV 267

Query: 1789 LVNSK----FKTLLDHSLSYVSKKLNY------QIENFKDQGINQNFTVDENLQLIKSEM 1938
            L  S+     ++L  + +  +S  +N       ++++  D   N     +  +Q  + E+
Sbjct: 268  LSKSENLKTLESLTSNEIERLSSSINAINLGKSELQDLLDNFSNTLHEKELEVQRFEEEL 327

Query: 1939 TNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALT-------SNYYSQIAE 2097
              +   +++     +Q            L  E+N   LN   LT       + Y  +++ 
Sbjct: 328  FAMKDKSKE-----FQNNSNSLARRQGELEAELNKYALNKTRLTDLQSQMSTRYGFEVSV 382

Query: 2098 NLSDLSEEYNNFKQ-FITD-----EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTI 2259
              S+  ++  ++K+ F +D     E  +Q+   Q E L+K I +              T+
Sbjct: 383  EASNFIDQLKHYKEKFCSDLDRFEETESQKIKDQEEKLSKVIYS-------------DTV 429

Query: 2260 QNLLNEHLRANKELIINSLSNVTTELMSNE-----LDRLKP-------KLSKWEESAELI 2403
            Q    ++ +A+K  +++ +SN+ +E++++E     L++ K        KL +WE+S ++I
Sbjct: 430  QAQKLDYYKADKNKLLDEISNMESEIITSEYSEDDLEKEKKILAETTLKLEEWEKS-DVI 488

Query: 2404 NRSDALNNEFNDNV---ESSMTTMTDKIKQTN 2490
             +  A   E N+ +   E+ +  + DKIK+TN
Sbjct: 489  KQMGAQLKEKNEQILLAENDLEEIQDKIKKTN 520

>NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8.604
            YOR195W
          Length = 846

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 85/395 (21%), Positives = 162/395 (41%), Gaps = 51/395 (12%)
 Frame = +1

Query: 1399 LKNITTELTKIKSD------LLSTKSKD---GIYMDQQHYKELTTDLQNYKTEIQECKRT 1551
            L+NI  +  ++K D      +   K+KD    I        +L+T  +N KT+++ CK  
Sbjct: 341  LENIRYKYLEVKKDYSYVMEVFDEKTKDLKEQINQLSMERDDLSTRRENLKTKLKSCKDE 400

Query: 1552 IESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIF 1731
            +  L     +L     T+    ++ +   QT+     KL  +++ + +  N +  ++   
Sbjct: 401  LLMLNQNQTILQNKYDTVVNECDIWKNNYQTLELESTKLKDELKLKDTELNSISSQLNEI 460

Query: 1732 TKTNSKLTKIIDEMKNREALVNSKFKTLLD--HSLSYVSKKLNYQI-ENFKDQGINQ--- 1893
             +  S+L      +KN    +NS  K + +  HS      +LN  I E+ + Q IN+   
Sbjct: 461  DRHMSELGDENVRLKNENESLNSNLKIIEEKLHSKKSEVDQLNKTIEESLETQRINETSK 520

Query: 1894 NFTVD-ENLQLIKSEMTNLLS-----------------TARDNFEKFYQ----------E 1989
            N   + E L L K E+    +                 TA++N  K  Q          E
Sbjct: 521  NLKEEYETLLLEKEELEKKTNEQIEEHNRTIFELRNDITAKENEFKDLQDTKNEIQEQLE 580

Query: 1990 CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK------QFITD 2151
              TK L +  + ++++ND+  N+K       S++ E+L +L E     +      + + D
Sbjct: 581  TKTKELEELKIQYEDVNDDA-NIKGAE---VSELCEDLKELKESKTYLEGTISKLETVVD 636

Query: 2152 EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTT 2331
            E+  + +    EL  K +      ++  ++D+ +     L EHL  N   +   L + +T
Sbjct: 637  EWKTKYETQTTEL--KKVTVELESLQLRNSDIEAEHLKEL-EHLHVNMSSLQEMLKDHST 693

Query: 2332 EL--MSNELDRLKPKLSKWEESAELINRSDALNNE 2430
             +  +  E + LK  L   ++S  L + +   N E
Sbjct: 694  TITELQEENENLKKML---KDSKTLFHENKEENGE 725

>SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly
            similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component ortholog of human kendrin involved in
            connecting nuclear microtubules to SPB interacts with
            Tub4p-complex and calmodulin phosphorylated by Mps1p in
            cell cycle-dependent manner
          Length = 849

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 86/465 (18%), Positives = 188/465 (40%), Gaps = 38/465 (8%)
 Frame = +1

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI------------- 1353
            ESK +  +QD    N K+      S  ++  EE   T E  SK K++             
Sbjct: 191  ESKESEKMQDIEADNGKSD-----SERQLLEEELFQTKEKLSKLKDVVKALENKVMEIRQ 245

Query: 1354 -KNKPQLGSFIMKDIL---LKNITTELTKIKSDLLSTKSK-DGIYMDQQHYKELTTDLQN 1518
               + +  SF+  ++L   ++ +   ++  +S+L+ +K K   +  + Q +   +  L  
Sbjct: 246  ESKEREHQSFLKNELLQAKIRELEGSISDKESELVKSKKKVQRLVNELQEFDHQSGSLLE 305

Query: 1519 YKTEIQECKRTIESLTSQNALLLKDKRTINEN--------NELQRIKIQTMNESMKKLYA 1674
             + +I      I +L ++   L   K+++           N+L+    Q+ + + KKL  
Sbjct: 306  LEKQIDMKNEGIRNLETKLTQLAHSKQSLERELSAKTQQINDLREEHDQSRSNNNKKLEE 365

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKL- 1851
             ++   + +  L  K++   +  ++L    +E+  +   +N+K +   +H +  + +K+ 
Sbjct: 366  LVQTNSTGDTVLKAKLEALRQEKAQLENANEELLKKNGTLNTKIRD-GEHEIEMLKRKVQ 424

Query: 1852 ----NYQIENFKDQGINQNFTVD--ENLQLIKSEMTNL----LSTARDNFEKFYQECITK 2001
                 Y+ E    +GI    +    E L  ++ E+  L     S  R+N E+  Q+ + +
Sbjct: 425  ELSDEYEKEKHARKGILHRASTSNKEALGSLQDELEKLNDSKRSLEREN-ERLKQQIVNQ 483

Query: 2002 FLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQ 2181
              S +PLL +  N  +L            +   + D+ EE +++K+ I      QE   +
Sbjct: 484  -ASRSPLLKENANKKLLE----KEKEIRLLQSTIHDIEEEVSHYKRQI------QEAKRE 532

Query: 2182 HELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL-IINSLSNVTTELMSNELDR 2358
            H   ++ +   +  ++S   + +   + L  E      EL       N    L  N+ + 
Sbjct: 533  H---SREVAEFEIKLQSLETEPLIERRKLEKEISMLQLELQSAQETKNRELALWENKCEA 589

Query: 2359 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
            LK       E+ +L  + +  +N  N  +      + D +++ +D
Sbjct: 590  LK------RENQQLSKQEEGHSNNLNRIIAERQKDLNDLVQRCSD 628

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 85/369 (23%), Positives = 160/369 (43%), Gaps = 13/369 (3%)
 Frame = +1

Query: 1417 ELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDK 1596
            +L K+K D  S   K    M+Q+  KE+ TD        QE  +  E +   N   +K++
Sbjct: 180  KLLKVKQDFESYVQK----MEQE--KEVNTD--------QEKTKEPEVIPIDNPEYIKER 225

Query: 1597 RTINENNELQRIKIQTMNESMKKLYAKIE-RQQSIENELDGKIQIFTKTNSKLTKIIDEM 1773
              I E  EL+R+     N  ++  Y  +E +  SI+NELD K Q F  + ++L + I  +
Sbjct: 226  EHILE--ELERVTEDFKN--LRDRYNDLEIKFLSIQNELDEKKQEFESSTARLNEEIHTL 281

Query: 1774 KNREALVNSKFKTLLDHSLSYVSKKLNY---QIENFKDQGINQNFTVDENLQLIKSEMTN 1944
            K   + ++ K     D ++S   +KL     Q+ +  DQ  NQN    + L  +K     
Sbjct: 282  K---STIDDK-----DATISEFKRKLGNAEDQLASIDDQNGNQN---QKLLHDLKEREDA 330

Query: 1945 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 2124
            +     D  EK  +  I  +        +EI D    LK   S Y        +++ +E+
Sbjct: 331  IDGLKEDIIEK--ENAIVHYK-------EEIQDKQNQLKESESKY--------AEVQKEF 373

Query: 2125 NNFKQFI---TDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEH--LRA 2289
             +FK+ +   T EF + +K    +L    +   Q  +E    ++   I+ L  +H   ++
Sbjct: 374  EDFKRELKKQTFEFEDGKKSTSRQLQELSVEKIQ--LEKQVCNLRGQIEKLEQQHRLTQS 431

Query: 2290 NKELIINSLSNVTTELMSNELDRLKPKL----SKWEESAELINRSDALNNEFNDNVESSM 2457
              + +   L ++ ++L  NE  R + K+    S  E++ + +  ++    E +  +  + 
Sbjct: 432  ENDGLRTKLKHIESDL-KNEKSRTEVKIKDLTSDLEDARKNLGEANNTIKELHHEIIKNA 490

Query: 2458 TTMTDKIKQ 2484
            T   D++ +
Sbjct: 491  TKSKDQLSE 499

>TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {ON}
            Anc_2.16 YNL225C
          Length = 936

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 104/532 (19%), Positives = 203/532 (38%), Gaps = 34/532 (6%)
 Frame = +1

Query: 985  SRSHTIFTITL-FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1161
            ++ H I  IT  F EVKG +    K  L+D  G  N      L +         + +LT 
Sbjct: 198  TKEHNIIAITSQFNEVKGLLELSKKDRLLD--GEANAGMIKDLREEINRKSHSIKEMLTK 255

Query: 1162 GRVINSLADKN---VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 1332
               I   +++    +     + K  +L ++   G T+     T    K+  +E      Y
Sbjct: 256  SEEIEEKSEQQREKLRATIEDLK-EQLARERENGFTELRAADTDWQNKIEEKEVKLRASY 314

Query: 1333 ASKAKNIKNK-----PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK- 1494
             +     ++K      +  + + +   L+    +L+K   D      K     D+   + 
Sbjct: 315  DADKSQYEHKISMLQEEFNNKLREINALEKTIKDLSKELDDQFQALEKAKRTNDELESQC 374

Query: 1495 ELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 1674
             +T  LQ+ + + Q+ KR ++S  S        +  +   N     K+Q  N+ +++L  
Sbjct: 375  NVTKKLQDMEEQNQQLKRDLQSSKSS-------RNELQTENTGIMTKLQVANDHIRELEK 427

Query: 1675 KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNR-EALVNSKFKTLLDHS-----LSY 1836
             +E  +S +  L    ++  K   + +K+ ++ K+   AL  S  +T ++++     L+ 
Sbjct: 428  SLELAKSSQTTLRNDYELTMKQVEEASKLNEQRKSELGALKESNERTRVENNDLKEKLNE 487

Query: 1837 VSKK--------LNYQIENFKDQGINQNF-TVDENLQLIKSEMTNLLSTARDNFEKFYQE 1989
             SK         L  Q+E  K    ++   T  +  QL   + T  L  + +     Y  
Sbjct: 488  ASKTNDELKKDVLKVQMEKEKAAHNSEKLQTAIQQEQLDHEKTTKNLRKSEE-----YSS 542

Query: 1990 CITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQE 2169
             +TKF+ +  L    ++   + L +   N+     +    +       K  I   F+ + 
Sbjct: 543  NLTKFVENMTLF--NVHIGTVMLHSFGKNHQVTCIDPFFTIQN-----KDIIG--FHTKS 593

Query: 2170 KGHQHELLNKYINN----TQTVIESSSNDVMSTIQNLLNEHLRANK-----ELIINSLSN 2322
               +H+ L++ I++     Q ++    N     ++ L  E +   K     E+ +     
Sbjct: 594  HDQKHQELDRRIDSLTLKNQKLVSQIDNQWKVKVEALTQESITQKKVLDQLEIKVKEAEK 653

Query: 2323 VTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKI 2478
             + EL S +L   + K +  +E  +LI    ALNN  N    S      DKI
Sbjct: 654  KSKELESRQLQSQEEKATMLKEKNDLIREQAALNNTINVLKGSHFNKEQDKI 705

>TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5.296
            YDR285W
          Length = 950

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 68/312 (21%), Positives = 135/312 (43%), Gaps = 23/312 (7%)
 Frame = +1

Query: 1615 NELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALV 1794
            N+L+R KI      + KL  K    +++ NELDGK +IF +  +   +II E+K      
Sbjct: 250  NKLER-KISNYENDIGKLVQKFNNHKTLLNELDGKTRIFKEQKNLDQRIIIELKQN---- 304

Query: 1795 NSKFK-TLLDHSLSYVSKKLNY-QIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDN 1968
            N  FK  +L +   +   +++  +  ++K +  N+    ++ +  +K E+ +      + 
Sbjct: 305  NDNFKEKILYYKNEFSKLRISLSECNDWKKEMNNEINKKNKEILYLKKELDDFSGQLSE- 363

Query: 1969 FEKFYQECITKFLS----DTPLLFDE--------INDNVLNL-----KALTSNYYSQIAE 2097
             EK     + K LS    +T   FDE         +  ++ L     KAL   +   + +
Sbjct: 364  -EKIKNSSLIKELSQNRDETLKTFDENKIYLEESFSGKIIELEKNLEKALVEKFTKPLID 422

Query: 2098 NLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQ--TVIESSSNDVMSTIQNLL 2271
            N ++ S +YN   Q     ++ +     +  L K+I  T    +I  S+ + +  I+ + 
Sbjct: 423  NFNENSIKYNENFQRNFKTYHYKINIPFYFFLTKFILLTYKIKIIYRSNEEFVKIIEIVK 482

Query: 2272 NEHLRANKELIINSLSNVTTELMSNE--LDRLKPKLSKWEESAELINRSDALNNEFNDNV 2445
            +EHL+   E     +SN     + N+  +  +      +EES         L ++FN+  
Sbjct: 483  DEHLKQLNENNDTVISNFNVFKVENDVSISNIFSTFKNFEES---------LKSKFNEIE 533

Query: 2446 ESSMTTMTDKIK 2481
             +  + +++K K
Sbjct: 534  NNYTSILSEKTK 545

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 70/349 (20%), Positives = 141/349 (40%), Gaps = 18/349 (5%)
 Frame = +1

Query: 1492 KELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQR---IKIQTMNESMK 1662
            + L  D+Q Y   + +       L      L + + T  +   LQ    +    +N + +
Sbjct: 674  RSLLVDIQKYNHAVAKVNELELKLIEMQKKLKEQEETSQKTKSLQNELNLADHKLNIAQR 733

Query: 1663 KLYAK-----IERQQSIENELDGKIQ--IFTKTNSKLTKIIDEMKNREALVNSKFKTLLD 1821
            +L        I+R + +  EL G  +  +  K N+   +I  E   ++A   SK K    
Sbjct: 734  RLVENSAAQIIKRNKELHEELQGCEEQILVEKKNASALEIEIETTKKDAEEFSKDKNSKL 793

Query: 1822 HSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN-------LLSTARDNFEKF 1980
              L    +KLN  IE+ +++     + + +NLQL   ++ N       ++   + N  K 
Sbjct: 794  SKLKNEIEKLNKAIEDVENKS-ESLYDLYQNLQLETEQLANEIKSNKEMMEQTKANVGKL 852

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 2160
             +E   K   D+ L   E+N +++ ++       ++    L  + EE    +  +  +  
Sbjct: 853  EEE---KVSVDSHL--QELNTSLIEVQTRVKEERAR----LLGIDEELKELESLVKSK-- 901

Query: 2161 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 2340
             Q+   QHE+  K I N       +S ++ + I+ L++EH       ++  + N    + 
Sbjct: 902  -QDTKSQHEIDLKKITNETNSFRQNSTNLQANIEKLIDEHEWLQDMEVVKGIVNQYHGIN 960

Query: 2341 SNE-LDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 2484
              E  +R K    K+ E    +N +     E  +  E+++ TM   I++
Sbjct: 961  LQEYTERQKQLHEKFSEMKRKVNPNIMSMIENVEKKETALKTMIRTIEK 1009

>TPHA0C01970 Chr3 complement(445831..447459) [1629 bp, 542 aa] {ON}
            Anc_8.450 YDR229W
          Length = 542

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 108/519 (20%), Positives = 206/519 (39%), Gaps = 50/519 (9%)
 Frame = +1

Query: 1048 LSKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESK 1221
            +S +N  D+ G+ N   SG     +      S   S +T G  ++S++D    V  ++  
Sbjct: 62   VSSINDTDINGNSNKKESGFNPFTKFTSRFSSRRPSSVTSG--MSSISDLRTLVTKKDMD 119

Query: 1222 LTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN----------------- 1350
             T +  + L  N+K+     +  +  + E  CS LE  SK K                  
Sbjct: 120  NTAIEIEKLYKNSKSYSSKLVDISTESSELACS-LEAISKLKGCSDVSADKLLKASGLFH 178

Query: 1351 -IKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKT 1527
             + N  Q+ S I+ D+L +NI  ELT  K                +  K+LT + +N   
Sbjct: 179  LLANHEQIMSRIINDLLNENILQELTNFK----------------EENKKLTKEFKNNFM 222

Query: 1528 EIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQ---TMNESMKKLYAKIERQQSI 1698
            E+             ++L L++KR    N EL + KI+   T  +S+  L  ++++ +++
Sbjct: 223  EL------------SSSLKLQEKR----NAELSKKKIRNILTYRQSLNNLQFQLDQVETL 266

Query: 1699 ENE-LDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTL------LDHSLSYVSKKLNY 1857
            ++       ++   T + + K +      +  ++            LD+ LS  +   NY
Sbjct: 267  KHHYFQDCYKLVEDTCNNVLKNVASTTRAQVEISENIARKGWSGGGLDNLLSDSNDPFNY 326

Query: 1858 ----------QIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT--- 1998
                      QI+N  +Q  +Q+   +E L  +K  + + + TA +N +      +T   
Sbjct: 327  ESDEEDEEFQQIKN--NQETDQHINGEEELPTLKENIVSKIVTAENNGKIAVSPKVTTSD 384

Query: 1999 ----KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQ 2166
                K +++ P L    +  +      TS+  + I       S   N  K   T    +Q
Sbjct: 385  VNENKIVNENPELMSTPHKFI-----CTSDNANSITNENYITSPLKNETKDSDTKSESDQ 439

Query: 2167 EKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA-NKELIINSLSNVTTELM- 2340
                +HE ++   +N      S S  +M   +N   +H+++ +++   N +++V   L+ 
Sbjct: 440  MDNEEHEDVDSNFDN------SFSLPIMPPSRNTNPDHIKSLSRQEQNNGITSVEKLLLP 493

Query: 2341 -SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESS 2454
             +N L  +  +  K E   EL N  D     F + +E S
Sbjct: 494  GTNILSDMHTEFEKHERKPELENEQD-----FGNTMEES 527

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 95/418 (22%), Positives = 173/418 (41%), Gaps = 25/418 (5%)
 Frame = +1

Query: 1318 STLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKE 1497
            S+LE  +K ++IK++ +L +   K    +    EL + +SDL            Q  Y  
Sbjct: 421  SSLEETAKERDIKDR-ELTNLQKKISNNEQFNDELLRQRSDLAH----------QVQYLL 469

Query: 1498 LTTDLQNYKTEIQEC--KRTIESLTSQN---ALLLKDKRTINENN--ELQRIKIQTMNES 1656
            L  D ++  TE +    K+ + +  ++N   +  +  KR ++  N  ELQ+  ++ +  +
Sbjct: 470  LCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTT 529

Query: 1657 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 1836
             ++L   +ERQ   E E    ++I T  N    KI++  K+    +    KTL +  ++ 
Sbjct: 530  -RQLVQTLERQ---EQEQQKTLRI-TDNN----KIVESAKSTSVDLEKHIKTL-ESKINI 579

Query: 1837 VSK-----KLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITK 2001
            +S+     KL       +    N + +  +  +L K  +TN LS+ +    K  +E   K
Sbjct: 580  ISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENK 639

Query: 2002 F-------------LSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQF 2142
                          +    L FDE+ DN   LK       ++I     DL+E     K  
Sbjct: 640  IKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNL 699

Query: 2143 ITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSN 2322
            IT    N E+    EL         +V E   + +   I NL +++     +++  +LS 
Sbjct: 700  ITGGVNNLEQSKIIEL---------SVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSK 750

Query: 2323 VTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
                L+ N++ +L+  LS+     EL   +   N E     + + T    K++  NDS
Sbjct: 751  ---NLLDNKVLQLETSLSE----RELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDS 801

 Score = 37.4 bits (85), Expect = 0.26
 Identities = 92/455 (20%), Positives = 168/455 (36%), Gaps = 55/455 (12%)
 Frame = +1

Query: 1111 NQRAKEAGSINQSLLTLGRVINSLAD-KNVHVPFRESKLTRLLQDSLGGNTKTALIATIS 1287
            N       S+ Q  L   R+ N L+  K  HV     K+   L++ +    K+ L + + 
Sbjct: 599  NTSNNSISSLQQCELEKERLTNELSSMKQQHV-----KVLEELENKIKTLQKSQLTSKME 653

Query: 1288 PAKVTL------EETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITT----ELTKIKS 1437
              K  L      +      EY  K +N K K         ++  KN+ T     L + K 
Sbjct: 654  VEKHALNFDEMKDNNNLLKEYVDKLEN-KIKTLEQDLAENELFEKNLITGGVNNLEQSKI 712

Query: 1438 DLLSTKSKDGIYMDQQ--HYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD----KR 1599
              LS   +   ++D++  + K    +L++    +   K  +++   Q    L +    K 
Sbjct: 713  IELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKN 772

Query: 1600 TINENNELQRIKIQTMNESMKKL------------YAKIERQQS-----------IENEL 1710
            T  +N E +  K QT     KKL            Y  +E  Q+           ++ +L
Sbjct: 773  TQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDL 832

Query: 1711 DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN 1890
            D K +   K  +K TK+ +++K     + S + TL              Q  +F    ++
Sbjct: 833  DMKTESHLKLENKYTKVKNDLKQATYKLASVYTTL-------------EQKNSFLANSVS 879

Query: 1891 QNFTVDENLQLIKSEMT----NLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNL 2058
            Q    ++ L  +KS++      L     +N EK     +        LL   + +N    
Sbjct: 880  QLQGKEKELNELKSKLVEKTEKLQMAENENSEKINNAIV--------LLQTMVEENTTFK 931

Query: 2059 KALTSNYYSQIAENLSDLSEEYNNFKQ--FITDEFYNQEKGHQHELLNK-------YINN 2211
             A     +     +LS L +  N+ +Q   + +  YN E  H +E L +       +   
Sbjct: 932  DA-----FKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGK 986

Query: 2212 TQTVIESSSNDVMST--IQNLLNEHLRANKELIIN 2310
               ++ES    +++T  I +L+   +   K L +N
Sbjct: 987  VTEILESYDGKILNTAAIGHLVRSLIHEKKMLALN 1021

>Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR023W
            (REAL)
          Length = 1929

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 74/368 (20%), Positives = 154/368 (41%), Gaps = 41/368 (11%)
 Frame = +1

Query: 1399 LKNITTELTKIKSDLLSTKSK-DGIYMDQ-----------QHYKELTTDLQNYKTEIQEC 1542
            LK   + L+++K++  + +S+ DGI  ++           Q+ +     +Q  +  I E 
Sbjct: 913  LKKKESLLSRVKTNSETLQSQFDGIVTEKNEINKQKLQIIQNLERAEQTIQELQGIINER 972

Query: 1543 KRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI 1722
            +  + +L S+N  L++    +N +   ++     +NES  KL  +I + + + +  D +I
Sbjct: 973  ETALANLNSKNEQLMQQISDLNNDISKEQKSQSLINESRLKLETEIRKLKEVISSKDSEI 1032

Query: 1723 QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFT 1902
              F   N KL+   +++  +   +       +    S V++  + + +N           
Sbjct: 1033 NSF---NEKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVAENSDLRSKN----------- 1078

Query: 1903 VDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNV-------LNLK 2061
              ENLQ  K+ ++N L    +  +K  +E I     +  +   + +D V       + LK
Sbjct: 1079 --ENLQKEKAVLSNQLKNKENELQKM-REKIDNHQKELAIFSKQRDDAVSEHGKISVELK 1135

Query: 2062 ALTSNYYSQIAENLSDLSEEYNNFKQFITD----------EFYNQEKGHQHEL------- 2190
              T N  ++   N   + +EY+NF++ I +          E  N  K  + E        
Sbjct: 1136 E-TRNQLTEYKSNCQKIEDEYSNFQRQIKEKEQKKRTDLAESLNDNKIKELEARLAQEIS 1194

Query: 2191 LNKYINN--TQTVIESSSNDV---MSTIQNLLNEHLRANKELIINSLSNVTTELMSNELD 2355
            LN+Y+N   +  +I+S+S+     +S   + LN+     K   +       T  + NE++
Sbjct: 1195 LNQYLNKRISGPLIQSNSSPTGRSVSYADDSLNKEDVMKKYYDLQLAFTEVTRNLENEIE 1254

Query: 2356 RLKPKLSK 2379
              K  +S+
Sbjct: 1255 EKKNLISR 1262

 Score = 40.4 bits (93), Expect = 0.030
 Identities = 103/636 (16%), Positives = 248/636 (38%), Gaps = 65/636 (10%)
 Frame = +1

Query: 778  MFSSGNNDSANKFSPADND-KSTIQSDQTAGIYIQNLQEFHITTAKEG---IKLLQKGLK 945
            + SS +     KF+   N  K  +Q  ++   ++++  +  I   KE    +KL Q+ LK
Sbjct: 855  LISSNDMSRTKKFNEQINKLKDNLQEMESKKKFLEDRNQSTINELKETQELLKLEQENLK 914

Query: 946  YRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRS-------- 1101
             ++   +++   S         TL  +  G +   +++N   L   +N+ R+        
Sbjct: 915  KKESLLSRVKTNSE--------TLQSQFDGIVTEKNEINKQKLQIIQNLERAEQTIQELQ 966

Query: 1102 GALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIAT 1281
            G +N+R     ++N     L   +  ++D N  +   +   + + +  L   T+   +  
Sbjct: 967  GIINERETALANLNSKNEQL---MQQISDLNNDISKEQKSQSLINESRLKLETEIRKLKE 1023

Query: 1282 ISPAK----------------------VTLEETCSTL------------EYASKAKNI-K 1356
            +  +K                      VTLE+ C+              +  SK +N+ K
Sbjct: 1024 VISSKDSEINSFNEKLSSSEEDLDIKLVTLEKNCNIAMSRLQSLVAENSDLRSKNENLQK 1083

Query: 1357 NKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQ-----HYKELTTDLQNY 1521
             K  L +       LKN   EL K++  + + + +  I+  Q+      + +++ +L+  
Sbjct: 1084 EKAVLSN------QLKNKENELQKMREKIDNHQKELAIFSKQRDDAVSEHGKISVELKET 1137

Query: 1522 KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI-QTMNES-MKKLYAKIERQQS 1695
            + ++ E K   + +  + +     +R I E  + +R  + +++N++ +K+L A++ ++ S
Sbjct: 1138 RNQLTEYKSNCQKIEDEYSNF---QRQIKEKEQKKRTDLAESLNDNKIKELEARLAQEIS 1194

Query: 1696 IENELDGKI-----QIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQ 1860
            +   L+ +I     Q  +    +     D+  N+E ++   +   L  + + V++ L  +
Sbjct: 1195 LNQYLNKRISGPLIQSNSSPTGRSVSYADDSLNKEDVMKKYYDLQL--AFTEVTRNLENE 1252

Query: 1861 IENFKDQGINQNFTVDE------NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL 2022
            IE  K+      FT         + Q ++++M  L    +D               D  +
Sbjct: 1253 IEEKKNLISRLRFTETRLASSSFDDQKVRAQMKKLKKLVKD--------------MDPNI 1298

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
              D + +  L+  + + +  +++   +  L       +Q   +   + +  +    L+  
Sbjct: 1299 QLDSLLEEPLSRSSSSESGINKLMSEVDYLK------RQLDIEARAHYDAENVITALHDK 1352

Query: 2203 INNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKW 2382
                Q     SS+D+         E +++ ++ +        T L   ++ + +  +SK+
Sbjct: 1353 FRKIQGEGSLSSSDIYKLKFEASEERVKSLEDKLKTMPLRDRTNLPVGDIIKNRDSISKY 1412

Query: 2383 EESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 2490
            EE        +    E  +     ++ +T  ++Q+N
Sbjct: 1413 EEEIRYYKLENYKLQEILNESNGKLSKLTHDLRQSN 1448

>CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} similar to
            uniprot|P40957 Saccharomyces cerevisiae YGL086w MAD1
            spindle assembly checkpoint protein
          Length = 657

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 77/339 (22%), Positives = 149/339 (43%), Gaps = 11/339 (3%)
 Frame = +1

Query: 1513 QNYKTEIQECKRTIESL----TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKI 1680
            + YK+++     ++  L    TS  +LL K +  I + +E    +I+ + +++KK     
Sbjct: 128  EKYKSDVFHLDNSVNELKLELTSCRSLLKKYEEVIEQQSE----QIKEIKKTLKK----- 178

Query: 1681 ERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLD--HSLSY---VSK 1845
            + Q+  E E++   Q    TN   T+ I +  N  A  ++ + TL+   +S++Y    ++
Sbjct: 179  KEQELDEIEVNRLKQAHNATN---TEEIRQQTNENASFSNGYNTLMSMKNSVNYWKNENQ 235

Query: 1846 KLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLL 2025
            +LN ++  + D        + + LQ  + E+  L    + N E++      KFLS+    
Sbjct: 236  QLNQKLSEYSD--------IYQQLQEAQLEIMEL----KANLEEW-----NKFLSNKK-- 276

Query: 2026 FDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYI 2205
              + N N  ++      + SQ  E L+ ++EE    K+     +YN +      +LN  +
Sbjct: 277  -QQDNSNDYSIDHFIIEFESQRRE-LNMVTEELAEVKK----SYYNSK------ILNDEL 324

Query: 2206 NNTQTVIESSSNDVMSTIQNL--LNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSK 2379
               +  +    +D  + I NL  LN  L   K L+    S     L+ N++    P    
Sbjct: 325  ALERNQLLKLKDDYENNIINLEKLNHELEQQKVLLEEECS-----LLKNQI----PTKEN 375

Query: 2380 WEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
              +     NR+DA  +   DN +     +T+++K+ NDS
Sbjct: 376  LNQQIRSTNRNDAEYDSLLDNYKQETENLTNELKRLNDS 414

>NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696
            YIL144W
          Length = 711

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 90/405 (22%), Positives = 171/405 (42%), Gaps = 12/405 (2%)
 Frame = +1

Query: 1090 INRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTA 1269
            I +S  L    ++  ++N  L      IN++  K+   P   +KL R+  + +  N +  
Sbjct: 353  IEKSEQLKISKQKNDALNNDLTKFQNYINTMQFKSQEWP---NKLERMRNEIISKNKQI- 408

Query: 1270 LIATISPAKVTLEETCSTLEYASKAKN----IKNKPQLGSFIMKDILLKNITTELTKIKS 1437
                    KVT +E  S  +Y  K K     I+ K Q     +K   L  IT E+ K+ S
Sbjct: 409  --------KVTSDEIESLQKYLKKEKISMEIIEGKNQEKETFLKS--LDGITDEIDKLTS 458

Query: 1438 DLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQ---ECKRTIESLTSQNALLLKDKRTIN 1608
             + S K +         +K +   ++ Y T IQ   + +R   + TS +    K      
Sbjct: 459  SITSKKIESAAT-----FKNMINTIKQYDTIIQSIIDARRDKLNHTSIDGNTFKINLNPE 513

Query: 1609 ENNELQRIKIQ--TMNESMKKLYAK--IERQQSIENELDGKIQIFTKTNSKLTKIIDEMK 1776
              N+++    +  T++E+ K  + K  ++   SI   +   I +    NS++  II ++K
Sbjct: 514  LINDIESFNFEDLTIDENNKITHDKLFVDSDFSISRNIKDNILLL---NSEIQDIIRDLK 570

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLST 1956
                  NS+ +T ++        +L  QI    ++  +QN  ++E L  +KSE    L+ 
Sbjct: 571  AE----NSQLETTIN--------ELKAQI----NESTSQNEYLEEELAHLKSEFE--LTR 612

Query: 1957 ARDNFEKFYQEC-ITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNF 2133
             +D  +   Q+  I KF        +EI   +L    L     ++  E    ++E+  + 
Sbjct: 613  QKDESDLVSQKIEIEKFERKILDSKNEIESKLLKANRLVQATKTKHHEAQRSINEKRESL 672

Query: 2134 KQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL 2268
            ++ I +           E+   +  + Q++IES +NDV++ ++ L
Sbjct: 673  QRKIIEII---------EVATDFKFDIQSLIESKNNDVLAQLKEL 708

>Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OFF}
           [contig 185] FULL
          Length = 93

 Score = 45.8 bits (107), Expect = 2e-05
 Identities = 25/43 (58%), Positives = 27/43 (62%)
 Frame = -2

Query: 182 PISSDVFIATSFDPIISGTVTTTELLASISL*FLPRHLTATVI 54
           P+S  V I TS  P+ SGT TTTELLA  S    P H TATVI
Sbjct: 2   PVSPVVLIETSLVPVTSGTATTTELLAFTSFSLRPLHRTATVI 44

>NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {ON}
            Anc_4.364 YJR134C
          Length = 759

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 90/438 (20%), Positives = 181/438 (41%), Gaps = 24/438 (5%)
 Frame = +1

Query: 1213 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 1392
            E+  ++L        T ++L   I   +  +E+     E  SK    K   Q+ S + K 
Sbjct: 157  ENLKSQLKDSQTTTKTDSSLFKLIRDKEDIIEQLKKEGETLSK-NEFKKSNQVKS-LKKT 214

Query: 1393 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 1572
            IL  N+  E++ + + L      D +    + Y  + T L     +I    +  E L S 
Sbjct: 215  IL--NMEEEISDLHNQL--NDKSDELDSLNESYSNIQTVLTESNEKISRLLKDNEELVSL 270

Query: 1573 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 1752
             + L      +NE  E       T+N+   KL          ++ELD   +I  K    L
Sbjct: 271  QSELNVKNEKLNELTEELSTTSTTLNDEKLKL----------QDELDSIKEINNKHIMNL 320

Query: 1753 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN-----YQIENFKDQG--INQNF---- 1899
               I+E+K    L N+K  T  D S SY+    N       + N ++Q   I Q F    
Sbjct: 321  ESTIEELKIE--LENNK-DTTRDQSSSYLINNSNNDNSSTSLHNVRNQYELIQQQFNSSK 377

Query: 1900 ----TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPL--LFDEINDNVLNL- 2058
                +++ +L    +++  LL  ++D+ +K  ++     L ++ L    D+ ++ + NL 
Sbjct: 378  QNWESIEFSLNTKITDLNTLLKGSKDDIDKLEKKIDELKLENSQLNSQLDKDHEKISNLT 437

Query: 2059 --KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH-QHELLNKYINNTQTVIE 2229
              K   S+    + ++L DL E++      + ++ YN +K   Q  ++   I++    I+
Sbjct: 438  EEKKSLSSELESLNKSLHDLREDH-----ALLEKKYNIQKSQLQQNIVPSSISSRGNSID 492

Query: 2230 SSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAEL--- 2400
            +    + ST Q+ +N   +   ++++    N++    ++    +     +W  S  +   
Sbjct: 493  NFPATLDSTAQDKINS--KTKSDIVLPKRKNISLSSTTSNDAIISTFQKQWLNSGNIPYT 550

Query: 2401 INRSDALNNEFNDNVESS 2454
             N  + ++N+  D +++S
Sbjct: 551  NNAEENIDNQIGDVIQNS 568

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 73/357 (20%), Positives = 153/357 (42%), Gaps = 3/357 (0%)
 Frame = +1

Query: 1396 LLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQN 1575
            ++ N   E+T   SD+LST S     + Q+H     TD +N KT  +E     ++   Q 
Sbjct: 67   IVPNAGHEVTVPDSDILSTSS-----LSQKH----DTD-ENDKTFFEEKSLNADASQQQK 116

Query: 1576 ALLLKD--KRTINENNELQRIKIQTMNESMKKLYAKIERQ-QSIENELDGKIQIFTKTNS 1746
             L++ +  +  + +N E   I ++ ++  ++     I+++ ++++++L    Q  TKT+S
Sbjct: 117  ELVISEGMRSWLPDNYENLPI-LEVLSSYVQPKIGSIQKENENLKSQLKDS-QTTTKTDS 174

Query: 1747 KLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLI 1926
             L K+I   +++E ++    K     +LS    K + Q+++ K   +N    +       
Sbjct: 175  SLFKLI---RDKEDIIEQLKKE--GETLSKNEFKKSNQVKSLKKTILNMEEEI------- 222

Query: 1927 KSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLS 2106
             S++ N L+   D                     D +N++  N++ + +    +I+  L 
Sbjct: 223  -SDLHNQLNDKSDEL-------------------DSLNESYSNIQTVLTESNEKISRLLK 262

Query: 2107 DLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLR 2286
            D  E  +             E   ++E LN+      T   ++ ND    +Q+ L+    
Sbjct: 263  DNEELVS----------LQSELNVKNEKLNELTEELSTT-STTLNDEKLKLQDELDSIKE 311

Query: 2287 ANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSM 2457
             N + I+N         + + ++ LK +L   +++    + S  +NN  NDN  +S+
Sbjct: 312  INNKHIMN---------LESTIEELKIELENNKDTTRDQSSSYLINNSNNDNSSTSL 359

>Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195W
            (REAL)
          Length = 829

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 71/362 (19%), Positives = 154/362 (42%), Gaps = 24/362 (6%)
 Frame = +1

Query: 1390 DILLKNITTELTKIKSDLLSTKSKDGIYMDQQ---HYKELTTDLQNYKTEIQECK----- 1545
            +I+LK+  TEL  +K  L  T S    + D +      EL +   + + E+ +       
Sbjct: 483  NIVLKSKETELDNLKLSLKETLSISKDFNDSELVTQLNELISTKNSLQLELNDLNNLNSD 542

Query: 1546 --RTIES--LTSQNALLLKDKRTINENNELQRIKIQTMNES-----MKKLYAKIERQQSI 1698
              +T++   + ++N L LKD    + NNEL  +K Q  ++       +  Y  +E +  I
Sbjct: 543  NLKTLQDKLIENENTLRLKDAEMDSLNNELNELKKQIASKDDEFKIWQSKYENVEDEAKI 602

Query: 1699 EN----ELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH--SLSYVSKKLNYQ 1860
             N    EL+  I    ++N  L + I E++N+   + +++    ++    S   + L  +
Sbjct: 603  RNAEVTELNRDIDDLRESNLHLQETITELENKVHDLENEYDLEKENFEKTSLELESLQLK 662

Query: 1861 IENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEIN 2040
              N + + I +   + ENL  +++E+            KF  + I     +  +L ++ N
Sbjct: 663  NSNIQAEHIKELENLHENLMSLQNEL------------KFSSDRIATLTKENEILKEQNN 710

Query: 2041 DNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQT 2220
             N  N   L++N   +  E +  L ++  ++K     E Y  ++   ++ L     +   
Sbjct: 711  SN-NNSVTLSNNQKDKDDEQIKLLRKQLQDWK-----EKYEAKEKDTNKRLKLLAEDLYI 764

Query: 2221 VIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKL-SKWEESAE 2397
               S     +  ++       ++  + +     N+  + +S E+++LK +L S+ +E  +
Sbjct: 765  QYSSKHEQKVKLLKKGYENKFQSKFDQL-----NLENKSLSEEIEQLKKQLDSERKEKQD 819

Query: 2398 LI 2403
            L+
Sbjct: 820  LL 821

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 63/311 (20%), Positives = 125/311 (40%), Gaps = 3/311 (0%)
 Frame = +1

Query: 1552 IESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIF 1731
            I++  S N  ++ D    N++  +   K+   NE    +  K E +  I++  +  +   
Sbjct: 204  IDTNISPNKFIMNDGVARNDSFNINTDKLNLENE----INEKQEEEDFIKSNSNNAVNTD 259

Query: 1732 TKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTV-D 1908
               N K  +  D   +    +   ++T +        + LNY        G +    V  
Sbjct: 260  NDDNDKEYEENDITNSHINRLTPLYETSV--------RDLNYNENERNHCGDDSKLDVRH 311

Query: 1909 ENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQ 2088
            +N Q++      L     D      Q+  T    +  + F     N  + + + S+  ++
Sbjct: 312  DNFQIVARRNEELT----DQIYHLNQKVNTLISQNESISFQYEKLNKNHQQLIDSS--NE 365

Query: 2089 IAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNL 2268
              E LS  +E  NN  +   ++F  + K    E+  K +N+ Q +++   +D ++ + NL
Sbjct: 366  KVEKLS--TERENNISK--VEKFKKRIKELNTEI--KVLNSNQKILQEKYDDSITDLNNL 419

Query: 2269 LNEHLRANKELIIN--SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDN 2442
             +EH      L IN  +L+    EL  N  + L+  + K  E   ++N  ++   E ND 
Sbjct: 420  RSEHENTVNTLHINEKNLNEKNVEL-ENVKEELRTNVDKLSEYQAMVNELNSCITELNDK 478

Query: 2443 VESSMTTMTDK 2475
            +ES+   +  K
Sbjct: 479  IESTNIVLKSK 489

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 80/389 (20%), Positives = 169/389 (43%), Gaps = 22/389 (5%)
 Frame = +1

Query: 1396 LLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQ----ECKRTIESL 1563
            ++KN  TE  K  + +    S+     D +  K LT DLQ  K +      E +R +  L
Sbjct: 337  VIKNFNTENYKHDNQVKDFISQIEELHDDK--KSLTRDLQISKEKFNKYRGEMERKVFEL 394

Query: 1564 TSQNALLLKDKRTINENNELQRIK---------IQTMNESMKKLYAKIERQQS-IENELD 1713
             + N     ++ T N+  +L +IK         +Q+ N S+ K  A+++ ++S ++++L 
Sbjct: 395  KTSN-----ERTTENDAEQLDQIKKLYEDRVNKLQSKNNSLLKEIAQLQTKESNVKSKLS 449

Query: 1714 GKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQ 1893
                 ++K   +LTK  +E K+RE L   +        L+ V KKL  + E+  ++  ++
Sbjct: 450  ELETKYSKNTKQLTKDRNEAKDRELLAKMEELQKNGAELNKVEKKLQ-ETESENNKLNSE 508

Query: 1894 NFTVDENLQLIKSEMTNLLSTARDNFEKFY--------QECITKFLSDTPLLFDEINDNV 2049
             F   + +  +  E+  L     +  E+          +  + K L  +     E+++ +
Sbjct: 509  LFQKSQEISKLSKELDGLSGVNSELLEENKSLKTSVRDKIALKKELKKSQSEIKELHEKI 568

Query: 2050 LNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIE 2229
            ++  +  S    QI EN     EE    ++ I D  Y+Q+   + +     I + Q  ++
Sbjct: 569  ISSASKKSQEILQIIEN---KDEEIRKLERKIRD--YDQKFSKESD-----IKDLQNKLK 618

Query: 2230 SSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINR 2409
            ++ N+ ++ ++    E      EL  + L    ++++  + D L  K +K EE    + +
Sbjct: 619  ATENEKLTLLERHEKEVEEWRHEL--DKLQEDASQVVKLKED-LNDKSTKIEELHASLIK 675

Query: 2410 SDALNNEFNDNVESSMTTMTDKIKQTNDS 2496
                N++  ++++       +  K  N+S
Sbjct: 676  HQKENSKIRNDMQKLTAQYGELRKSMNES 704

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 81/380 (21%), Positives = 159/380 (41%), Gaps = 19/380 (5%)
 Frame = +1

Query: 1390 DILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKT--EIQECKRTIESL 1563
            +IL KN      K+  + L   +++ ++M +Q      T+L   KT  EI+ C+  I+ L
Sbjct: 872  EILEKNF-----KVAYNSLKEMNQEILHMKEQIP---ATELNISKTTIEIEYCENEIKQL 923

Query: 1564 TSQNALLLKDKRTIN--ENNELQRIKIQTMN-ESMKKLYAKIERQQSIENELDGKIQI-- 1728
             SQ    LK+K+ I+  E+N    IK+     +++KK Y  +  Q  +  +   K++   
Sbjct: 924  ISQ----LKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQI 979

Query: 1729 -------FTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
                       NSK+T +++++K    +VNSK K                          
Sbjct: 980  MDAGGIELKMQNSKVTSLVNQLK----IVNSKQK-------------------------- 1009

Query: 1888 NQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKAL 2067
            N    + +N  ++K ++ N L+T +DN  +F                     N+ N K  
Sbjct: 1010 NDKSAIKKNNNILK-KLQNELNTTKDNSLEF-------------------KTNLENSKKK 1049

Query: 2068 TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDV 2247
             +    ++A+  SD+++  N  ++ + +   N+EK  + E  ++   + +  I++  + +
Sbjct: 1050 VTLLSEELAKLESDINDTQNAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKL 1109

Query: 2248 MSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESA-----ELINRS 2412
                   L+ HL      +   L+ +T   +S  L+    +L K++ S      +  + S
Sbjct: 1110 KD-----LSHHLEKQIGKLDTELNALTIREISQNLESFDERLEKYDISKNGATEDTQHTS 1164

Query: 2413 DALNNEFNDNVESSMTTMTD 2472
             ALN+  N N ++     TD
Sbjct: 1165 SALNSVSNINTDTMDIDSTD 1184

 Score = 39.3 bits (90), Expect = 0.066
 Identities = 82/407 (20%), Positives = 157/407 (38%), Gaps = 30/407 (7%)
 Frame = +1

Query: 1150 LLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLE 1329
            L+  G V N    K       +  L   L+D +G +     I         L E C   E
Sbjct: 311  LILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKE 370

Query: 1330 YASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 1509
                  NI  K +      K+  LK +  E   + +   S K +  +Y+D    K+LT+ 
Sbjct: 371  ---NRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAK--SKKYQHQLYIDN---KKLTST 422

Query: 1510 L-------QNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKL 1668
            L       +NY  E+++     + L +     +   + +NE  + +   +    ++  +L
Sbjct: 423  LAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSEL 482

Query: 1669 YAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKK 1848
             +  E  ++IE + D   ++   T   +T+            N+K +TL +    Y    
Sbjct: 483  ISTQEMIKNIEKKKDNAEKLVNTTEKSITQ-----------TNNKLETLNNQQEDYTK-- 529

Query: 1849 LNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF-------------YQE 1989
               QIE            ++E L++ KS++  +  + +   E+F             YQ 
Sbjct: 530  ---QIEE-----------LNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQI 575

Query: 1990 CITKFLSDTPLLFDEI---NDNVLNLKALTSNYYSQIAE---NLSDLSEEYNNFKQFITD 2151
             + + +S   LL  EI   N+N  NL     +    I E   ++  +SE+   +KQ + +
Sbjct: 576  QLQEKMSQIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLE 635

Query: 2152 EFYNQEKGH-QHELLNKYINNTQTVIES---SSNDVMSTIQNLLNEH 2280
            +    E G  +     K I   +  ++S    +ND  +++ N+ N++
Sbjct: 636  QRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKN 682

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 75/372 (20%), Positives = 151/372 (40%), Gaps = 53/372 (14%)
 Frame = +1

Query: 1402 KNITTELTKIKSDLLSTKSKDGIYMDQQHYK-----ELTTDLQNY--------------- 1521
            K    ++ K+K+DL   +SK   ++++++ K     E T DL N                
Sbjct: 864  KKFNEQINKLKNDLQEMESKKK-FLEEKNQKTVNELENTQDLLNQEKENLRKNESLLNRV 922

Query: 1522 KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIE 1701
            KT  +  ++  + L S+   + ++K  + +N E    KIQ + E++++  A +E+  S  
Sbjct: 923  KTSSETLQKQFDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQETIREREATLEKLHSKN 982

Query: 1702 NELDGKIQIFTKTNSK-----------LTKIIDEMKNREALVNSKFKTL----------- 1815
            NEL  +I       SK             K+ +E+K  + ++NSK + +           
Sbjct: 983  NELIKQISDLNCDISKEQSSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFNDKLSSSE 1042

Query: 1816 --LDHSLSYVSKKLNYQIENFKDQGINQNFTV---DENLQLIKSEMTNLLSTARDNFEKF 1980
              LD  L  + K  N  +   +   + +N  +   +EN +  K+ + N L        K 
Sbjct: 1043 EDLDIKLVTLEKNCNIAMSRLQSL-VTENSDLRSKNENFKKEKAALNNQLKNKESELLKM 1101

Query: 1981 YQECITKFLSDTPLLFDEINDNVLNLKALTSN------YYSQIAENLSDLSEEYNNFKQF 2142
             +E I     +      + +D V     +T+         ++   N   + EEY+NF++ 
Sbjct: 1102 -KEKIDNHKKELATFSKQRDDAVSEHGKITAELKETRIQLTEYKSNYQKIKEEYSNFQR- 1159

Query: 2143 ITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSN 2322
               E   QE+  ++ L+    ++    +E+  +  +S +   LN+ +  N      S + 
Sbjct: 1160 ---ETKEQEQKKRNSLVESLNDSKIKELEARLSQEIS-LNQYLNKRISGNSVETNISSTR 1215

Query: 2323 VTTELMSNELDR 2358
             +T    + LD+
Sbjct: 1216 RSTSYSDDPLDK 1227

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 71/349 (20%), Positives = 133/349 (38%), Gaps = 27/349 (7%)
 Frame = +1

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHY--------KELTTDLQ---NYKTEIQECK 1545
            LK +      +  DL   K +     D+  Y        +EL   L+   N K E    K
Sbjct: 1555 LKRVQDVKKILSDDLAHLKERLSAVEDRSQYTDEINRLKEELNCSLKAETNLKKEFATLK 1614

Query: 1546 RTIESLTSQNAL----LLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELD 1713
              +E+ T+ +      LLK      +  E+   +   ++ + K+LY K E   +    L 
Sbjct: 1615 YKLETSTNDSEAKISDLLKQLDHYTKVVEMLNNEKDAISLAEKELYQKYEALNTECESLK 1674

Query: 1714 GKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQ 1893
            GKI   TK   +L   +++  +   + N+   +    +   +++K+ Y  E  + Q + Q
Sbjct: 1675 GKIVSLTKIKQELESDLNQKTDALQISNAALSSSTQKN-KEITEKIKYLEETLQLQ-MEQ 1732

Query: 1894 NFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTS 2073
            N     N +L+K+   +  +  +D F+   Q+ I  +         E N  +  L     
Sbjct: 1733 N---SRNGELVKTLQAS-CNGYKDKFDDEKQKNIDLY---------EENQTLQKLNTDLQ 1779

Query: 2074 NYYSQIAENLSDLSE---------EYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVI 2226
                 + E LSD +E         E  N     TD  Y + K  +++ L + +   QT  
Sbjct: 1780 LQLKNLHERLSDTTEKNAWLSKIHELENMVSLETDLKYEEMK--KNKSLERAVEELQT-- 1835

Query: 2227 ESSSNDVMSTIQNLLNEHLRANKELIIN---SLSNVTTELMSNELDRLK 2364
                N   + +  L N++    +E  +     +S++   +   EL+  K
Sbjct: 1836 ---KNSQQTDVIELANKNRSEFEEATLKYEAQISDLEKYISQQELEMKK 1881

>YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}
            SHE3Protein that acts as an adaptor between Myo4p and the
            She2p-mRNA complex; part of the mRNA localization
            machinery that restricts accumulation of certain proteins
            to the bud; also required for cortical ER inheritance
          Length = 425

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 63/280 (22%), Positives = 122/280 (43%), Gaps = 22/280 (7%)
 Frame = +1

Query: 1588 KDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIID 1767
            KD+ T ++N    R+ I+++++ +  L     +  +    L  K+++     SKL + ++
Sbjct: 31   KDRNTSSQNASSSRV-IESLHDQIDMLTKTNLQLTTQSQNLLSKLELAQSKESKLLENLN 89

Query: 1768 EMKNREALVNSKFKTL------LDHSLSYVSKKLNYQIENF--------KDQGINQNFTV 1905
             +KN    +NS F+        L+   S +S + N Q E              I Q  + 
Sbjct: 90   LLKNENENLNSIFERKNKKLKELEKDYSELSNRYNEQKEKMDQLSKLAKNSSAIEQ--SC 147

Query: 1906 DENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYS 2085
             E LQ ++    +LL  +++ +   Y + I+K      LL  E+++  LN  + TS+  S
Sbjct: 148  SEKLQNMEVNYNSLLE-SQNLYRDHYSDEISKLNEKIGLLELELSNQNLNYGSDTSS-NS 205

Query: 2086 QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQN 2265
             I  NL+  ++   + K   T++     K   H L    + +   + +++ N + +  + 
Sbjct: 206  DIELNLNKFNDSVKDLKSLETEKDSKLSKIITHSLDELNLQSWLNLYQTNENLISTFAEK 265

Query: 2266 L-LNEHLRANKELIINS-------LSNVTTELMSNELDRL 2361
            + L + L+ N E I N          NV T++ SN  D L
Sbjct: 266  MDLKDVLKRNDEKISNKGAVVQTLKKNVQTQVESNNADAL 305

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
            Ashbya gossypii AER241W
          Length = 854

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 78/395 (19%), Positives = 167/395 (42%), Gaps = 42/395 (10%)
 Frame = +1

Query: 1375 SFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD-QQHYKELTTDLQNYKTEIQECKRT 1551
            SFI K   L     ++ ++++ L       G  ++ ++   E    ++N ++++QE    
Sbjct: 269  SFISKQEALAQAEEKVNRLRNQLQEFDHNSGSLLELEKKIDEKNQGIRNLESKLQELNHQ 328

Query: 1552 IESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIF 1731
             ++L  Q  L   D    +  NE ++ K    N++  KL +  +   + EN+L  K++I 
Sbjct: 329  RQNLERQ--LQTSDGVVNSLKNEYEKYK----NDTENKLNSYQKSASADENKLREKMEIL 382

Query: 1732 TKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDE 1911
             K NSKL+K+ D ++      + K K   +  +  + ++    +   +D   +      +
Sbjct: 383  EKDNSKLSKMKDSLEQNNREFDVKLKK-AEKQIQTLERERERILSEQQDAIHDLRLEHQK 441

Query: 1912 NLQLIKSEMTNL--LSTARDNFEKFYQECITKFLSDTP---LLFDEI---NDNVLNLKAL 2067
             +Q +  E++NL  +++  +   + Y++   + +  +P      DE+   N  +  LKA 
Sbjct: 442  RVQSLHKEVSNLREMNSKLEGDNQSYKKRFEQLVKPSPHRKSTEDELIRKNREIGTLKAT 501

Query: 2068 TSNYYSQI---AENLSDLSEEYNNFKQFITDEF--YNQEKGHQHELLNKYI-------NN 2211
              +   +I      L  +  +Y   K  +  +    ++EK  +  LL K I       N+
Sbjct: 502  LRDLEDKIKYVEHELESVHSKYRREKALLEAKLAQADREKPLESNLLEKEISILKLELNS 561

Query: 2212 TQ-------TVIESSSNDVMSTIQNLLN-----------EHLRANKELIINSLSNVTTEL 2337
             Q        + E+    +  T +N+L            E  R   + ++   +++TTE 
Sbjct: 562  IQDTKEREIALWENKYESLKQTYENMLKQDRNNDFNNILEQRREELKSLMRRYNDLTTEN 621

Query: 2338 MS--NELDRLKPKLSKWEESAELI-NRSDALNNEF 2433
            +S   EL++ K     ++E  + + +R D +  EF
Sbjct: 622  LSLTKELNKQKSHKESYKEDLKKVQSRLDFITKEF 656

>TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {ON}
            Anc_4.46 YLR309C
          Length = 910

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 109/476 (22%), Positives = 184/476 (38%), Gaps = 63/476 (13%)
 Frame = +1

Query: 1255 NTKTALIAT-ISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKI 1431
            N KTA++   I           ST + +  A+    K   GS  +++ + K +T EL  +
Sbjct: 103  NDKTAMLNDEIKKLSALQSNNTSTKDASLNAEVSHEKHHTGSDALQNQIDK-LTEELEDL 161

Query: 1432 KSDLLSTKSKDGIYMDQ-----QHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDK 1596
            K +    K+      DQ     +  +E  T ++N KTE+ E  +  + LTS+        
Sbjct: 162  KKECEEHKTTVKTQRDQTSKLTKDLEEKDTIIENQKTELYEKSKKEDKLTSE-------- 213

Query: 1597 RTINENNELQRIKIQTMNESMKK-------LYAKIERQQSIENELD------------GK 1719
              + ENN    IKI +  ES+K        L  K+   ++ EN  +              
Sbjct: 214  --LKENN----IKIASYEESIKSKDMEINGLKRKLSDLENTENTKNNDNVSSPLNTEQAS 267

Query: 1720 IQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVS----------------KKL 1851
            I    ++NS   K     KN++   N K     +   S+V+                K L
Sbjct: 268  ISNVNESNSTNGKKKKNKKNKKKPANQK-----EEYTSFVAEEKSAPGSKDMDNEEYKSL 322

Query: 1852 NYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFY---QECITKFLSDTPL 2022
              +  +FK +G  Q   +    + +KSE   + S    N +K +   Q+ +TK  ++   
Sbjct: 323  LKEFNDFK-EGHKQCEDIKLKFEELKSENDKIQSETLPNLKKEHLSLQDELTKTKANLKG 381

Query: 2023 LFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKY 2202
              DE+ + V  +     N   +  + L  L E  NN     T      E   + E+L K 
Sbjct: 382  KTDEV-EEVREMLRDVGNELVEAKDELKKLQE--NNAGDSNTLRAELDEVHKEKEVLLKD 438

Query: 2203 INNTQTVIESSSNDVMSTIQNL------LNEHLRANKELIINSLSNVTTELMSNELDRLK 2364
              N +  +E+S       I +L      LNE   A+++ I  S SNVT   + N+ + L 
Sbjct: 439  FKNKEDELEASIKKYQDDITDLKKNISKLNEQRTAHEQAI--SQSNVTITKLKNDNNVLN 496

Query: 2365 PKL--------SKWEESAELINRSDA---LNNEFNDNVESSMTTMT--DKIKQTND 2493
             +L        S+ +    L+ +      L N+     E   +T T  D +K+ N+
Sbjct: 497  VQLKELAVLKKSENQLKTNLVQKEKTITYLENQIKKYTEDEKSTKTLFDSLKKENE 552

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 62/303 (20%), Positives = 119/303 (39%), Gaps = 6/303 (1%)
 Frame = +1

Query: 1606 NENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNRE 1785
            N ++E+ +     +N S+++    ++    +  E+  K++ F K   K   ++   KN E
Sbjct: 11   NISDEISKGLSDDLNSSVEQF---VDDNSGLPKEVQTKLRKFEKYEQKYPLLLQAYKN-E 66

Query: 1786 ALVNSKFKTLLDHSLSYVSKKL--NYQIENFKDQGINQNF--TVDENLQLIKSEMTNLLS 1953
             + + KF+         V K L  N  I +  D     +F   +++   ++  E+  L +
Sbjct: 67   KIKSEKFQD--------VEKVLMENTPISSIDDLDSLPSFFKNINDKTAMLNDEIKKLSA 118

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNF 2133
               +N              D  L  +  ++          N   ++ E L DL +E    
Sbjct: 119  LQSNNTST----------KDASLNAEVSHEKHHTGSDALQNQIDKLTEELEDLKKECEEH 168

Query: 2134 KQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVM--STIQNLLNEHLRANKELII 2307
            K  +      + +  Q   L K +    T+IE+   ++   S  ++ L   L+ N   I 
Sbjct: 169  KTTV------KTQRDQTSKLTKDLEEKDTIIENQKTELYEKSKKEDKLTSELKENNIKIA 222

Query: 2308 NSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQT 2487
            +   ++ ++ M  E++ LK KLS  E +          N + NDNV S + T    I   
Sbjct: 223  SYEESIKSKDM--EINGLKRKLSDLENTE---------NTKNNDNVSSPLNTEQASISNV 271

Query: 2488 NDS 2496
            N+S
Sbjct: 272  NES 274

 Score = 38.1 bits (87), Expect = 0.14
 Identities = 69/340 (20%), Positives = 137/340 (40%), Gaps = 16/340 (4%)
 Frame = +1

Query: 1006 TITLFKEVK--GEIFRLSKMNLVDLAG---SENINRSGALNQRAKEAGSINQSLLTLGRV 1170
            T TLF  +K   E  ++S  NL+       +   N S +     KE G +++ L  L   
Sbjct: 540  TKTLFDSLKKENEQLKVSSDNLIKQNNELKTSVTNSSASFENYIKENGKLSERLSVLQEK 599

Query: 1171 INSL------ADKNVHVPFRE-SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLE 1329
             +S+      ++  V +  R+  +LT  L+++   N           A +  ++T     
Sbjct: 600  YDSIQSLKSNSNDQVELIQRQCEELTFKLKEATKKNNINLEDEINEYANIIQDKTREAAT 659

Query: 1330 YASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 1509
                  + +N  +   F+     L+ +  E  KI+SD+    S+             + +
Sbjct: 660  MRRLLSDAQNNEE-SKFVDIKHKLERVLEEKNKIQSDMELQDSRT------------SRE 706

Query: 1510 LQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQ 1689
            +QN+K    E    I +L  +   LL +  TIN  N  + IKIQ  ++S      ++ER 
Sbjct: 707  IQNWKKASDELNTEIHALRLREKQLLSEIETINALN--KDIKIQHDHQSNDS--GELERV 762

Query: 1690 QSIENE----LDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNY 1857
             S   E     D K++   ++N +L  + +++  +   +   ++T+ +   +   +K+  
Sbjct: 763  TSNLKESLLKSDKKVRDLQESNDELMSLNNDLNKKLDRITKNYRTISNQLSTLKEEKVG- 821

Query: 1858 QIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK 1977
              E+ +    N + +V            N+L+T   + EK
Sbjct: 822  --ESNRTSRSNSSVSVSALNNNPPKANVNVLTTVPSSVEK 859

>KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} similar to
            uniprot|Q06704 Saccharomyces cerevisiae YLR309C IMH1
            Protein involved in vesicular transport mediates
            transport between an endosomal compartment and the Golgi
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 927

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 83/398 (20%), Positives = 167/398 (41%), Gaps = 76/398 (19%)
 Frame = +1

Query: 1414 TELTKIKSDLLSTKSKDGIYMD-----QQHYKELTTDLQNYKTE----IQECKRTIESLT 1566
            TE+  +KS L S +S++   +      Q   K+    LQ  K+E    + + + T+    
Sbjct: 430  TEMKHLKSQLESLRSQNSENIKSYETTQSELKQKVASLQKEKSETEKELDDLRTTLNKHM 489

Query: 1567 SQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNS 1746
             + + LL D +  +E   +   +  T+++ +K L A    + S+++ L  K     KT  
Sbjct: 490  QEKSKLLTDLKQSHEKMSILNNENITLSDQVKNLNALKRSESSLKSSLSQK----EKTIV 545

Query: 1747 KLTKIIDEMKNRE-----ALVNSKFKT-LLDHSLSYVSKK---LNYQIENFK---DQGIN 1890
             L + + E  ++E     AL  +K +   L + +S VSK+   L  ++E  K   ++ I 
Sbjct: 546  YLEQQVKEYSSKEEASSRALREAKMENGRLSNKISLVSKECESLKNELEKSKTSLEKFIK 605

Query: 1891 QNFTVDENLQLIKSE---MTNLLSTARDNFEKFYQEC------ITKFLSDTPLLFDEIND 2043
            +N  + E L+++  +   + ++ + + +  E   ++C      I +       L DE+N+
Sbjct: 606  ENGGLSERLEILNEKYETLQDMKTNSHEQVELIRRQCDELNVKIKELNKKNLSLEDELNE 665

Query: 2044 NVLNLKALTSNYYSQ---IAENLSD--------------LSEEYNNFK------------ 2136
            +V  L+  T    S    +AE  SD               SEE N  +            
Sbjct: 666  SVSALQERTQEASSMRRLLAERQSDKDFQVQKLEQSFAAASEEKNRLESELALHDAKTKR 725

Query: 2137 -----QFITDEFYNQ-------EKGHQHEL-----LNKYINNTQTVIESSSNDVMSTIQN 2265
                 + + D+   Q       EK ++ E+     LNK +  T+     SSN++   + N
Sbjct: 726  TINELKEVNDDLRVQVQTLIAKEKDYEQEVARLTSLNKEMQTTRNESSQSSNELKEALAN 785

Query: 2266 LLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSK 2379
            +    + + K+L     S+   + ++++L +   ++SK
Sbjct: 786  VKAALMTSEKKLREMESSSENIKELNDDLTKKLERISK 823

>NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {ON}
            Anc_7.21 YAL047C
          Length = 856

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 96/448 (21%), Positives = 175/448 (39%), Gaps = 47/448 (10%)
 Frame = +1

Query: 1342 AKNIKNKPQLGSFIM-KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY-KELTTDLQ 1515
            +KN +   +L   I  K+  L+N   ELTKIK++   T +    Y+       +   DL 
Sbjct: 347  SKNDEQVEKLKKIIKDKENQLENSNNELTKIKNEYSETLNYANEYLQHSEIISQSIDDLL 406

Query: 1516 NYKTEIQEC-------KRTI---------------ESLTS-----------QNALLLKDK 1596
            N   E  E        K T+                SLTS           ++A ++KD+
Sbjct: 407  NLIVENAEFLQIDDNEKNTLIKATQINSTFIMVKLNSLTSILKNLISNQLEKDASIVKDQ 466

Query: 1597 RTINEN-NELQRIKIQTMNESMKKLYAK--------IERQQSIENELDGKIQIFTKTNSK 1749
            +T N N N     K++   ES+ K Y K        +   Q+IEN L  K+       ++
Sbjct: 467  QTNNNNSNTTIDTKLEINIESLHKQYDKFLNGIKFKLSSSQAIENALYEKLSNQFNLLNQ 526

Query: 1750 LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQ-IENFKDQGINQNFTVDENLQLI 1926
            + + I E  N      S+    L+  L+ + KKLN + + N K   + +     EN Q +
Sbjct: 527  IQQYIQESNNDTGEKESQI-IQLEKELNLLEKKLNNEKVNNTKLMNLKE-----ENWQDL 580

Query: 1927 KSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLS 2106
              ++ N +            E +T    D   L DE++ N+ +L+    +  S + +   
Sbjct: 581  IGQLENDI------------EYLTSNKDDLTSLIDELSKNIEHLRFENDDISSLVKQLTE 628

Query: 2107 DLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLR 2286
            +   + N+F   + +        +  +L N   NN Q +IE+  ++   T +    E  +
Sbjct: 629  EKRNKDNDFSNLLVEL-------NDMKLQN---NNLQNIIENLHSNANITNEKNELEFDK 678

Query: 2287 ANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNE--FNDNVESSMT 2460
              + L+++   N   E+    L   K  + + ++  E I ++  L N       +ES   
Sbjct: 679  LKQHLLLH--LNKNFEIFERILQ--KKSIDQSKKKIEFITKNTGLKNVKLIQPKLESLYN 734

Query: 2461 TMTDKIKQTNDSXXXXXXXXXEHFKTND 2544
             +   +K   D+         +  ++ND
Sbjct: 735  FIETALKAITDAYITLLTQEKQEKRSND 762

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 35/219 (15%)
 Frame = +1

Query: 1942 NLLSTARDNFEK--FYQECITKFLSDTPLLFD----EINDNVLNLKALTSNYYSQIAENL 2103
            N+++T+  N ++  F Q+ +T +      L++    ++N N  +     +  Y  +  N+
Sbjct: 287  NVMATSSSNVKEIEFLQKQLTSYKLQQKTLYEVIIHQLNQNNTDSNNGGNKLYENLLSNI 346

Query: 2104 SDLSEEYNNFKQFITDEFYNQEKGHQHELL-------------NKYINNTQTVIESSSND 2244
            S   E+    K+ I D+  NQ +   +EL              N+Y+ +++ +I  S +D
Sbjct: 347  SKNDEQVEKLKKIIKDK-ENQLENSNNELTKIKNEYSETLNYANEYLQHSE-IISQSIDD 404

Query: 2245 VMSTI-------------QNLLNEHLRANKELI---INSLSNVTTELMSNELDRLKPKLS 2376
            +++ I             +N L +  + N   I   +NSL+++   L+SN+L        
Sbjct: 405  LLNLIVENAEFLQIDDNEKNTLIKATQINSTFIMVKLNSLTSILKNLISNQL-------- 456

Query: 2377 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND 2493
              E+ A ++      NN  N  +++ +    + + +  D
Sbjct: 457  --EKDASIVKDQQTNNNNSNTTIDTKLEINIESLHKQYD 493

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
            (REAL)
          Length = 877

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 80/412 (19%), Positives = 173/412 (41%), Gaps = 27/412 (6%)
 Frame = +1

Query: 1282 ISPAKVTLEETCSTLEYA-SKAKNIKNKP-QLGSFIMKDILLK----------NITTELT 1425
            ++ ++ TL++    LEYA +  K I + P    +    D+LL+          N+  EL 
Sbjct: 142  VNDSETTLKDN-KLLEYAITNGKPILHTPVDTSNTSSNDVLLEAFTNTQRICSNLKQELQ 200

Query: 1426 KIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI 1605
            K + D +  K++   Y+      ++   +  YKT ++  +  I +LTS         + +
Sbjct: 201  KQQQDNVKLKARLQSYVFDSG--KINEKVGKYKTWLETLQERITTLTSHKNNQDTKLKDL 258

Query: 1606 NENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMK--- 1776
             +N++L + +I     +++ L   I      + + D ++    K    L + +D+     
Sbjct: 259  RQNHQLNQRRISGFKTTIESLNGTINEVGKHKKDADTELLKRGKEIEYLKRELDDCSGQL 318

Query: 1777 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLI-KSEMTNLLS 1953
            + E + NS     +  +   ++KK+   +   K   + Q    +E L  + + ++     
Sbjct: 319  SEEKIKNSSLVQEIGKNREQLTKKMEDLLSEDKAYHLLQFTKFEEKLHTVFEEKLLEHFR 378

Query: 1954 TARDNFEKFYQECITKFLSDTPLLFDE----INDNVLNLKALTSNYYSQIAENLSDLSEE 2121
             A+D+F    +    +    T  +  +      +N+ +  +L+ N    IA+ L++L  +
Sbjct: 379  GAKDSFSIELKNNGVELSDHTETILKQQCELFKENLQDKMSLSEN---NIAKILTELGIK 435

Query: 2122 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMST--IQNLLNEH----L 2283
             N     + DE     +  Q  LL +  N  Q ++  SS     +  + NLL E+    +
Sbjct: 436  QNELAVKVQDELLTSSESIQTVLLAEMKNTKQDLLADSSQVAQKSLGLANLLKEYKAEIV 495

Query: 2284 RANK-ELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFN 2436
            ++N+ E  I  L +  + L S +   +    +K  +  +L+ + +A N E +
Sbjct: 496  QSNEYEERIKQLESERSTLSSQKNQIISSLGTKEAQYEDLLKKLEAKNIEIS 547

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 106/540 (19%), Positives = 216/540 (40%), Gaps = 9/540 (1%)
 Frame = +1

Query: 856  QTAGIYIQNLQEFHITTAKEGIKLLQK-GLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 1032
            Q   ++ +NLQ+    +     K+L + G+K  ++A    ++  + S +I T+ L  E+K
Sbjct: 405  QQCELFKENLQDKMSLSENNIAKILTELGIKQNELAVKVQDELLTSSESIQTV-LLAEMK 463

Query: 1033 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 1212
                  +K +L+                   ++  + Q  L L  ++     + V     
Sbjct: 464  N-----TKQDLL------------------ADSSQVAQKSLGLANLLKEYKAEIVQSNEY 500

Query: 1213 ESKLTRLLQD-SLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLG---SF 1380
            E ++ +L  + S   + K  +I+++   +   E+    LE    AKNI+     G   S 
Sbjct: 501  EERIKQLESERSTLSSQKNQIISSLGTKEAQYEDLLKKLE----AKNIEISQIFGKEQSL 556

Query: 1381 IMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIES 1560
            I K+  L N   EL K +  L    + +            TT   NY+ +I      +++
Sbjct: 557  IEKNESLSN---ELKKAQDQLDKITNLN------------TTTKSNYENKISSQNEIVKA 601

Query: 1561 LTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKT 1740
            LTS+N                      T+ + +++L   +E +++ + +   K++ F K 
Sbjct: 602  LTSEN---------------------DTLKQRIQQL---VEFKENAQKDHSTKLEAFQKN 637

Query: 1741 NSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQ 1920
            N +L K+     N E +     +  L+    Y+   L+      K+ G+ ++ +   +++
Sbjct: 638  NEQLQKL-----NVEVVQLKAHELELEEQCRYLKGCLDK-----KEIGVEESLS---DVK 684

Query: 1921 LIKSEMTNLLSTARD-NFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAE 2097
            ++K ++  L S  +D   EK                  E+ DN+ NL+ +T N   ++  
Sbjct: 685  ILKQQVIVLKSEKQDITAEKL-----------------ELQDNLENLEEVTKNLQQKVQL 727

Query: 2098 NLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNE 2277
               +L E+   F+           K H      K + + Q  I++S+  + S  +N    
Sbjct: 728  QRRELEEKTKQFELI---------KNH------KRVESKQRGIQNSTKPLGSPKKN---- 768

Query: 2278 HLRANKELIINSLSNV-TTELMSNELDRLKPKLSKWEESAELINRSDA--LNNEFNDNVE 2448
                  E I ++ S + ++      +D +  K +K E S E+   +D   L++  ND++E
Sbjct: 769  --DTRSEFIPDNSSKMDSSSTRPPRVDHI-GKSAKTEPSKEIPKYNDEFDLSSSSNDDLE 825

>NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {ON}
            Anc_8.704 YPL174C
          Length = 888

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 83/421 (19%), Positives = 178/421 (42%), Gaps = 50/421 (11%)
 Frame = +1

Query: 1303 LEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDL---LSTKSKDGIY 1473
            L++T   L    +  N++N+  L    +     K +  EL  ++ +L    S K ++   
Sbjct: 155  LQDTIELLTLNDEDLNLRNQEFLAKIQVLQEENKQLLNELQPLREELEMRRSIKFENTQK 214

Query: 1474 MDQQHYKELTTD---LQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQT 1644
             + ++Y+ L      LQN   E++  K   ESL     +L ++ + I++N+ LQ+     
Sbjct: 215  NEDKNYQSLLEQNKLLQNVLNELE--KSLTESLQDYELVLEENTKLISKNSCLQK----- 267

Query: 1645 MNESMKKLYAKIERQQSIENELDGK----------IQIFTKTNSKLTKIIDEMKNREALV 1794
               S+++L  ++E  ++I N+L  +          +   T+ N++L   ++ + +    +
Sbjct: 268  ---SVEQLTKELESSKTILNDLKRQLMAEKDSTNIVDFLTEQNNELLSQVNSLTHEIEKL 324

Query: 1795 NSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFE 1974
            +SK  T LD  L+  S KL  Q++  +    N   + +E +  +++ +  +    RD  +
Sbjct: 325  SSKENTTLDDHLNSES-KLQQQLDTLQ----NLLESKEERIHQLENVIKEIDVEGRDQEQ 379

Query: 1975 KFYQECITK-----------FLSDTPLL-FDEIND-NVLNLKALTSNYYSQIAENLSD-- 2109
            K  +  +TK              DT L+ F EI   N  +  AL  N       +++D  
Sbjct: 380  KHLKMQLTKLRIKISDLEQELFKDTILIKFHEITTVNKEDNLALLPNKLQYFLAHINDKE 439

Query: 2110 ----------------LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINN-TQTVIESSS 2238
                            L +E  + K+   D+ + +   H  ++ ++Y++   +  +   +
Sbjct: 440  LRDSIHQKKRIQCMLILLKELTSVKETFQDDLFREYVVHVSDICHRYLSEFAEGFVRDDT 499

Query: 2239 NDVMSTIQNLLNEHLRANKE--LIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRS 2412
             D+ + I+  LN     +K+  L++N    +   +  + LD      +  E  A+L+  S
Sbjct: 500  IDIETAIK-FLNSSSSVDKDPLLLLNIYREIFECISFDYLDSTLNSTNSEEIHAKLLRIS 558

Query: 2413 D 2415
            +
Sbjct: 559  E 559

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 78/363 (21%), Positives = 156/363 (42%), Gaps = 24/363 (6%)
 Frame = +1

Query: 1399 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA 1578
            L+N+  E  + K+   +  SK          K +   ++  + +++E +  +    SQN 
Sbjct: 124  LENVIKERDEFKTQYNTLLSKIS------SMKSIFNKMKESQKQLEEVQEQLTEYESQNL 177

Query: 1579 LLLKD-KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLT 1755
             L K  + T  EN+ELQ   I T+N+ +          +++E E +    IF +  SK+ 
Sbjct: 178  KLKKKLEATKIENSELQST-IVTINKEL----------ENLEKEQESAEDIFLEYESKIE 226

Query: 1756 KIIDEMKNREALVNSKFKTLL--DHSLSYVSKKLNYQIENFKDQGI---NQNFTVDENLQ 1920
             + DE +N     + + K        LS   ++L   +EN K       ++   + + L+
Sbjct: 227  ALQDEQRNMIETHSKELKASRKDKDQLSVQVQELMIILENLKQDKSDLKDERDDLKQALE 286

Query: 1921 LIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAEN 2100
            L +SE T L ++  D  E   +E ++K         +E  +  L +KAL S   +++  +
Sbjct: 287  LHESEKTALQNSVND-LELKIEELVSK-------REEESREKDLEVKALRSQLDTELEAH 338

Query: 2101 ------LSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQ 2262
                  L +L +E  + K+ ++ +   +E+  QH L    + +   ++       ++ ++
Sbjct: 339  NNDITILENLKKEIEDMKEDVSMKEKYEEESKQHVLQIGKLRHEAIILNEHLTKALAMLK 398

Query: 2263 NLLNEHLRANKELIINSLSNVTT------------ELMSNELDRLKPKLSKWEESAELIN 2406
               ++    +KELI N L +               EL+SN L+  + K    ++ A LI+
Sbjct: 399  K-SSDSESVDKELISNLLISFVAIPRADPRKFEVLELLSNFLNWDEDK----KQQAGLIS 453

Query: 2407 RSD 2415
             +D
Sbjct: 454  NND 456

>KAFR0B02340 Chr2 complement(456758..457867) [1110 bp, 369 aa] {ON}
            Anc_8.198 YER149C
          Length = 369

 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 63/222 (28%), Positives = 105/222 (47%), Gaps = 7/222 (3%)
 Frame = +1

Query: 1717 KIQIFTKTNSKLTKIIDEMKNR--EALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN 1890
            +++ FTK ++      D+M+N   E   ++ FK   +  +  + +  +Y + N    GI 
Sbjct: 140  RLKHFTKNHN------DDMENNSNEKDDSTSFK---NDQMEIIQEITSYLLSNSIKNGIE 190

Query: 1891 --QNFT-VDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK 2061
               N T VD+ L+ +KS + +LL  ++ N        I K  +DT    DEIN    +LK
Sbjct: 191  LKPNITDVDDPLKFLKSNIDSLLEVSKSN-------TIVKNHADTNNKVDEINTAFEDLK 243

Query: 2062 ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQ-HELLNKYINNTQTVIESSS 2238
             L  N+ ++  E+  D SE   + ++        QEK  Q H LL K  NNT     +S+
Sbjct: 244  -LAHNFLTKQYEH--DRSEHSKDVEKLNRTNKELQEKLLQYHSLLTKNENNTDNTRSTSN 300

Query: 2239 NDVMSTIQNLLNE-HLRANKELIINSLSNVTTELMSNELDRL 2361
            +D+ +  QN+LN   L ++     N   + +  +M NE  RL
Sbjct: 301  SDLWN--QNILNSPDLNSSNHTSPN--GSYSLSIMRNEFKRL 338

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
            YNL250W
          Length = 1306

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 97/462 (20%), Positives = 188/462 (40%), Gaps = 22/462 (4%)
 Frame = +1

Query: 1168 VINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 1347
            VI  L  KN+ +   E +L ++ +  L  N +T L A +   K ++EE   T+   +  +
Sbjct: 492  VIKLLKLKNMDILSAEEELEKIQEQILKTNQQTDLFAKLGLIKKSIEEKKGTV---TDLE 548

Query: 1348 NIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK--ELTTDLQNY 1521
                K  +   +   +  +++  E  K    L    +   I +  +  K  E+T  L + 
Sbjct: 549  ETLQKNDISQILPTPLNNEDLDLEFKKFYISLQKDIALSNIVLHDKENKLSEITFRLDSS 608

Query: 1522 KTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIE 1701
              +I+  K  I++LT +    L +   I+E +E+                A++  + ++E
Sbjct: 609  NADIERNKAEIQALTLRLDAELPEDCPIDEYDEV-------------VADAELSYKTALE 655

Query: 1702 NELDGKIQIFTKTNSKLTKIIDEMKNREA--LVNSKFKTLLDHS--LSYVSKKLNYQIEN 1869
            N     +++   T     K +D  +N++   L + KF+ +   S  L+ + KK +   E+
Sbjct: 656  N-----LKMHQTTLEFNRKALDIAQNKDCCYLCSRKFENVEVKSRLLAELKKKTDANFEH 710

Query: 1870 FKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF--YQECITKFLSDTPLLFDEIND 2043
                 +N+      NL+ ++ ++ + L   ++  +K    + C+ +  + T    +EI +
Sbjct: 711  TLVTAVNEEKEFLHNLRTMEKDIIS-LRNIKEQVKKLEELKPCLVEEHTSTKASLEEIEN 769

Query: 2044 NVLNLK---ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNT 2214
            +   LK    +      +  E + D S+E N     +  EF    K  Q E+ N      
Sbjct: 770  SNRKLKEKREVCEKTLRRTIEQIVDNSKELN----LLEAEFKGLSK--QLEMYNNSSGTL 823

Query: 2215 QTVIE-----SSSNDVM----STIQNLLNEHLRANKE--LIINSLSNVTTELMSNELDRL 2361
            QTV E        ND++      I +L  E  R  KE   +IN +   T  +   E    
Sbjct: 824  QTVDELRAEQKQKNDLLRKLRKDINDLQEERERKTKEHNSLINMVKEKTLSIREMESSVA 883

Query: 2362 KPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQT 2487
              K  + E SA+          E ND +E  + ++  +I++T
Sbjct: 884  SEKNIQREYSAK--------KTELND-IEHHIQSIKSEIEKT 916

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 70/348 (20%), Positives = 145/348 (41%), Gaps = 53/348 (15%)
 Frame = +1

Query: 1609 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 1788
            + ++  +IKIQ +   +++   +++  +S   ++ G+     K+N    +++ +++N + 
Sbjct: 217  DRSKTTKIKIQQLEAKIEQFRQQVKNIESQILDITGQSDRLFKSNQTFQEVLSKVENLKT 276

Query: 1789 --------------------LVNSKFKTLLDH---SLSYVSKKLN---YQIENFKDQGIN 1890
                                L   +  +LLD+   +L     KL+   Y+I   K+Q  N
Sbjct: 277  LKLATSNEIERLSATIELLDLPKDELSSLLDNFSLTLQQQESKLDQTQYEINQLKNQLQN 336

Query: 1891 QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT---KFLSDTPL-LFDEINDNVLNL 2058
                 D+   LI+ E    L++ R ++E+   + +T   +F    PL L  +     L L
Sbjct: 337  AYIEKDD---LIRKEAE--LTSKRHDYEQLKHDRLTLIEEFKQKFPLDLSSDYPTECLRL 391

Query: 2059 -----KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEK----GHQHELLNKYINN 2211
                 K L S+     AE  S L++  N+  + + +E    +K          L K I+ 
Sbjct: 392  LRDYKKTLESDAQMVKAEGESKLAKIENHVAEQVYEETVQNQKLEYCIRDKTDLKKRIDW 451

Query: 2212 TQTVIESS--SNDVMSTIQNLLN---------EHLRANKELI-INSLSNVTTELMSNELD 2355
             +T ++SS  S + +   +  L          E   A++E+I +  L N+       EL+
Sbjct: 452  LETELKSSDVSEETLEDEKKALTELNGQLANFEKGNASEEVIKLLKLKNMDILSAEEELE 511

Query: 2356 RLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD--KIKQTND 2493
            +++ ++ K  +  +L  +   +      ++E    T+TD  +  Q ND
Sbjct: 512  KIQEQILKTNQQTDLFAKLGLIKK----SIEEKKGTVTDLEETLQKND 555

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
            EDE1Endocytic protein; involved in a network of
            interactions with other endocytic proteins, binds
            membranes in a ubiquitin-dependent manner, may also bind
            ubiquitinated membrane-associated proteins; interacts
            with Cmk2 and functions upstream of CMK2 in regulating
            non-apoptotic cell death
          Length = 1381

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 89/454 (19%), Positives = 184/454 (40%), Gaps = 10/454 (2%)
 Frame = +1

Query: 1141 NQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTK----TALIATISPAKVTLE 1308
            NQ L   G     L++    +    +++  L + +   N K    T  +  ++  K +++
Sbjct: 586  NQDLFADGEASAQLSNATTEMANLSNQVNSLSKQASITNDKKSRATQELKRVTEMKNSIQ 645

Query: 1309 ETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH 1488
               + L  ++  +N+K   QL + +++      +  E   +   L    S+   +  +  
Sbjct: 646  IKLNNLR-STHDQNVKQTEQLEAQVLQ------VNKENETLAQQL--AVSEANYHAAESK 696

Query: 1489 YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKL 1668
              ELTTDLQ  +T+  E K  I +L S  A L   +  +NE  +  + +   ++ + K+L
Sbjct: 697  LNELTTDLQESQTKNAELKEQITNLNSMTASL---QSQLNEKQQQVKQERSMVDVNSKQL 753

Query: 1669 YAKIERQQSIENELDG---KIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 1839
                    +++ E+DG   KI ++     +L      ++ + A + +K++ L +      
Sbjct: 754  ELNQVTVANLQKEIDGLGEKISVYLTKQKELNDYQKTVEEQHAQLQAKYQDLSNKDTDLT 813

Query: 1840 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 2019
             ++   Q+E    Q   Q     +++  ++ EM + LS  + +FEK  QE   + +    
Sbjct: 814  DRE--KQLEERNRQIEEQENLYHQHVSKLQ-EMFDDLSQRKASFEKADQELKERNI---- 866

Query: 2020 LLFDEINDNVLNLKALTSNY-YSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 2196
                E  +NV  L     N    Q+ E+  D+  +  +     T E  ++   H+ + ++
Sbjct: 867  ----EYANNVRELSERQMNLAMGQLPEDAKDIIAKSASNTDTTTKEATSRGNVHE-DTVS 921

Query: 2197 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 2376
            K++   +T +E              N +L  N+   +      T    S+  DR  P L 
Sbjct: 922  KFV---ETTVE--------------NSNLNVNR---VKDDEEKTERTESDVFDRDVPTLG 961

Query: 2377 KW--EESAELINRSDALNNEFNDNVESSMTTMTD 2472
                 E+A   N + + N   N N+  +++   D
Sbjct: 962  SQSDSENANTNNGTQSGNETANPNLTETLSDRFD 995

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 68/328 (20%), Positives = 138/328 (42%), Gaps = 29/328 (8%)
 Frame = +1

Query: 1576 ALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLT 1755
            +L ++ K  +  +N++ R K    NE + KL   ++  +S +  L+ K +          
Sbjct: 845  SLFIRIKPLLISSNDMTRTK--KFNEQINKLKNDLQEMESKKKFLEEKNR---------- 892

Query: 1756 KIIDEMKNREALVNSKFKTL---------LDHSLSYVSKKLNYQIENFKDQGINQNFTVD 1908
            K IDE+K+   L+N + + L         +  S   + K+ N  +   KD+   Q   + 
Sbjct: 893  KTIDELKDTHELLNQEKENLKRNENLLNRIKTSSGTLQKQFNDLVSE-KDEINRQKLQIM 951

Query: 1909 ENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQ 2088
            + L+  +  + +L  T ++      +  + K       L  +I+D   ++    S+  S 
Sbjct: 952  QKLEESELTIHDLQETVKER-----ETTLEKLHIKNDQLIKQISDLNCDISKEQSSQ-SL 1005

Query: 2089 IAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQ-------TVIESSSNDV 2247
            I E+   L  E    K  I        K  + +  NK ++ ++         +E + N  
Sbjct: 1006 IKESKMKLENEIERLKNIIN------LKEEEIKTFNKKLSTSEEDLDIKLVTLEKNCNIA 1059

Query: 2248 MSTIQNLL---------NEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAEL 2400
            MS +Q+L+         NE+ +  KEL+ N L N       N+L+++K K+   ++   +
Sbjct: 1060 MSRLQSLVAENSDLRSKNENCKKEKELLNNQLKN-----KDNQLEKMKEKIDNHKKELAI 1114

Query: 2401 IN--RSDALN--NEFNDNVESSMTTMTD 2472
             +  R DA+N   +    ++ + T +T+
Sbjct: 1115 FSKQRDDAVNEYGKITTELKETRTQLTE 1142

 Score = 35.8 bits (81), Expect = 0.77
 Identities = 92/481 (19%), Positives = 182/481 (37%), Gaps = 12/481 (2%)
 Frame = +1

Query: 1024 EVKGEIF-------RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 1182
            E++GE F        +S   +  LA + N   + +   R ++   +NQ   T    +  +
Sbjct: 623  ELEGEKFSSTSIEANISNQEVKKLARTSNFKTTSS-RHREQQITLLNQLASTHPHFVRCI 681

Query: 1183 ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATIS-PAKVTLEETCSTLE--YASKAKNI 1353
               NV  P   ++   L Q    G  +   +A    P ++  +E     +  Y   + + 
Sbjct: 682  IPNNVKRPKEFNRKLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYKILYPENSNST 741

Query: 1354 KNKPQLGSFIMK--DILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKT 1527
                +L S I +  + LL ++  +    K        K G+  D +  K+   ++    T
Sbjct: 742  SFNSRLKSTIKQSCEFLLTSLQLDTNVYKIGNTKLFFKAGVLADLERQKDAKLNI--IMT 799

Query: 1528 EIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENE 1707
            E+    R   +  +  + L K K T    N  +       ++    L+ +I+      N+
Sbjct: 800  ELTATIRGCATRKATTSHLQKLKNTRVIGNTFRLYNQLVKDDPWFSLFIRIKPLLISSND 859

Query: 1708 LDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGI 1887
            +  + + F +  +KL   + EM++++  +  K +  +D  L    + LN + EN K    
Sbjct: 860  MT-RTKKFNEQINKLKNDLQEMESKKKFLEEKNRKTIDE-LKDTHELLNQEKENLKR--- 914

Query: 1888 NQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKAL 2067
                  +ENL        N + T+    +K + + +++         DEIN   L     
Sbjct: 915  ------NENL-------LNRIKTSSGTLQKQFNDLVSEK--------DEINRQKL----- 948

Query: 2068 TSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDV 2247
                  QI + L +     ++ ++ + +     EK H        I N Q + + S    
Sbjct: 949  ------QIMQKLEESELTIHDLQETVKERETTLEKLH--------IKNDQLIKQISD--- 991

Query: 2248 MSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNN 2427
                   LN  +  +KE    SL   +   + NE++RLK  ++  EE  +  N+  + + 
Sbjct: 992  -------LNCDI--SKEQSSQSLIKESKMKLENEIERLKNIINLKEEEIKTFNKKLSTSE 1042

Query: 2428 E 2430
            E
Sbjct: 1043 E 1043

>KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} similar to
            uniprot|P47166 Saccharomyces cerevisiae YJR134C SGM1
            Protein of unknown function required for wild- type
            growth rate on galactose and mannose localizes to COPI
            coated vesicles and the Golgi apparatus
          Length = 668

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 69/367 (18%), Positives = 157/367 (42%), Gaps = 24/367 (6%)
 Frame = +1

Query: 1468 IYMDQQHYKELTTDL---QNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 1638
            +Y   Q Y++ + D    Q++        R I+    +   LLK+  T+++    Q  KI
Sbjct: 104  LYPIVQKYQQNSIDSTAKQSHSNSDSSLIRLIKEKDEKIDSLLKEGETLSKKELQQSDKI 163

Query: 1639 QTMNESMKKLYA----KIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKF 1806
            + +N+++K L +    K++  Q ++ + D    +   TN+ L   + +M+N+   +N K+
Sbjct: 164  KKLNKTIKDLESDFSLKLDELQDVKTQAD----VLETTNASLMVSLKDMENQFGTLNKKY 219

Query: 1807 KTL---LDHSLS--YVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNF 1971
            + L    D  L+  Y SKK+  +      + + +N  ++  L  I+     +  T    +
Sbjct: 220  EDLKKEYDEHLNTEYESKKVELK------KLVEENEVLNTELSQIREHEDQMQRTFESKY 273

Query: 1972 EKFYQECITKFLSDTPLLFDEINDNVLNLKA----------LTSNYYSQIAENLSDLSEE 2121
             K  +E   + +    +  +++  ++ N+             T++ YS++         E
Sbjct: 274  -KALEETSKEEVDRLEIRLEQLRIDLENINTKSGDSTTTDNTTNDAYSKLMSQYKAAQHE 332