Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003706.16ON96396350660.0
NDAI0D008706.16ON106992122930.0
TDEL0G045306.16ON95889622730.0
ZYRO0C07898g6.16ON97494322240.0
NCAS0H008806.16ON100492822250.0
YEL061C (CIN8)6.16ON100092021990.0
Smik_5.266.16ON100292321830.0
Skud_5.286.16ON99883121740.0
Suva_5.66.16ON99992121380.0
CAGL0B03641g6.16ON98891221320.0
KLTH0C11330g6.16ON94189520290.0
Kwal_56.224036.16ON94390320210.0
ACR010C6.16ON94595020080.0
KNAG0M011306.16ON95095219900.0
Ecym_30206.16ON94493419850.0
Kpol_1032.66.16ON100462314770.0
SAKL0E01078g6.16ON94863614510.0
Kpol_1045.736.16ON96291814181e-180
TPHA0M002406.16ON93962713391e-169
KLLA0D01045g6.16ON96570513351e-168
TBLA0A072306.16ON109760313211e-165
TPHA0J003006.16ON98291610371e-124
TBLA0D006407.387ON11424766641e-71
SAKL0F12298g7.387ON11124436576e-71
ACR228C7.387ON11293256444e-69
Ecym_46887.387ON11343176276e-67
TPHA0E008907.387ON12322126215e-66
NCAS0E026407.387ON11024916171e-65
Suva_2.547.387ON11106226161e-65
Skud_2.417.387ON11106046143e-65
Smik_2.537.387ON11132156143e-65
YBL063W (KIP1)7.387ON11112156134e-65
NDAI0E043007.387ON11863296135e-65
KAFR0L017107.387ON11513906072e-64
ZYRO0B03234g7.387ON11382916021e-63
TDEL0C016007.387ON11052916011e-63
SAKL0G05016g5.531ON5042003568e-35
KLTH0G03850g5.531ON4731733486e-34
KLLA0B00759g5.531ON4562203343e-32
Kwal_47.186085.531ON4791733344e-32
SAKL0G18920g2.633ON6491893333e-31
Ecym_34152.633ON6621793192e-29
TDEL0F036403.479ON7044493164e-29
ADR145C2.633ON6351783138e-29
Ecym_40665.531ON4781723062e-28
CAGL0I07029g3.528ON7054223103e-28
SAKL0F01760g3.528ON8091843086e-28
TDEL0D059603.528ON7331853014e-27
Smik_7.483.528ON8051823014e-27
KAFR0F042103.528ON6721842995e-27
KNAG0B005203.528ON7233762995e-27
Kwal_47.190933.528ON8191853006e-27
Kpol_1004.255.531ON5061972938e-27
NCAS0E005503.528ON7841842988e-27
Skud_7.533.528ON8051822998e-27
NDAI0I029603.528ON8681902972e-26
Kpol_423.83.528ON8062682962e-26
Suva_7.443.528ON8051812962e-26
ZYRO0E08668g3.528ON7781852943e-26
TBLA0C049603.528ON8011942934e-26
CAGL0D04994g3.479ON6921982924e-26
YGL216W (KIP3)3.528ON8051822925e-26
TPHA0D034803.528ON8471852925e-26
KLTH0G01606g3.528ON8191852916e-26
Skud_16.4353.479ON7291882899e-26
TBLA0C039403.479ON7391822862e-25
ZYRO0D12650g5.531ON4782122802e-25
KNAG0A078803.479ON7641552853e-25
AER441C3.528ON8181842845e-25
TPHA0D032003.479ON7241502826e-25
Kpol_505.393.479ON6921492819e-25
AGR253W3.479ON7091832801e-24
Smik_16.3883.479ON7291872782e-24
Ecym_12003.528ON8332372783e-24
YPR141C (KAR3)3.479ON7291442773e-24
KLLA0A01606g3.528ON7691862773e-24
KAFR0B065903.479ON7061492764e-24
Suva_16.4693.479ON7311772755e-24
Skud_16.1278.678ON7064212746e-24
ZYRO0B04290g3.479ON7311492746e-24
NDAI0B057703.479ON7631542738e-24
NCAS0F034703.479ON6981492721e-23
SAKL0F03168g3.479ON7061452711e-23
Kpol_1013.78.678ON6201812692e-23
KLLA0D05951g8.678ON6682942692e-23
Smik_6.3528.678ON7154232692e-23
TBLA0C053103.479ON6761962683e-23
NCAS0C013508.678ON6551862673e-23
Kpol_1050.1033.479ON6971492673e-23
KAFR0H024108.678ON6582332664e-23
KLTH0F14498g3.479ON7021672657e-23
KLLA0B10956g3.479ON6901472612e-22
SAKL0H06490g8.678ON6571802532e-21
TPHA0D012708.678ON6962032542e-21
Kwal_26.88068.678ON7152082523e-21
Ecym_44073.479ON7111662523e-21
CAGL0M02189g8.678ON6721962513e-21
ZYRO0F07414g8.678ON6541972513e-21
KNAG0J017208.678ON6251912495e-21
KLTH0D11286g8.678ON6783112452e-20
YPL155C (KIP2)8.678ON7062022452e-20
NDAI0E02090singletonON6851982423e-20
TDEL0A062408.678ON6372482362e-19
Ecym_23958.678ON6871892353e-19
ACR145W8.678ON6852112301e-18
Suva_16.1558.678ON7042022263e-18
TBLA0C018808.678ON4681502234e-18
TDEL0B072702.633ON6442012237e-18
TPHA0D041903.479ON6721452202e-17
Kwal_55.21164singletonOFF5882481915e-14
Kwal_YGOB_55.211643.479ON6572481907e-14
Kpol_1019.112.633ON6471861881e-13
Skud_11.1482.633ON6561091728e-12
TPHA0N016502.633ON6821851729e-12
Suva_11.1452.633ON6571101692e-11
YKL079W (SMY1)2.633ON6561271612e-10
Smik_11.1602.633ON6561271612e-10
KNAG0M025402.633ON5221081593e-10
ZYRO0E01078g2.633ON6682931406e-08
NCAS0H031802.633ON6601041407e-08
NDAI0C004802.633ON5982851353e-07
TBLA0C008002.633ON6931721343e-07
TBLA0A008202.633ON8031671343e-07
CAGL0L05104g2.633ON6751991245e-06
KNAG0H003602.633ON6811161020.002
KAFR0C040202.633ON667170980.007
NCAS0C052002.633ON57264900.046
NCAS0C028308.401ON874127800.74
KNAG0F024606.131ON14368704.8
TPHA0H002608.160aON17954715.1
KAFR0E003101.515ON2465108745.3
Kpol_534.193.393ON49896726.4
SAKL0H15378g8.331ON3729188728.4
Kpol_1044.137.101ON1103212719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00370
         (963 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...  1956   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   887   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   880   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   861   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   861   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   851   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   845   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   842   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   828   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   825   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   786   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   783   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   778   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   771   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   769   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   573   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   563   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   550   e-180
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   520   e-169
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   518   e-168
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   513   e-165
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   404   e-124
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   260   1e-71
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   257   6e-71
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   252   4e-69
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   246   6e-67
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   243   5e-66
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   242   1e-65
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   241   1e-65
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   241   3e-65
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   241   3e-65
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   240   4e-65
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   240   5e-65
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   238   2e-64
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   236   1e-63
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   236   1e-63
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   141   8e-35
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   138   6e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   133   3e-32
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   133   4e-32
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   132   3e-31
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   127   2e-29
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   126   4e-29
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   125   8e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   122   2e-28
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   124   3e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   123   6e-28
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   120   4e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   4e-27
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   119   5e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   119   5e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   120   6e-27
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   117   8e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   119   8e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   8e-27
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   119   2e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   118   2e-26
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   118   2e-26
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   117   3e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   117   4e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   117   4e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   117   5e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   117   5e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   116   6e-26
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   115   9e-26
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   114   2e-25
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   112   2e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   114   3e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   114   5e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   113   6e-25
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   112   9e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   112   1e-24
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   111   2e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   111   3e-24
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   111   3e-24
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   111   3e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   110   4e-24
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   110   5e-24
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   110   6e-24
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   110   6e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   109   8e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   109   1e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   1e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   108   2e-23
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   108   2e-23
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   108   2e-23
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   107   3e-23
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   107   3e-23
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   107   3e-23
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   107   4e-23
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   106   7e-23
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   105   2e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   102   2e-21
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   102   2e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   101   3e-21
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   101   3e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   101   3e-21
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   101   3e-21
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....   100   5e-21
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    99   2e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    99   2e-20
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    98   3e-20
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    96   2e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    95   3e-19
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    93   1e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    92   3e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    91   4e-18
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    91   7e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    89   2e-17
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    78   5e-14
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    78   7e-14
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    77   1e-13
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    71   8e-12
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    71   9e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    70   2e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    67   2e-10
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    67   2e-10
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    66   3e-10
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    59   6e-08
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     59   7e-08
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    57   3e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    56   3e-07
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    56   3e-07
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    52   5e-06
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    44   0.002
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    42   0.007
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    39   0.046
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     35   0.74 
KNAG0F02460 Chr6 (463897..464328) [432 bp, 143 aa] {ON} Anc_6.13...    32   4.8  
TPHA0H00260 Chr8 (43951..44490) [540 bp, 179 aa] {ON}  YER134C         32   5.1  
KAFR0E00310 Chr5 complement(63266..70663) [7398 bp, 2465 aa] {ON...    33   5.3  
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    32   6.4  
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    32   8.4  
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    32   9.3  

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score = 1956 bits (5066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 963/963 (100%), Positives = 963/963 (100%)

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60
           MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI
Sbjct: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60

Query: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
           GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM
Sbjct: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120

Query: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180
           TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN
Sbjct: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180

Query: 181 DNGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSM 240
           DNGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSM
Sbjct: 181 DNGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSM 240

Query: 241 QTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI 300
           QTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI
Sbjct: 241 QTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHI 300

Query: 301 TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 360
           TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG
Sbjct: 301 TTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAG 360

Query: 361 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 420
           SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT
Sbjct: 361 SENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNT 420

Query: 421 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 480
           KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD
Sbjct: 421 KTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSD 480

Query: 481 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 540
           LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE
Sbjct: 481 LLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNE 540

Query: 541 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 600
           LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS
Sbjct: 541 LQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNS 600

Query: 601 KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 660
           KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF
Sbjct: 601 KFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKF 660

Query: 661 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 720
           YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY
Sbjct: 661 YQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFY 720

Query: 721 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 780
           NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM
Sbjct: 721 NQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELM 780

Query: 781 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKI 840
           SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKI
Sbjct: 781 SNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKI 840

Query: 841 NEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDT 900
           NEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDT
Sbjct: 841 NEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDT 900

Query: 901 SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 960
           SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP
Sbjct: 901 SIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 960

Query: 961 RLE 963
           RLE
Sbjct: 961 RLE 963

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/921 (53%), Positives = 643/921 (69%), Gaps = 36/921 (3%)

Query: 17  LNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKV 76
           LNITVAVRCRGRN+REI  KSSV+VTVPDI GS EV+INT++D+G TAQMNSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 77  FGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAG 136
           FGPSA Q LIFDE+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 137 IIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK---LRIFDS 193
           IIPRILFKLF+TLE   ED++VKCSF+ELYNE+LKDLL+ + N+ N +      LRIFDS
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 194 L----------GRDSRSNSRNNSPKM----SNNNTT---FLKKKLRNEAL--LRSRNIAS 234
                         SR+NSRNNSP++    SN  TT   +L++KL++       + NI +
Sbjct: 232 STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFT 291

Query: 235 SKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTI----QSDQTAGI 290
           S  SS  +++N T  K S  + +    S+ N +S  + +P     S++    Q D   GI
Sbjct: 292 SNASS--SVKNMT--KNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGI 347

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRL 350
           YIQNLQEFHI+ AKEG+ LLQKGLKYRQVASTKMNDFSSRSHTIFTITL+KE +G +FRL
Sbjct: 348 YIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRL 407

Query: 351 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTR 410
           SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVINSLAD+N H+PFRESKLTR
Sbjct: 408 SKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTR 467

Query: 411 LLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNI 470
           LLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGS I KDILLKNI
Sbjct: 468 LLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNI 527

Query: 471 TTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLK 530
           TTEL+++KSDLLSTKSK+GIYM Q+HY++L  +L N+KTE  E KR IE L+SQNALLLK
Sbjct: 528 TTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLK 587

Query: 531 DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDE 590
           DKRT NE NELQRIK+    +S+  L  KIE Q   E  L   +     +     K+I+ 
Sbjct: 588 DKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIEN 647

Query: 591 MKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLL 650
            + ++  V SK + +L+  L  +   L       K      +F +  NL +I++E+  +L
Sbjct: 648 YECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKML 707

Query: 651 STARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNN 710
            T ++  EK Y++ I  FL  TP  F +I +++ ++     N+++ +A+NLSD+SEEYNN
Sbjct: 708 GTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNN 767

Query: 711 FKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIIN 770
            KQ++ +  +   + +  +L+N +IN+T   + +S++ + +T ++++N+HL +N+ L++N
Sbjct: 768 LKQYLNENLF---QNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLN 824

Query: 771 SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 830
           S    T E+++ E++   P+  KWEES +LIN+ D+LNN F   V   ++    KI  + 
Sbjct: 825 SFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITASI 884

Query: 831 DSINNNIKKINEHFKTNDIAHSN---NLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLV 887
           + + +N  ++      ++  +++     +++DN II+  F  +  KNS   + V+     
Sbjct: 885 NQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSLKC 944

Query: 888 TNESMKKLNELDTSIRTVLKD 908
              S+  LN L+ SI+  ++D
Sbjct: 945 AVASVNNLNHLEDSIKMAVRD 965

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/896 (53%), Positives = 616/896 (68%), Gaps = 49/896 (5%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI AKSSVVV+VPD+ GS EV+INT+ D+G TAQ+NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           +VFGPSA QSL+F +IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS- 193
           AGIIPRILFKLFETLE   ED++VKCSFVELYNEELKDLL GD + +  + +KLRIFDS 
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLL-GD-SQEIASSRKLRIFDSN 190

Query: 194 -LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTKAS 252
            +   + S S  NS K S NN+     +L     LR R                      
Sbjct: 191 TMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRW--------------------- 229

Query: 253 ATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQK 312
                             K +P+         DQ AGIYIQNLQ+FHIT AKEGIKLLQK
Sbjct: 230 ------------------KTAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQK 271

Query: 313 GLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 372
           GLK+RQVA+TKMNDFSSRSHTIFTITL+KE  GEIFR+SKMNLVDLAGSENI+RSGA +Q
Sbjct: 272 GLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQ 331

Query: 373 RAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 432
           RAKEAGSINQSLLTLGRVINSL DK++HVPFRESKLTRLLQDSLGGNTKTALIATISPAK
Sbjct: 332 RAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 391

Query: 433 VTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYM 492
           +  EETCSTL+YA+KAKNIKNKPQLGS IMKDIL+KNIT EL KIK+DLLSTKSK+GIYM
Sbjct: 392 INSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYM 451

Query: 493 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 552
            Q +YKELT DL++YKTE++ECKR IE+LTSQN LLLKDK+  NE N+LQRIK+Q M ++
Sbjct: 452 SQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDA 511

Query: 553 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 612
           M  LY+K E+Q   E  L         T   +  II E + RE  + SK   L ++  + 
Sbjct: 512 MSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFAR 571

Query: 613 VSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDT 672
           V + +   I + + Q   +N  V  N+  I+ E++ LL  A+   +  Y++C+ K L +T
Sbjct: 572 VKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDET 631

Query: 673 PLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 732
           P  F    + V  ++ L +  +  + ENLSD+SEE+NN +Q++ D F+   K +  E+L 
Sbjct: 632 PGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFF---KNNHEEILV 688

Query: 733 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 792
            +I+ T   I++S++D+    + +++ HL  NK+L++ SL   T +++  E+   +P+  
Sbjct: 689 SHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKK 748

Query: 793 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHS 852
           KWE+S + IN+ D++N  F + V+S +  +   +  + ++IN  I K+ E    ++   S
Sbjct: 749 KWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESPAS 808

Query: 853 NNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKD 908
              M+ ++ +    F  I  K S LHE +K+  ++T++    +++L  +I  V+ +
Sbjct: 809 ---MLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSE 861

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/943 (50%), Positives = 630/943 (66%), Gaps = 46/943 (4%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVR RGRN+REI AKSSVVV+VPD+MGS EVAINT++D+G TAQMNSKTY VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGPSA Q LIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYN+ELSDS
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDSL 194
           AGIIPRILFKLFETL+  +ED++VKCSFVELYNEELKDLL  D + +N + +KLRI+DS 
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL--DDSVENSSMRKLRIYDSG 190

Query: 195 GRDS-----RSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTT 249
              +     R NSRNNSPK+  +     ++++R   L  S ++A  +    Q        
Sbjct: 191 SGSNSNSGSRKNSRNNSPKLVTD-PMINRRRMRTVPL--SSSLAKQQHQWQQRREQQHQL 247

Query: 250 KASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKL 309
           +                         +  +   Q D  +G+YIQNLQ+FHIT+A++G++L
Sbjct: 248 REQQQREQQAQQQQ-----------KEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQL 296

Query: 310 LQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGA 369
           LQKGL+ RQVA+TKMNDFSSRSHTIFTITL++E +GE+F++SKMNLVDLAGSENI+RSGA
Sbjct: 297 LQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGA 356

Query: 370 LNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATIS 429
            +QRAKEAGSINQSLLTLGRVINSLADK+ HVPFRESKLTRLLQDSLGGNTKTALIATIS
Sbjct: 357 QHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATIS 416

Query: 430 PAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDG 489
           PAK+  EETCSTL+YASKAKNIKN+PQL SFIMKDIL+KNIT EL K+KSDLLSTK ++G
Sbjct: 417 PAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREG 476

Query: 490 IYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTM 549
           +YM Q +YKE+T DL++YKTEIQE KR IE L+SQN+LLLKDK+  NE NELQRIK+Q M
Sbjct: 477 VYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNM 536

Query: 550 NESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHS 609
            + M  L  K+E Q   E EL         T S    +I E   RE  ++ + + +L   
Sbjct: 537 KDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQE 596

Query: 610 LSYVSKKLNYQIENFKDQGINQNF-------TVDENLQLIKSEMTNLLSTARDNFEKFYQ 662
                + L   IE+ +      +         + +NL +++ E+  LL  A+   EK Y+
Sbjct: 597 FLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYK 656

Query: 663 ECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQ 722
           + I K L + P +F  I++ V  ++   + Y+ ++ ENLSD+SE YNN KQ+  D F+  
Sbjct: 657 DWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFF-- 714

Query: 723 EKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSN 782
            K +  E+LN +I+ T   ++ S++ ++   + ++++HL+ NK L++ SL + TTE +  
Sbjct: 715 -KNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDK 773

Query: 783 ELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINE 842
           E+   +P+  KWEES +LIN  D+++N FN ++ S+++ +      + D I+ ++ K+ +
Sbjct: 774 EMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKD 833

Query: 843 HFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSI 902
             K  + A +   ++D N ++K     I  K+S L   + +    +   +   +EL   I
Sbjct: 834 EVKGYEDAST---ILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERI 890

Query: 903 RTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFL 945
           R           I   NS L   H++    T PL  + +RS L
Sbjct: 891 RNT---------IASENSTL---HQNKIATTPPLGQNSERSPL 921

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/928 (51%), Positives = 640/928 (68%), Gaps = 47/928 (5%)

Query: 4   PTVSSDKQPQEE-ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGF 62
           P  ++ + P+E+ ELNITVAVRCRGRN+REI++KS VVVTVPDI G++E++INT+ + G 
Sbjct: 15  PLTTTREPPEEDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGI 74

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
           TAQMNSKTYTVDKVFGP+A Q LIF E+AEPLF DF+KGYNCT+LVYGMTSTGKTYTMTG
Sbjct: 75  TAQMNSKTYTVDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTG 134

Query: 123 DEKLYNEE--LSDSAGIIPRILFKLFETLEKLNE--------DHIVKCSFVELYNEELKD 172
           DEKLY     LSD+AGIIPRILFKLF+TL+            D +VKCSFVELYNE+LKD
Sbjct: 135 DEKLYQNGTMLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKD 194

Query: 173 LLHGDCNNDNG-----NFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALL 227
           LL+ D N++         +KLRIFDS   ++ +++       +++  +      R  ++L
Sbjct: 195 LLNYDSNDEQQQQQQLGSRKLRIFDSTNNNNNNSN-----SNASSRASSRNNSPRTSSIL 249

Query: 228 ---RSRNIASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS 284
               + N+A  K+S      +    K+S  T   T      ND  +  +  D        
Sbjct: 250 PNANATNLAMRKKSIRYNYNSNNKAKSSNNTRPNT------NDEPSSIAGPD-------- 295

Query: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344
           + T GIYIQNLQEFHIT AKEG+ LLQKGLK+RQVASTKMNDFSSRSHTIFTITL+KE K
Sbjct: 296 ENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHK 355

Query: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
             +FRLSKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVINSLADK+ HVPFR
Sbjct: 356 DNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFR 415

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGS I+KD
Sbjct: 416 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKD 475

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
           ILLKNIT+EL K+KSDL+STKSKDGIYM  +HY+EL  +L++ KTE+QE KR IE L+SQ
Sbjct: 476 ILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQ 535

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584
           N++LLKDKR+ NE NELQRIK+  + +SM  L  K+E Q   E +L  +I    K+  KL
Sbjct: 536 NSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKL 595

Query: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 644
             ++   + +++ + ++   +L+ +L  + K LN   +  +      NF V+ NL++IK 
Sbjct: 596 NSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIKD 653

Query: 645 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 704
           E+T++L   +   E  Y+E I +FL  TP+   +I ++V  ++ + + YY++I ENLSD+
Sbjct: 654 EITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDI 713

Query: 705 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764
           SEEYNN KQ++ ++F+   + +  +LLN +IN T  ++  SS ++ +  + +++ HL  N
Sbjct: 714 SEEYNNLKQYLDNDFF---QNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMEN 770

Query: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824
           K+L+I++    T ++++ E++  KPK +KWEES ELINR D++NN F+ N+   ++ +  
Sbjct: 771 KKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKT 830

Query: 825 KIKQTNDSINNNIKKINEHF---KTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFV 881
            +  ++ SI+N I  I        +ND +     + +D  +   +F  I EKN  L +  
Sbjct: 831 NLASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALEND-PMFNKHFNEIIEKNMILQKNR 889

Query: 882 KEGYLVTNESMKKLNELDTSIRTVLKDI 909
           K     T++S+  ++EL  +++  L +I
Sbjct: 890 KNAINYTDKSLLNIDELSETVKIALNNI 917

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/920 (50%), Positives = 638/920 (69%), Gaps = 50/920 (5%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 188
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N       +G F KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 189 RIFDSLGRDSRSNSRNN-----------------SPKMSNNNTTFLKKKLRNEALLRSRN 231
           RIFDS   ++ +++  +                 +PK +      L+K+LR ++L    N
Sbjct: 213 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAA-----LLRKRLRTKSL---PN 264

Query: 232 IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIY 291
               +    Q + +   + +++ +TT    S+ N ++  + S A ND       QT GIY
Sbjct: 265 TIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPND-------QTNGIY 317

Query: 292 IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLS 351
           IQNLQEFHIT A EG+ LLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+S
Sbjct: 318 IQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 377

Query: 352 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL 411
           KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFRESKLTRL
Sbjct: 378 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRL 437

Query: 412 LQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT 471
           LQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGSFIMKDIL+KNIT
Sbjct: 438 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNIT 497

Query: 472 TELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD 531
            EL KIKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IESLTS+NALL+KD
Sbjct: 498 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKD 557

Query: 532 KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENEL---DGKIQIFTKTNSKLTKII 588
           K    E  + Q  +I+++  ++  L A++++Q   E E+   + K+Q  T+    +   +
Sbjct: 558 KLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV---MQMAL 614

Query: 589 DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 648
            + K RE  +N KF+  +   +  +   L  Q+   + + I Q   +  NL +IK+E+  
Sbjct: 615 HDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLT 674

Query: 649 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 708
           L+ T ++  E  Y++C+ K L+++P  F+ + + +  ++     +Y  IAENLSD+SEE 
Sbjct: 675 LMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEEN 734

Query: 709 NNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 768
           NN KQ++ + F+   K +  ELLN+++++T   IE  +N+ +   + +LN+HL  NK+LI
Sbjct: 735 NNMKQYLKNHFF---KNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLI 791

Query: 769 INSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 828
           + +L+  T+ ++  E+D  +PK  KWE S +LIN  D++NNEF +++ ++++ +   +  
Sbjct: 792 MQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDT 851

Query: 829 TNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVT 888
           +++S+N +I  +    + ++ A S   ++ +N    + F+ +  K++ L + +K     T
Sbjct: 852 SSNSMNESISVMKGQVEESENAIS---LLKNNTKFNDQFEQLINKHNMLKDNIKNSITST 908

Query: 889 NESMKKLNELDTSIRTVLKD 908
           +  +  ++++  +I  ++K+
Sbjct: 909 HSHITNVDDIYNTIENIMKN 928

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/923 (51%), Positives = 631/923 (68%), Gaps = 58/923 (6%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 188
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N+      +G F KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 189 RIFDSLGRDSRSNSRNN-----------------SPKMSNNNTTFLKKKLRNEALLRSRN 231
           RIFDS   ++ +++  +                 +PK +      L+++LR ++L  +  
Sbjct: 213 RIFDSSTANNTTSNSASSSRSSSRNSSPRSLNDLTPKAA-----LLRRRLRTKSLPNTIK 267

Query: 232 IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIY 291
               +    QT+ +   + +++ + T  + S  NN++  + S A ND       Q+ GIY
Sbjct: 268 -QQQQHQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPND-------QSNGIY 319

Query: 292 IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLS 351
           IQNLQEFHIT A EG+KLLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+S
Sbjct: 320 IQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 379

Query: 352 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL 411
           KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFRESKLTRL
Sbjct: 380 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRL 439

Query: 412 LQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT 471
           LQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+KNIT
Sbjct: 440 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNIT 499

Query: 472 TELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD 531
            EL KIKSDLLSTKSK+GIYM+Q HYK L +DL++YK E+QECKR IESLTS+N+LL+K+
Sbjct: 500 MELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSLLVKE 559

Query: 532 KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEM 591
           K    E  + Q  +I+++  ++  L  ++++Q   E E+ G        NSKL K+ + M
Sbjct: 560 KLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG-------FNSKLQKLTEVM 612

Query: 592 -------KNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 644
                  K RE  +N KF+T +   +  +   L  Q+   + + I Q   +  NL +IK+
Sbjct: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672

Query: 645 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 704
           E+  L+ T ++  E  Y++C+ K L+++P  F+ I + +  +      +Y  IAENLSD+
Sbjct: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732

Query: 705 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764
           SEE NN KQ+ T+ F+   + +  ELL+ ++++T   IE  +N  +   +  LN+HL  N
Sbjct: 733 SEENNNLKQYFTNHFF---RNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEEN 789

Query: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824
           K+LI+ +L+  T+ ++  E+   +PK  KWE S +LIN  D++NNEF +    SM T   
Sbjct: 790 KKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYN----SMATTLS 845

Query: 825 KIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNN-FKSIEEKNSRLHEFVKE 883
           +IK T D+ +N++ K     K       N + +  NNI  N+ FK +  K++ L + ++ 
Sbjct: 846 QIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIES 905

Query: 884 GYLVTNESMKKLNELDTSIRTVL 906
               TN  +  ++++  +I  ++
Sbjct: 906 SITSTNSHITNIDDIYNTIEKIM 928

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/831 (54%), Positives = 601/831 (72%), Gaps = 15/831 (1%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKEV+INT+ D G TAQMN+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGP A+Q LIF+E+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN EL+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 188
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + N       +G F KKL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 189 RIFDSLGRDSRSNSRNNSPKMSNNNTTF--LKKKLRNEALLRSRNIASSKRSSMQTIRNT 246
           RIFDS   ++ +++  +S + ++ N++   L       ALLR R      +S   TI+  
Sbjct: 215 RIFDSSTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKR---LRTKSLPNTIKQQ 271

Query: 247 TTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEG 306
              +A  +   ++  S    ++++  +       T Q+DQ+ GIYIQNLQEFHIT A EG
Sbjct: 272 QQQQAMNSRNNSSSNSGSAANNSSSNTNGQRSPMT-QNDQSNGIYIQNLQEFHITNALEG 330

Query: 307 IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 366
           + LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLVDLAGSENINR
Sbjct: 331 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 390

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIA 426
           SGALNQRAKEAGSINQSLLTLGRVIN+L D++ H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 391 SGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIA 450

Query: 427 TISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKS 486
           TISPAKVT EETCSTLEYASKAKNIKNKPQLG+F+MKDIL+KNIT EL KIKSDLLSTKS
Sbjct: 451 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKS 510

Query: 487 KDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKI 546
           K+GIYM Q HYK L +DL+++K E+QECKR IESL S+N+LL+KDK    E  + Q  ++
Sbjct: 511 KEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASKNSLLVKDKLKSRETIQSQNSQM 570

Query: 547 QTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 606
           +++  ++  L A++++Q   E E+ G      K    +   + + K RE  +N KF+T +
Sbjct: 571 ESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHI 630

Query: 607 DHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT 666
              +  +   L  Q++N + + I Q   +  NL ++K+E+  L+ T ++  E  Y++C+ 
Sbjct: 631 SKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVK 690

Query: 667 KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGH 726
           K L+++P  F+ I + +  ++    N+Y  IAENLSD+SEE NN KQ++ + F+   K +
Sbjct: 691 KILNESPKFFNVIVEKIDIIRIEFQNFYKNIAENLSDISEENNNLKQYLKNHFF---KNN 747

Query: 727 QHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDR 786
             ELLN +I++T   IE  +N  +   +  LN+HL  NK+LI+ +++N T+ ++  E+D 
Sbjct: 748 HQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDL 807

Query: 787 LKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNI 837
            +P+ +KWE S +LIN+ D++NNEF +N+ ++++ +   +  +++S+N +I
Sbjct: 808 FEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQIKKTVDTSSNSMNESI 858

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/921 (50%), Positives = 646/921 (70%), Gaps = 53/921 (5%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GS+EV+INT+ D G TAQMN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDN-----GNF-KKL 188
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + NN +     G F KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 189 RIFDSLGRDSRSNSRNN-----------------SPKMSNNNTTFLKKKLRNEALLRSRN 231
           RIFDS   ++ +++  +                 +PK +      L+K+LR ++L  +  
Sbjct: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAA-----LLRKRLRTKSLPNT-- 265

Query: 232 IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIY 291
               ++   QT  +   + ++  +T   +  + N +++ + S A ND       Q+ GIY
Sbjct: 266 --IKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPND-------QSNGIY 316

Query: 292 IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLS 351
           IQNLQEFHIT A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+S
Sbjct: 317 IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 376

Query: 352 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL 411
           KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+LADK+ H+PFRESKLTRL
Sbjct: 377 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRL 436

Query: 412 LQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT 471
           LQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+KNIT
Sbjct: 437 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNIT 496

Query: 472 TELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD 531
            EL KIKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IESL+S+N+LLLKD
Sbjct: 497 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKD 556

Query: 532 KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI---- 587
           K    +  + Q  +++++  ++ +L A++++Q   E E+ G    F     KLT+I    
Sbjct: 557 KLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG----FNNKLQKLTEIMQLA 612

Query: 588 IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMT 647
           + + K RE  +N KF+T +   +  +   L  Q+   +   I+Q   +  NL +IK+E+ 
Sbjct: 613 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL 672

Query: 648 NLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEE 707
            L+ T ++  E  Y++C+ K L+++P  F+ I + +  ++     +Y+ IAENLSD+SEE
Sbjct: 673 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 732

Query: 708 YNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKEL 767
            NN KQ++ + F+   K +  ELLN +I++T   IE  +++ +   +N LN+HL  NK+L
Sbjct: 733 NNNLKQYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789

Query: 768 IINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIK 827
           I+ +L+N T+ +++ E+D  +PK  KWE S +LIN+ D++NNEF +N+ ++++ + + + 
Sbjct: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849

Query: 828 QTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLV 887
            +++S+N +I  +    + ++ A S   ++ +N    + FK +  K++ L + ++     
Sbjct: 850 TSSNSMNKSISVMKGQVEESENAVS---LLKNNKKFNDQFKQLVNKHTILKDNIENSITS 906

Query: 888 TNESMKKLNELDTSIRTVLKD 908
           T+  +  ++++  +I  ++K+
Sbjct: 907 THSHITNIDDIYDTIENIMKN 927

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/912 (48%), Positives = 622/912 (68%), Gaps = 36/912 (3%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNI VAVRCRGRN+REI AKSSVVV VPD   + EV+INT++D+G  A+MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGPSA+Q L+++EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+N EL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS- 193
           AGIIPR+LF+LF+TLE   +D++VKCSFVELYNEELKDLL       N + KKLRIFDS 
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDSN 209

Query: 194 ----------LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTI 243
                         SR+NS  ++P   N+    L++KL       +  I+++  +     
Sbjct: 210 VNGTSASGSSSRSSSRNNSPRSAP--DNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRF 267

Query: 244 RNTT--TTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS----DQTAGIYIQNLQE 297
           + T+  +T+A A+           N+  N   P +N  +T Q     DQ+A IYIQNL+E
Sbjct: 268 KQTSQESTRAHAS-----------NNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEE 316

Query: 298 FHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVD 357
           FHIT+A EG++LLQKGLK RQVASTKMNDFSSRSH+IFTITL+KE  GE+FR+SKMNLVD
Sbjct: 317 FHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVD 376

Query: 358 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLG 417
           LAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSLG
Sbjct: 377 LAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLG 436

Query: 418 GNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKI 477
           GNTKTALIATISPAK+T EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+++IT+EL KI
Sbjct: 437 GNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKI 496

Query: 478 KSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINE 537
           KSDLLSTKSK+G+YM  +HYK+L  D++ YKTE++E KR IESLT+QNA+L +++ ++ +
Sbjct: 497 KSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKD 556

Query: 538 NNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREAL 597
           +N   +  I ++ +++  L + ++ Q + E  +   ++     N ++ K I   + ++  
Sbjct: 557 DNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQE 616

Query: 598 VNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNF 657
           +     T +   +S +   L   IE  ++ G  ++  +  NL  ++ E+  ++  A +  
Sbjct: 617 LQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEA 676

Query: 658 EKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITD 717
            K Y EC+   L +TP LF+ ++  + N+  L    +S+IAE LSD+SEEYNN KQ++T+
Sbjct: 677 SKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTN 736

Query: 718 EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTT 777
            F+   K +  ELL+ ++ NT   +E +S  +M     +L++H++ NK  ++ ++  VT 
Sbjct: 737 NFF---KNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTD 793

Query: 778 ELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNI 837
           E+++NEL     + +KWE+S+ LIN+ D++N+ F+  + S++  + D +  + D+I   I
Sbjct: 794 EVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATI 853

Query: 838 KKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNE 897
             I    +      S   MI  N++I+     I++KN  L  F +        S+  +N+
Sbjct: 854 SSIQSRTRNR---QSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATTSIGSVNK 910

Query: 898 LDTSIRTVLKDI 909
           ++ +++ ++  +
Sbjct: 911 VEGNLKVIMDKV 922

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/895 (48%), Positives = 584/895 (65%), Gaps = 52/895 (5%)

Query: 13  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 72
           +EEELNITVAVRCRGRN++E+ AKSSVVV VPD+ G+ EV+INT+ D G TAQ+NSKTYT
Sbjct: 3   EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 73  VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 132
           VD+VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122

Query: 133 DSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192
           + AGIIPR+LFKLF+ L+  N+D+++KCSF+ELYNEELKDLL  D   D+   +KLRIFD
Sbjct: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL--DETPDSSMPRKLRIFD 180

Query: 193 SLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTKAS 252
           S+                    T       +      +    S   + + IR  T  K S
Sbjct: 181 SV--------------------TNPNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYKPS 220

Query: 253 ATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQK 312
            + T                      K T+ S+  + I+IQNLQEFHI  AKEGI+LLQ+
Sbjct: 221 RSPTV---------------------KPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQR 259

Query: 313 GLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 372
           GL++RQVASTKMND SSRSHTIFTI L+++  GE FR+SKMNLVDLAGSENI+RSGA NQ
Sbjct: 260 GLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQ 319

Query: 373 RAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAK 432
           RAKEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSLGGNTKTALIATISPAK
Sbjct: 320 RAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 379

Query: 433 VTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYM 492
           +  EET STLEYA+KAKNIKNKPQ+GSFIMKD+L+KN+T EL KI+SDLL+TKSKDGIYM
Sbjct: 380 INSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYM 439

Query: 493 DQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNES 552
            Q++YKELT +L+NYKTE+QECKR IE L++QN LL K+KR  NE NE QR+KI+ ++ +
Sbjct: 440 SQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNN 499

Query: 553 MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSY 612
           +  LY KI+RQ   E EL   +Q   +    +   +   +++     ++ + +L  ++  
Sbjct: 500 IDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGS 559

Query: 613 VSKKLNYQIENFKDQGINQN-FTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSD 671
               L  +IE  K  G  ++ F VD N+  +  E+  +      +  +  ++ + K    
Sbjct: 560 FKHSLLNEIEKLK--GTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQ 617

Query: 672 TPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELL 731
           TP    +I + V ++  +  +Y S +  +LS +SEEYN+ K ++ + F+   K +  + L
Sbjct: 618 TPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFF---KNNFQDAL 674

Query: 732 NKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKL 791
           + +++ T   ++ S+N +   ++ ++NE L  NKE+++ SL N  +E+++ E+  L P  
Sbjct: 675 DVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVK 734

Query: 792 SKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAH 851
             WE S E IN  D LN+ F  ++ S +  + +KI +      + +   N        A 
Sbjct: 735 QAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDA- 793

Query: 852 SNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVL 906
           S  L  DD  +I  + + I++K++ L   V++       + +K  E+D SI+ +L
Sbjct: 794 SRALRTDD--VIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLL 846

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/903 (47%), Positives = 592/903 (65%), Gaps = 68/903 (7%)

Query: 14  EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73
           +EELNITVAVRCRGRN++E+ A+SSVVV VPD+ G+ EV+INT+ D G TAQ+NSKTYTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
           DKVFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 134 SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS 193
            AGIIPR+LFKLF+ L    +D+++KCSF+ELYNEELKDLL  D   D+   KKLRIFDS
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLL--DETPDSSMPKKLRIFDS 181

Query: 194 LGRDSRSNSRNNS---PKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTK 250
           +   S ++  ++    PK +  ++   ++K R  ++ R      SK              
Sbjct: 182 VSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSK-------------- 227

Query: 251 ASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLL 310
                                 SP +          ++ I+IQNLQEFHI  AKEGI+LL
Sbjct: 228 --------------------PVSPCE---------PSSAIHIQNLQEFHIMDAKEGIRLL 258

Query: 311 QKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGAL 370
           Q+GL++RQVASTKMND SSRSHTIFTI L+K+  GE FR+SKMNLVDLAGSENI+RSGA 
Sbjct: 259 QRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISRSGAQ 318

Query: 371 NQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISP 430
           NQRAKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 319 NQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIATISP 378

Query: 431 AKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGI 490
           AK+  EET STLEYA+KAKNIKNKPQ+GSFIMKD+LLK++T EL KIKSDLLSTKSKDGI
Sbjct: 379 AKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKSKDGI 438

Query: 491 YMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN 550
           YM Q++YKELT +L+NYKTE++ECKR +E +++QN+LL+K+KR  NE NE Q++K++ + 
Sbjct: 439 YMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKLRKLG 498

Query: 551 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 610
            +++ LY KI+RQ   E EL   +Q   +    + + +   +++    +++ + +L  ++
Sbjct: 499 NNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVLYDNI 558

Query: 611 SYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLS 670
               K L  +IE  K         V+ N+  + +E+T +      +  + ++  I K   
Sbjct: 559 GSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVND 618

Query: 671 DTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHEL 730
            TP  F +I   V ++ ++ S+Y S +  +LS +SEEYNN K ++ + F+   K +  E 
Sbjct: 619 QTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFF---KNNFQEA 675

Query: 731 LNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPK 790
           L+ +++ T   ++ S+N +   ++ +LNE L  NKE ++ SL +  +E+++ E+  L P 
Sbjct: 676 LDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPV 735

Query: 791 LSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ-------TNDSINNNIKKINEH 843
              WE S E IN  D LNN F + +  ++  +   I Q       T +   + + ++   
Sbjct: 736 KQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRAA 795

Query: 844 FKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIR 903
           F +          + +N II  N  SI++K++ L   V++       + +K  E+D SI+
Sbjct: 796 FSS----------LQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQ 845

Query: 904 TVL 906
            +L
Sbjct: 846 DLL 848

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/950 (46%), Positives = 612/950 (64%), Gaps = 57/950 (6%)

Query: 14  EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73
           +EELNITVAVRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G  A+MNS+TYTV
Sbjct: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
           DKVFGPSA QSLIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ +LSD
Sbjct: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137

Query: 134 SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS 193
           SAGIIPRI+FKLF+ LE  + D +VKCS++ELYNEELKDLL  D ++D+   K+LRIFDS
Sbjct: 138 SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL--DESHDSS--KRLRIFDS 193

Query: 194 LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTKASA 253
                  +S N+S + S+ + +  + ++ +    R R             +     KA+ 
Sbjct: 194 -------SSMNHSSRASSQSNSPREPEVAHNGFSRRR-------------QRPPPVKANR 233

Query: 254 TTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKG 313
            + T    S                      +  +GIY+QN+QEFHI  A+EGI +LQKG
Sbjct: 234 MSATKQQLS----------------------ESGSGIYVQNVQEFHIINAREGINVLQKG 271

Query: 314 LKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQR 373
           LK+RQVASTKMNDFSSRSHTIFTI L+K   GE+FR+SKMNLVDLAGSENI+RSGA NQR
Sbjct: 272 LKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQR 331

Query: 374 AKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 433
           AKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+
Sbjct: 332 AKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 391

Query: 434 TLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMD 493
             +ET STLEYA+KAKNIKN+PQLG+ +MKDIL+KNI++EL KIKSD LSTKSKDGIYM 
Sbjct: 392 NADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMS 451

Query: 494 QQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESM 553
            +HY+E+  DL+N +TEIQE KR IESLTSQN LLLKDK+   E  ELQ  KI+ +  ++
Sbjct: 452 HEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTI 511

Query: 554 KKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYV 613
           + LY KIERQ   E EL   I    +    +   +   +  E  + +  K +L   ++  
Sbjct: 512 EYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSY 571

Query: 614 SKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTP 673
            + +N  +E  K   +++N ++ EN+  I +   + L +   N      + + K + +TP
Sbjct: 572 RESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETP 630

Query: 674 LLF-DEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLN 732
            ++  E N+ V +LK+  S+Y + +   L+++SEE N+ ++++    +   K    E+L+
Sbjct: 631 SMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLF---KNSTQEVLD 687

Query: 733 KYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLS 792
             + +    +++ S+ ++S + +++  H+  ++ L++NS+ +   E++ NE    +P   
Sbjct: 688 LRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRD 747

Query: 793 KWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND-SINNNIKKINEHFKTNDIAH 851
           +W  S + IN+ DA +  F    E+  T+  DK+K+ +D S+ ++   +N+     D  H
Sbjct: 748 RWIASCDNINQCDASHQNF----EAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFH 803

Query: 852 SNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDY 911
                +  +  +K     I +K+  L +   +      ES K   ++D SI+ ++ ++  
Sbjct: 804 DFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSP 863

Query: 912 E-KDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 960
           E  DIK   + ++  +   ++   P      R  L NA  ++  ++S  P
Sbjct: 864 EVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSP 913

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/952 (45%), Positives = 630/952 (66%), Gaps = 67/952 (7%)

Query: 3   DPT--VSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60
           DP   + S    +++++NITVAVRCRGRN+REI+AKS +VVTVPD+  + EV+INTS   
Sbjct: 9   DPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGS 68

Query: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
           G  AQ+ +KTYTVDKV+GP ++Q L+F++ AEPLF DF++GYNCTMLVYGMTSTGKTYTM
Sbjct: 69  GIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTM 128

Query: 121 TGDEKLYNE-ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL-HGDC 178
           TGD ++  E +++  AGI PRIL KLFE L+   +D++VKCSFVELYNE+L+DLL  G  
Sbjct: 129 TGDVEMGAEGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQD 185

Query: 179 NNDNGN------------FKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEAL 226
           +  NG              KKLRIFDS      +NSR+NSP  + NN T           
Sbjct: 186 DFSNGTENSSKQPESLNASKKLRIFDS------NNSRSNSPVTNTNNPTH---------- 229

Query: 227 LRSRNIASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQ 286
                     RS     +  +  K S    +    + G              K+ +   Q
Sbjct: 230 --------KARSDYLKKKLKSNRKKSLDDMSLNANAGG--------------KTHVPPTQ 267

Query: 287 TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGE 346
           T GIYIQNL++FHI+TAKEG++LLQ+GL+ RQVA+TK+ND SSRSHTIFTITL+K+ K +
Sbjct: 268 T-GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDD 326

Query: 347 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRES 406
           ++RLSK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVINSLADK+ H+PFRES
Sbjct: 327 LYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRES 386

Query: 407 KLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDIL 466
           KLTRLLQDSLGGNTKT LIATISPAK+  EETCSTLEYASKAKNIKNKPQLGSFI+KDIL
Sbjct: 387 KLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDIL 446

Query: 467 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNA 526
           LK+++ EL K+++DL  TKSK+GIY+ Q++YKE+  DL N+KTE+ E KRT +SL  +N 
Sbjct: 447 LKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENE 506

Query: 527 LLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTK 586
           LL K+K++  E  +  + ++  +   +K +  K+ +  +   +L  ++    +  ++L  
Sbjct: 507 LLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKS 566

Query: 587 IIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQ-NFTVDENLQLIKSE 645
           +I+  + +      KF+ LL   L+ ++ K+  Q +  K+  +N  N+ +  ++  I+ E
Sbjct: 567 LIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN--VNSGNYQIHTHIDSIRGE 624

Query: 646 MTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLS 705
           + NLL T ++N E  Y+ CI   L +TP +F  I+DNV +++ +T  +Y+++A N SDLS
Sbjct: 625 VMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLS 684

Query: 706 EEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANK 765
           EE+N FKQ++  +F+   + +  E++  + +   + ++  S+D++ ++QN +  +L  N 
Sbjct: 685 EEFNTFKQYLDGQFF---QNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNA 741

Query: 766 ELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDK 825
           +++ NS+++V  ++++ E+D   PK SKWEES +LIN+SD+L+N+F +N+  S+  +   
Sbjct: 742 QMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASV 801

Query: 826 IKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEK-NSRLHEFVKEG 884
           I+ +N+S++ +I  I +H   NDI  ++   I+ N ++ N+FK+I+EK N+ LH    + 
Sbjct: 802 IRNSNESMDRSISTIKKHIIENDI--NSQEQINSNELLTNSFKAIQEKSNNILHLVTGDL 859

Query: 885 YLVTNESMKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPL 936
            +   ESM  +  LD SIRT++    Y    K  + P +      ++  IPL
Sbjct: 860 TVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPL 911

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/934 (46%), Positives = 604/934 (64%), Gaps = 102/934 (10%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+REI AKS+VVVTVPD+ GS EV+INT+ DIG   +MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           +VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNF-KKLRIFDS 193
           AGIIPR+LF+LF+TLE    DH+VKCS++ELYNEELKDLL     +D  ++ K+LRIFDS
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLL-----DDTPDYSKRLRIFDS 193

Query: 194 -LGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIAS-SKRSSMQTIRNTTTTKA 251
               +SR+ S+NNSPK  +  ++ + K+       R  +I +  KR S+           
Sbjct: 194 NTITNSRAGSQNNSPKEQDGTSSSMAKR-------RYTHIPTKPKRPSL----------- 235

Query: 252 SATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQ 311
                             NK          +  +Q++ IYIQNLQEFHIT A+EGI +LQ
Sbjct: 236 ------------------NK---------QLLYEQSSAIYIQNLQEFHITNAREGISVLQ 268

Query: 312 KGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALN 371
           KGLK+RQVASTKMNDFSSRSHTIFTI L+K  +GE+FR+SKMNLVDLAGSENI+RSGA N
Sbjct: 269 KGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQN 328

Query: 372 QRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPA 431
           QRAKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATISPA
Sbjct: 329 QRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPA 388

Query: 432 KVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIY 491
           K+  +ET STLEYA+KAKNIKN+PQLGSF+MKDIL+K+I++EL+K+KSD LSTK+K+GIY
Sbjct: 389 KINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIY 448

Query: 492 MDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNE 551
           M  +HY+E+  DL+NY+TEIQE KR +ES +SQN+LLLKDK+   + NELQ +KI  +  
Sbjct: 449 MSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQN 508

Query: 552 SMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKN-------REALVNSKFKT 604
           +++ L  KIERQ    NE+D        T  KL + +  MK         E  + +  K 
Sbjct: 509 TIEYLCDKIERQH--RNEID-----LVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKE 561

Query: 605 LLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQEC 664
           +L   ++   + ++  +E  K + +++N +++ N+  I++     L + R         C
Sbjct: 562 VLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDM---C 618

Query: 665 --ITKFLSDTP-LLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYN 721
             I K + D P   + +  + + +L      Y   +   L++++EE NN K+++ + F  
Sbjct: 619 TNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFL- 677

Query: 722 QEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMS 781
             K +  E+L+  +       +++S+ ++S++ +++  H+  ++ L+++S+ +  +E++ 
Sbjct: 678 --KNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMID 735

Query: 782 NELDRLKPKLSKWEESAELINRSDALNNEFNDN-----------VESSMTTMTDKIKQTN 830
            EL+  +P   +W  S E IN  DA + +F +             ++S+    D  KQ  
Sbjct: 736 KELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVVAADDVAKQVQ 795

Query: 831 DSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNE 890
           +++ N    + +      I    N + D + +++++F    E N +  +          E
Sbjct: 796 ENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHF----ENNIKYFK----------E 841

Query: 891 SMKKLNELDTSIRTVLKDIDYE-KDIKETNSPLK 923
           S K   E+D SI+ +++++  E  DIK+  + L+
Sbjct: 842 SSKGFEEMDCSIKKIIREMSPEVGDIKQIEALLE 875

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/623 (47%), Positives = 435/623 (69%), Gaps = 6/623 (0%)

Query: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344
           D+  GIYIQNL+EFHIT+AKEGI+LLQ+GL+YRQVASTKMNDFSSRSHTIFTI L+KE  
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           G+IFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN+H+PFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGGNTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQLGS I KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
           IL+KNI +EL K+K+DLLSTKS+DG+YM Q HYKELT DL++YKTE+QECKR I+ LT+Q
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584
           N LLLKDK+  NE + LQ+IK+Q+M +S+  L+  IE+Q   E  L   I      + ++
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKS 644
              I     RE +  +K K + +  L  +   L   +E    + +  N  +  N++ IK 
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 645 EMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDL 704
           E+ +++ T +      Y++C+ + + ++P+L   +ND+++ ++ ++  Y  Q++ ++S+L
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 705 SEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRAN 764
           + E+N+ KQ++   F+   K    E+LN++I  T   I  +S  ++  ++  L  +L  +
Sbjct: 718 NIEHNDLKQYLNGSFF---KSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEES 774

Query: 765 KELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTD 824
           + +II+SL N T++++ +E++   PK  KWE+S E+IN+ D+LNN++  ++ + ++ M  
Sbjct: 775 RNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKT 834

Query: 825 KIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEG 884
            +  T+D +++++ ++ ++  T++ + S  L  +++  I   F  + EKNS+L   + E 
Sbjct: 835 SVTSTSDLVDDHVSQMRKY--TDNTSRSTKLT-ENSKRIGQQFTEMMEKNSKLESHLNES 891

Query: 885 YLVTNESMKKLNELDTSIRTVLK 907
             +   S+   ++L  SI +  +
Sbjct: 892 ITMNESSINAFDKLSESIHSAFE 914

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/636 (47%), Positives = 428/636 (67%), Gaps = 18/636 (2%)

Query: 277 NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 336
           N+K    S+Q++ IYIQNLQEFHIT AK+GI LLQ+GLK+RQVASTKMNDFSSRSHTIFT
Sbjct: 248 NNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFT 307

Query: 337 ITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD 396
           I L+K   GE+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLAD
Sbjct: 308 IMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 367

Query: 397 KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQ 456
           KN H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQ
Sbjct: 368 KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQ 427

Query: 457 LGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKR 516
           LG+ +MKDIL+KNIT EL KIKSD LSTKSKDGIYM Q HYKELT+DL+NYKTE+QECKR
Sbjct: 428 LGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKR 487

Query: 517 TIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQ- 575
            IE + SQN LLLKDKR  +E +ELQRIKI+ +N+ +  LY K+++Q   E +L   I  
Sbjct: 488 EIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHT 547

Query: 576 ----IFTKTNSKLTKIIDEMKNREALVNSKFKTLL-DHSLSYVSKKLNYQIENFKDQGIN 630
               I+T  NS     +   ++ +    S+ + +L DH  S+  + ++ Q+   K    +
Sbjct: 548 LKDAIYTVQNS-----LKNCEDYQLQCKSEMEDVLYDHVTSF-KQSIHEQLAAMKASHSS 601

Query: 631 QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALT 690
           ++  +D N+ +I+ E++ +L +         + C+ K L   P  F+ I  ++L++  + 
Sbjct: 602 RHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVV 661

Query: 691 SNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVM 750
            +Y +++ +NL D+SEEYNNF++++ +  +   K +  E L+ +++ T  +++ S+ ++ 
Sbjct: 662 DSYSNELVKNLGDISEEYNNFREYLNEHLF---KNNHEETLSIHVDKTYHMLKKSAGELF 718

Query: 751 STIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNE 810
           S  + +++ HL  NK L+I SL   + E+++ E+    P   KWE S E IN+ D+LNN 
Sbjct: 719 SKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNT 778

Query: 811 FNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSI 870
           F+  V+ ++  +   I+ + +   N    + +  K  D       ++ +N  + NN   +
Sbjct: 779 FDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISE---VLKNNTKVVNNINEV 835

Query: 871 EEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVL 906
           +EK++ L + V+        + +K   +D  IR ++
Sbjct: 836 KEKHTFLRDQVERTSSYIEAANEKFEGIDQFIRQII 871

 Score =  300 bits (767), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 161/178 (90%), Gaps = 2/178 (1%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           +ELNITV+VRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G TAQMNSKTYTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGPSA QSLIF +IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELSD+
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192
           AGIIPRILFKLF+TLE  +ED++VKCSF+ELYNEELKDLL+     ++G  KKLRIFD
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEP--QESGVIKKLRIFD 190

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  550 bits (1418), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 339/918 (36%), Positives = 534/918 (58%), Gaps = 69/918 (7%)

Query: 8   SDKQPQEEELNITVAVRCRGR--NQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQ 65
           SD    + E NI V  R +G+  N++  D +  +++  P +             I F  +
Sbjct: 4   SDGVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------------IKFKGK 50

Query: 66  MNS--KTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 123
            ++  + + +D +F     Q  ++ +  +P+F DFI GYNC+ LVYG T +GKTYT++G+
Sbjct: 51  DDAVKREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGE 110

Query: 124 EK--LYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 181
           E   L++E    S G+IPR+L +LF+ L   N DH+VKCS+VE+YNEELKDLL    N+ 
Sbjct: 111 EDSLLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL 170

Query: 182 -NGNFKKLRIFDSL------GRDSRSNSRNNSPKMSNNN--TTFLKKKLRNEAL--LRSR 230
            + + KKLRI DS       G +S  N+R+NSP  S+ +  T  ++KK+  ++L  L+  
Sbjct: 171 LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQA 230

Query: 231 NIASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGI 290
           N  S  RS                            +S N++SP    +  IQ ++T   
Sbjct: 231 NTLSISRS----------------------------NSFNEYSP----QRHIQ-EKTGAP 257

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRL 350
           YIQNL+EFHIT AKEGI+LL +GLK RQ+AS+K   +SSR+ TIFTI L+KE +GEIFR+
Sbjct: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317

Query: 351 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTR 410
           SK N VDLAG+E+ ++    NQR K+   INQ +  L +++NSL +K   +PF++SKLT 
Sbjct: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTY 377

Query: 411 LLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNI 470
           L++D+L GN+K+  I T+   K +L+E   TLE+ +K +++K  P LG  I K+ L+K+I
Sbjct: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437

Query: 471 TTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLK 530
           + EL K+KSDLLSTKSK+G+YM  +HY  LT DL  +K EI + K+ I+ L  Q+  L K
Sbjct: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497

Query: 531 DKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDE 590
           DKR   E NE+QRIK+Q+M +S+  +Y  IE+QQ  E++L        +T + +   I  
Sbjct: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557

Query: 591 MKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLL 650
             +RE+ V ++ KTL +  LS +   L   +  F+   +  N  ++ NL     E+  +L
Sbjct: 558 YTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQIL 617

Query: 651 STARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNN 710
             + +  +  + +CI K   ++P LF     +V  L+  TS  Y+ +AE LSD+SEE+NN
Sbjct: 618 QISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNN 677

Query: 711 FKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIIN 770
            KQ+I ++F+   K +  ELL  Y+N T   ++ SS+D +    +LL  +L  NK +++ 
Sbjct: 678 LKQYINEKFF---KNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQ 734

Query: 771 SLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTN 830
           ++ + T+E++ NE++   P+  KWE+S ELI +S   +NEF       +  + D +K T+
Sbjct: 735 NIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTS 794

Query: 831 DSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNE 890
           +S+ + + ++    K N++  + N+ I++N ++   F SI +KN  L + +      T E
Sbjct: 795 ESLFDTLSEMKS--KINELQKAANI-IENNEVVTEEFISIMKKNGILKDTLNINMTSTEE 851

Query: 891 SMKKLNELDTSIRTVLKD 908
           S+   ++LD SIR V K+
Sbjct: 852 SIVAFDKLDDSIRNVFKN 869

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  520 bits (1339), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/627 (46%), Positives = 419/627 (66%), Gaps = 9/627 (1%)

Query: 278 DKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTI 337
           D + IQ +  A IYIQNL+EFHI  A+EGI+LLQKGLKYRQVASTKMND SSRSHTIFTI
Sbjct: 227 DNTAIQ-NGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTI 285

Query: 338 TLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK 397
            L+KE KGEIF++SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINS+ADK
Sbjct: 286 NLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADK 345

Query: 398 NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQL 457
           N+H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+  EETCSTLEYA+KAK+IKNKPQL
Sbjct: 346 NIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQL 405

Query: 458 GSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRT 517
           GS IMKD+ LK++  EL KIK DL STK KDG+YM Q HYK+LT DL++YKTEIQEC R 
Sbjct: 406 GSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRI 465

Query: 518 IESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIF 577
           ++SL  QNALLLKDK+  NE N+LQ + +  M  ++  +   +E Q   E  L  ++   
Sbjct: 466 VKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHS 525

Query: 578 TKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDE 637
            + + K+  +I E   +E  + S  K++ +  L  + + L   +     + +     V +
Sbjct: 526 REKSLKMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKD 585

Query: 638 NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQI 697
           N++LIK ++ ++++ +++  +K + E   + + +TPL+ +  + +V   + L   Y++ +
Sbjct: 586 NIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANL 645

Query: 698 AENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLL 757
            ENL  + ++Y+   ++ +++F+   K +   ++N ++N T+ +IE S +D+    Q  +
Sbjct: 646 FENLESIKQQYSKLNEYFSNDFF---KSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNM 702

Query: 758 NEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVES 817
                 N++LI+ +L  V+++L+ NE++  K   S+W+ S + IN  D LNN ++D + +
Sbjct: 703 EAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHT 762

Query: 818 SMTTMTDKIKQTNDSINNNIKKINEHFKTN-DIAHSNNLMIDDNNIIKNNFKSIEEKNSR 876
            +  M  K+ Q++D I   IKK     K+N D  +S   +++ +  I +N+  I  K  +
Sbjct: 763 YLRNMKGKL-QSSDEI---IKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDK 818

Query: 877 LHEFVKEGYLVTNESMKKLNELDTSIR 903
           LH+ ++     T  S+   +E+  SI+
Sbjct: 819 LHDHLQISLNSTQNSLLVFDEICKSIQ 845

 Score =  291 bits (746), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 136/192 (70%), Positives = 167/192 (86%), Gaps = 8/192 (4%)

Query: 6   VSSDKQPQEE---ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI-- 60
           +S+D Q  E+   E+NI VAVRCRGRN+REI +KSSV+V+VPD+MGS E++INTS+DI  
Sbjct: 1   MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVS 60

Query: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
           G TAQ+NSKTYTVDKVFGPSA Q LIF+EIAEPLF+DF++GYNCT+LVYGMTSTGKTYTM
Sbjct: 61  GLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTM 120

Query: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180
           TGDEKLY  +LSDSAGIIPR+LFKLFET+E  ++++++KCSF+ELYNEELKDLL    ++
Sbjct: 121 TGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---IDS 177

Query: 181 DNGNFKKLRIFD 192
           +N   KKLRIFD
Sbjct: 178 NNTKLKKLRIFD 189

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  518 bits (1335), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 308/705 (43%), Positives = 433/705 (61%), Gaps = 48/705 (6%)

Query: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344
           +Q++ IYIQ+LQEFHIT AKEG++LLQKGL +RQVASTKMND SSRSHTIFT+TL+K   
Sbjct: 264 EQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFN 323

Query: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           GE FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVINSLADKN H+PFR
Sbjct: 324 GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR 383

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGGNTKTALIATISPAK+  EET STLEYA+KAKNIKNKPQLGSF+MKD
Sbjct: 384 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD 443

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
           IL+KNI+ EL K+KSD LSTKSK+GIYM   HY E+  D++NYKTEIQE +R IE L+SQ
Sbjct: 444 ILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQ 503

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584
           N LL KDK++  +  E QR++I+ +  SM  LY KI+ +   E EL   I         +
Sbjct: 504 NQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNM 563

Query: 585 TKIIDEMKNREALVNSKF-KTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIK 643
              +   ++ E  + S   K L D+ L Y  +K+  +++N K Q + Q+FT+D+++  +K
Sbjct: 564 QGALKTHEDHEQRLQSDIQKMLYDNILEY-RRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 644 SEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD 703
             +  LL T + +     +    K + D P  F+ +   + ++ +    +  ++ E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 704 LSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRA 763
           ++ E NN K ++   F+   + +  E+LN + + T   +  SS  +MS I N++++H+  
Sbjct: 683 ITAENNNLKAYLDTHFF---RNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQ 739

Query: 764 NKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMT 823
           N+ L++++L   TTE+++ E+   +P    WE+S   IN  D+L+N+F D+   S+ ++ 
Sbjct: 740 NRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLK 799

Query: 824 DKIKQT---NDSINNNIKKINEHFK-TNDIAHSN---NLMIDDNNIIKNNFKSIE---EK 873
             ++ T   +  I + IK    HF+  NDIA+     N  +DD   IKN    +    EK
Sbjct: 800 SHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDD---IKNKHSVLRDELEK 856

Query: 874 NSRLHEFVKEGYLVTNESMKKL------------------NELD------------TSIR 903
           N        EG+   + S+K++                    +D            T +R
Sbjct: 857 NVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLR 916

Query: 904 TVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNA 948
            +LK    ++ + ++ SP K SH    N  +   +   R F  N+
Sbjct: 917 PLLKSETKQRSLSKSVSPAKSSHATIINSPLKRKSSDSRIFPGNS 961

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  513 bits (1321), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 288/603 (47%), Positives = 404/603 (66%), Gaps = 28/603 (4%)

Query: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344
           D    IYIQNLQEF+I  A +GIKLLQKGL++R+VASTKMND SSRSHTIFTITL+KE  
Sbjct: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388

Query: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           G ++R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVINSLADK++H+PFR
Sbjct: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGGNTKT LI+TISPAK+ ++ET STLEYASKAKNIKNKP LGSFIMKD
Sbjct: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
           +LLKNITTEL KIKSDL+ST+ KDG+YM QQHYKEL  DL++YKTE+QE KR  E L SQ
Sbjct: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584
           N  LLKDK+  NE NELQRI+I+  NE +K+LY  ++     E+ L   I+      + +
Sbjct: 569 NGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSM 628

Query: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN-------------- 630
              I+  + R+  +    K +L++   ++  +L+  + N     I+              
Sbjct: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIE 688

Query: 631 ----QNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNL 686
                NF   +N+ +I++    +L   ++  +  Y  CI + LSD P + ++    + ++
Sbjct: 689 AIDSSNF--QKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSI 746

Query: 687 KALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSS 746
               ++ +++I ENLSDLSEEYNNFK+++ + F    + +   +L  ++ + Q+ IES S
Sbjct: 747 DFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL---QNNYELILKNHLESGQSQIESFS 803

Query: 747 NDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDA 806
           N+++  I   +NE    N +L    L+N+  +++  E + +KP   KW +S E+IN +D 
Sbjct: 804 NNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDK 863

Query: 807 LNNEFNDNVESSMTTMTDKIKQTNDSINNNI-----KKINEHFKTNDIAHSNNLMIDDNN 861
           +NN F++++ + +  + + I Q+++ INN+I      +I E+   N+I  SN   +++ N
Sbjct: 864 INNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNIN 923

Query: 862 IIK 864
            +K
Sbjct: 924 ELK 926

 Score =  308 bits (789), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 141/181 (77%), Positives = 161/181 (88%), Gaps = 3/181 (1%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           EELNITVAVRCRGRN+RE+ AKSSVVV+VPDIMGS EV+INTS+++G  A MNSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           KVFGPSA+Q L+F EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDSL 194
           AGIIPR+LFKLFE+ E LN+D+I+KCSFVELYNE+LKDLL    +N    +KKLRIFDS+
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN---TYKKLRIFDSM 185

Query: 195 G 195
            
Sbjct: 186 S 186

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  404 bits (1037), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 302/916 (32%), Positives = 499/916 (54%), Gaps = 64/916 (6%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIM-GSKEVAINTSEDIGFTAQMNSKTYTVDKV 76
           NITVAVRCR     E  + S  ++++ D   G+    I   E  G       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 77  FGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD----EKLYNEELS 132
           +G    Q  +FDE   P +  F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 133 DSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL---------HGDCNNDNG 183
           ++ G++PR+L +LF+ LE    DHI+KCSFVE+YN+EL+DLL         +        
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 184 NFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRS--SMQ 241
             KKLRI DS     RS   +NS   + +N+     K    A++R R     KRS     
Sbjct: 183 TGKKLRIVDSASNGLRSAGSSNSS--TRDNSPLTNSKKIPTAMMRKR---MGKRSLPPNN 237

Query: 242 TIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHIT 301
           +I N T      + + T  FS  +  S++              ++   IYIQNLQE  IT
Sbjct: 238 SISNNTANNNRLSLSRTNSFSDYSLQSSH--------------ERLNSIYIQNLQEITIT 283

Query: 302 TAKEGIKLLQKGLKYRQVASTK----MNDFSSRSHTIFTITLFKEVK-GEIFRLSKMNLV 356
             +EG+ +++KGLK R++AST      N+FS RSH+IF ITL+KE +  E+FR+SK++ V
Sbjct: 284 EIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFV 343

Query: 357 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSL 416
           + AGSE  + + + N      G+ N +L +  ++IN + + + +  F +SKLT+LLQ++ 
Sbjct: 344 NFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNF 397

Query: 417 GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTK 476
            G T+T  IA I+P K  L+ TCS L  A+K K IKN+P+ GS I K+ L+K ++ EL K
Sbjct: 398 DGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVK 457

Query: 477 IKSDLLSTKSKD-GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTI 535
            KSDLLS KS D GIYMD++HY ELT  L++YK +IQ  K +I  LT +   +  +KRT 
Sbjct: 458 TKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTF 517

Query: 536 NENNELQRIKIQTMNESMKKLYAKIERQQSIENELDG-KIQIFTKTNSKLTKIIDEMKNR 594
            E NE QRIK+Q + E++  L   +E+Q   E+EL+  KI++ +   + + K +++  ++
Sbjct: 518 EEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGN-MQKSVEKYSDK 576

Query: 595 EALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTAR 654
           E  + +K K L D  L  +   L     + K++  + N  ++ N+  IK+E+  + + ++
Sbjct: 577 EIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQ 636

Query: 655 DNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQF 714
              ++       + L  +P  F++++ N+ NL+      +++ +E LSD+SEE+NN   +
Sbjct: 637 SKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNY 696

Query: 715 ITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSN 774
           I D F    K    EL++ YIN T   ++  S +     + LL+ ++  N + +  S+++
Sbjct: 697 INDNFL---KSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITS 753

Query: 775 VTTELMSNELDRLKPKLSKWE-ESAELI-NRSDALNNEFNDNVESSMTTMTDKIKQTNDS 832
           +T+E++ NEL +  P+  KWE  S E+I N ++++    N N E  +  +  +   T++ 
Sbjct: 754 LTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSE-ILAKLLSESTSTSEL 812

Query: 833 INNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESM 892
             NN+  I ++    +I    + + + N++IK+ F  I  KN +L + + + +  +  S+
Sbjct: 813 FINNMSSIKKNV---EIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSI 869

Query: 893 KKLNELDTSIRTVLKD 908
              + L  +++ V K+
Sbjct: 870 DSFDNLKEAMQNVFKN 885

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  260 bits (664), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 248/476 (52%), Gaps = 118/476 (24%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR RNQ+EID KSSVVV+     G++ +  N++         N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY-------NEE 130
           G  + Q  IF+ +A     + I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRI 190
           L + AGIIPR+L +L                                             
Sbjct: 120 LGEHAGIIPRVLVQL--------------------------------------------- 134

Query: 191 FDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTK 250
           F SL  DS SN +N S K      +FL+  L NE   R +++ S+         N+ ++ 
Sbjct: 135 FTSL-EDSISNQKNTSVKGYTVKISFLE--LYNE---RLKDLLSA---DADLPPNSGSSS 185

Query: 251 ASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLL 310
           A+  + ++ +    N DS++                 + I ++ +QE  I  A EG+ LL
Sbjct: 186 ANDPSVSSNIKIFDNKDSSD-----------------SSIIVKGMQEIFIKNAMEGLNLL 228

Query: 311 QKGLKYRQVASTKMNDFSSRSHTIFTIT-----LFKEVKGEIFRLSKMNLVDLAGSENIN 365
            KG   R+V STK+ND SSRSHTIFTIT     L  +   E  ++ K+NLVDLAGSENI 
Sbjct: 229 MKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENIT 288

Query: 366 RSGALNQRAKEAGSINQSLLTLGRVINSLADK--NVH----------------------V 401
           +SG   +R++E G IN+SLLTLGRVIN+L+DK  N H                      +
Sbjct: 289 KSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHI 346

Query: 402 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQL 457
           P+RESKLTRLLQDSLGG TKT +IATISPAK  L+ET STLEYA++A +IKN P++
Sbjct: 347 PYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETISTLEYATRAMSIKNNPKI 402

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  257 bits (657), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 253/443 (57%), Gaps = 82/443 (18%)

Query: 276 DNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIF 335
           DN K    +  +  I ++ ++E +I +A+EG+KLL +G   RQVASTK ND SSRSHT+F
Sbjct: 238 DNIKPEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVF 297

Query: 336 TITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 390
           TIT        + GE + +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRV
Sbjct: 298 TITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRV 357

Query: 391 INSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
           IN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EET STLEYA++AK+
Sbjct: 358 INALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKS 417

Query: 451 IKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTE 510
           IKN PQ+   + KD  +     E+ +++ +L +T++KDGIY+ Q+ Y             
Sbjct: 418 IKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY------------- 464

Query: 511 IQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENEL 570
                     L   N +L+ +          Q+ +I  + E +K+   K  +Q +I  E 
Sbjct: 465 ---------DLYESNCILVGE----------QKARIDNLEEQIKRFKEKYVQQVNITKET 505

Query: 571 DGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLN---YQI-----E 622
           + K+Q   K +    ++ ++            K LL+ SL Y+ +K N   ++I     +
Sbjct: 506 EQKLQ---KIDLSYQQVWEK------------KQLLESSLDYLQQKCNSFEHEITEIHHK 550

Query: 623 NFK--DQGINQNFTVDENL-----------QLIKSEMTNLLSTAR--DNFEKFYQECITK 667
           N K  D  +++  T+ E+L             I  E+T L +  +  +N+ K ++  +  
Sbjct: 551 NLKILDSIVDERDTISEDLVQKYRYITETDHCITKELTTLKNVKKTLNNYNKSFKGVLKS 610

Query: 668 FLSDTPLLFDEINDNVLNLKALT 690
                  +F E+ D V+NL A+T
Sbjct: 611 -------VFQELQDKVINLSAVT 626

 Score =  156 bits (395), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 116/193 (60%), Gaps = 10/193 (5%)

Query: 12  PQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTY 71
           P     NI V VRCR RN+REI  KSSVV++     G   +  N S     +     KTY
Sbjct: 48  PDSPGYNIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTY 107

Query: 72  TVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL----- 126
           T D+VFG  + Q ++F+ +A+   S+ ++GYNCT+  YG T TGKTYTM+GD  +     
Sbjct: 108 TFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTT 167

Query: 127 YNEE-----LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 181
           +N +     LS+ AGIIPR+L  LF+ L+  + D+ VK SF+ELYNE LKDLL      D
Sbjct: 168 HNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKED 227

Query: 182 NGNFKKLRIFDSL 194
           + N + +RIFD++
Sbjct: 228 DNNAESIRIFDNI 240

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  252 bits (644), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 142/325 (43%), Positives = 211/325 (64%), Gaps = 43/325 (13%)

Query: 270 NKFSPADNDK--STIQSDQTA----GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTK 323
           N  +P ++ +   ++++D+T+     I+++ ++E +I +A+EG+KLL  G   R+VA+TK
Sbjct: 225 NGMAPPESIRIYDSLKTDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATK 284

Query: 324 MNDFSSRSHTIFTITL----FKEVKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAG 378
            ND SSRSHTIFTIT        + GE + ++ K+NLVDLAGSENINRSGA N+RA+EAG
Sbjct: 285 CNDLSSRSHTIFTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAG 344

Query: 379 SINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEET 438
            IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET
Sbjct: 345 LINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEET 404

Query: 439 CSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 498
            STLEYA++AK+IKN PQ+   + K+  +     E+ +++ +L ++ SK+GIY+ Q+ ++
Sbjct: 405 VSTLEYATRAKSIKNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE 464

Query: 499 ELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYA 558
                             T ES    N++L+++          Q+ KI  + E +++L  
Sbjct: 465 ------------------TYES----NSILVEE----------QQAKIDNLQEQLRRLKE 492

Query: 559 KIERQQSIENELDGKIQIFTKTNSK 583
           K   Q  +  E DG+I+     N K
Sbjct: 493 KFLEQTKLIKEKDGQIKELDVANRK 517

 Score =  156 bits (395), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 130/212 (61%), Gaps = 27/212 (12%)

Query: 7   SSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMG--SKEVAINTSEDIGFTA 64
           SS +   E E NI V VRCR RN+REI  KSSVV++    +G   +EV I T+   G   
Sbjct: 43  SSQQSEGEPEYNIKVYVRCRSRNEREIREKSSVVIST---LGNNGREV-ILTNPGTG--- 95

Query: 65  QMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE 124
             ++KTYT D+VFG  + Q  +F+++A    ++ I+GYNCT+  YG T TGKTYTM+GD 
Sbjct: 96  --SNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDI 153

Query: 125 KLYNEE--------LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL-- 174
            +            LS+ AGIIPR+L +LF  L +++ED+ VK SF+ELYNE+L+DLL  
Sbjct: 154 TMMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVD 213

Query: 175 HGDCNNDNGNF------KKLRIFDSLGRDSRS 200
             D + ++ NF      + +RI+DSL  D  S
Sbjct: 214 DKDVSLEDHNFNGMAPPESIRIYDSLKTDRTS 245

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 94/237 (39%), Gaps = 64/237 (27%)

Query: 486 SKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRI- 544
           +KDG+     H KEL  DL++ K E  +  +T+E                    +LQ+I 
Sbjct: 728 TKDGLI---SHKKELEADLESQKREHFDIAQTME-------------------EQLQKIV 765

Query: 545 --KIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKF 602
             + Q + ESMK  Y  + +Q  +E EL                     KN E  + SK 
Sbjct: 766 GKERQNIQESMKASYDFLMKQM-VETEL-------------------RQKNFEESIVSKV 805

Query: 603 KTLLDHSLSYVSKKLNYQIENFKDQGIN-----------QNFTVDENLQLIKSEMTNLLS 651
           K LL HS + +SK  +Y +    D  I              F++  +LQ  + +++ +  
Sbjct: 806 KGLLSHSNNGMSKMSSYAVGRLYDSAIGGVNSIENTVSSATFSMKNDLQEFQMDISPICD 865

Query: 652 TAR--DNF---EKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSD 703
           + R  D F   E    E I + L  TP L D I     NL  L     +Q A  +SD
Sbjct: 866 SRRFGDEFTAVETRISEAIREEL--TPKLQD-ITSKACNLIGLGVQDINQKALGVSD 919

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  246 bits (627), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 202/317 (63%), Gaps = 44/317 (13%)

Query: 290 IYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL----FKEVKG 345
           I ++ ++E +I +A+EG+KLL +G   R+VA+T+ ND SSRSHTIFTIT        + G
Sbjct: 255 IMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTKIHPISG 314

Query: 346 EIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           E + ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + H+P+R
Sbjct: 315 EQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 374

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGG TKT +IAT+SPAK ++EET STLEYA++AK+IKN PQ+   + K+
Sbjct: 375 ESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQINQLMAKE 434

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
             +     E+ K++ +L +  +K+GIY+ ++ Y+                  T ES    
Sbjct: 435 SCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE------------------TYES---- 472

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQI-------F 577
           N +L+++          Q+ KI  + E +K+   K   Q  +  E D ++++        
Sbjct: 473 NCILVEE----------QQAKIDNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIKSINERI 522

Query: 578 TKTNSKLTKIIDEMKNR 594
           T  N KLT  +D+++ R
Sbjct: 523 TMYNKKLTDYLDKLRFR 539

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 143/265 (53%), Gaps = 29/265 (10%)

Query: 13  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 72
           +E+  NI V VRCR RN REI  KSSVVV+     G + +  N S         N+KTYT
Sbjct: 51  EEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTG-------NNKTYT 103

Query: 73  VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 132
            D+VFG  + Q  +FD++A    ++ ++GYNCT+  YG T TGKTYTM+GD  +    L 
Sbjct: 104 FDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLE 163

Query: 133 DS--------AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN--DN 182
           D         AGIIPR+L +LF+ L++ +ED+ VK SF+ELYNE+L+DLL  D     D 
Sbjct: 164 DPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLIDE 223

Query: 183 GNF--------KKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIAS 234
           G          + +RI+D+L  D RSNS  +S  +      +++       LL      S
Sbjct: 224 GGIGGGVANSPETIRIYDNLKLD-RSNSSGHSIMVKGMEEMYIRSAQEGLKLLME---GS 279

Query: 235 SKRSSMQTIRNTTTTKASATTTTTT 259
            KR    T  N  ++++    T TT
Sbjct: 280 LKRKVAATRCNDLSSRSHTIFTITT 304

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  243 bits (621), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 164/212 (77%), Gaps = 5/212 (2%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTI----TLFKEV 343
           + I ++ ++E +I +A EG++LL +G   R+VASTK+ND SSRSHTIFTI    T    V
Sbjct: 338 SSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPV 397

Query: 344 KGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVP 402
            G+ F +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D++ H+P
Sbjct: 398 TGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIP 457

Query: 403 FRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM 462
           +RESKLTRLLQDSLGG TKT +IAT+SPAK++LEET STLEYA++AK+IKN PQ+   + 
Sbjct: 458 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLS 517

Query: 463 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 494
           KD  +     E+ +++++L   ++K+GIY+ Q
Sbjct: 518 KDTFIHEYINEIDRLRNELKLARTKEGIYITQ 549

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  242 bits (617), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 180/491 (36%), Positives = 270/491 (54%), Gaps = 71/491 (14%)

Query: 287 TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL----FKE 342
           ++ I ++ ++E +I +A +G++LL  G   R+VA+TK ND SSRSHT+FTIT        
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 343 VKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHV 401
           V GE + +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D   H+
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 402 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFI 461
           P+RESKLTRLLQDSLGG TKT +IATISPAK++++ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 462 MKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY----------KELTTDLQNYKTEI 511
            KD  +     E+ +++ +L +++ KDGI + Q  +           E  T +QN + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 512 QECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELD 571
           Q  K      T  N    K+  +  + NELQ I++++      +L + +E  QS  N   
Sbjct: 479 QRFKDKYVKQTELN----KNLESRLKQNELQTIQLKSQR---TQLLSLLENFQSNSNHY- 530

Query: 572 GKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQ 631
             I+  TK +   T +I ++  + +        L + S++YV K +   +    DQ    
Sbjct: 531 --IERVTKIHDSNTHLIQQLAQQRS-------ELHNGSITYV-KSVTEAMSGISDQ---- 576

Query: 632 NFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLN-----L 686
                   Q   SE+ N+L +  D F    +  IT        +F E+ D V +     L
Sbjct: 577 --------QKELSELRNVLQSYNDKF----KHVITG-------IFTELEDKVKDTRKSTL 617

Query: 687 KALTSN----YYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHEL------LNKYIN 736
           + LTS         I E   D+S  +   K+  T++     K HQ  +      +N+Y +
Sbjct: 618 EPLTSMNLRLILDMIGELRDDISTRFEMLKKPRTEDTTKIFKAHQDIIETCFSHINEYCD 677

Query: 737 NTQTVIESSSN 747
           + + V+ +S N
Sbjct: 678 SMEKVLTTSIN 688

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 110/188 (58%), Gaps = 16/188 (8%)

Query: 19  ITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFG 78
           I V VRCR RN+REI  KSSVV++    +G+ +       +         +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 79  PSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE-------- 130
             + Q  +F++ A+    + ++GYNCT+  YG T TGKTYTM+GD  +   +        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRI 190
           L + AGIIPR+L +LF  L+  NE + VK SF+ELYNE LKDLL  + + +    + +RI
Sbjct: 178 LGEHAGIIPRVLVELFRWLDG-NEGYSVKVSFLELYNERLKDLLASEQSEE----ENIRI 232

Query: 191 FDSLGRDS 198
           FD++   S
Sbjct: 233 FDNVSASS 240

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  241 bits (616), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 199/622 (31%), Positives = 327/622 (52%), Gaps = 86/622 (13%)

Query: 266 NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 325
           NDS  +    DN+      +  + I ++ +QE  I +A EG+ LL +G   R+VA+TK N
Sbjct: 223 NDSKKQIRIFDNN------NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCN 276

Query: 326 DFSSRSHTIFTIT--LFKEVKGE------IFRLSKMNLVDLAGSENINRSGALNQRAKEA 377
           D SSRSHT+FTIT  + ++   E        ++ K+NLVDLAGSENINRSGA N+RA+EA
Sbjct: 277 DLSSRSHTVFTITTNIIEQDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEA 336

Query: 378 GSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 437
           G IN+SLLTLGRVIN+L D + H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EE
Sbjct: 337 GLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEE 396

Query: 438 TCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY 497
           T STLEYA++AK+IKN PQ+   + KD  LK+   E+ K+++DL ++++K GI++ Q   
Sbjct: 397 TASTLEYATRAKSIKNSPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQL 456

Query: 498 ----------KELTTDLQNYKTEIQECK-RTIESLTSQNALLLKDKRTINENNELQ---- 542
                      E    + N + +I++ K + +  L   N L  + ++ IN          
Sbjct: 457 DLYESNSILIDEQNLKIHNLREQIKKFKEKYLNQLDINNFLQSEKEKLINIIRNFHVDFS 516

Query: 543 --RIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL------TKIIDEMKNR 594
              ++IQ ++ S  ++  +I +Q+ + ++++ + Q  T  N +L       + +D ++N 
Sbjct: 517 NFNLEIQKIHRSNLEVMTEITQQRDL-SQVNSRRQYTTNQNLQLEISNQVLQTLDTLQNS 575

Query: 595 EALVNSKFKTLLDHSLSYVSKKLNYQIENFK---DQGINQNFTVDENLQLIK-----SEM 646
               NSKF  +++     V+++L+  + + K   D  +   F    NL  IK     S +
Sbjct: 576 LMNYNSKFSQVING----VTEELSLNVNSHKVKHDSTLESLFNTTANLLTIKMNELVSSI 631

Query: 647 TNLLSTARDNFEKFY-----------QECITKFLSDTPLLFDEINDNVLNLKALTSNYYS 695
           +  L+  R++    Y           Q  ++K  +D     D I  ++LN     S   +
Sbjct: 632 SQSLANIRNDSLSHYNKDLNEIYQSHQRFLSKLQNDIKSCLDSIGSSILNSINEISQTCT 691

Query: 696 QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQN 755
               +++DL+  + +    + ++ + Q +  ++ELLN+                   + N
Sbjct: 692 TNLNSMNDLTSHHQSVATEMIEKQHLQIEKLKNELLNE-----------------RKVSN 734

Query: 756 LLNEHLRANKELIINSLSNVTTEL---MSNELDRLKPKLSK-----WEESAELINRSDAL 807
             ++     KE   N +S   TEL    +  + +LK K SK     W+E+  + N +   
Sbjct: 735 QFHKQSTRLKEYFQNHVSRTRTELDDEFNEFISKLKEKQSKLDQEIWQETESIFNETGKE 794

Query: 808 NNEFNDNVESSMTTMTDKIKQT 829
            N  + +  S++T   + I QT
Sbjct: 795 VNAIHSSSISTLTENAETILQT 816

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 117/187 (62%), Gaps = 13/187 (6%)

Query: 16  ELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDK 75
           E NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQ 106

Query: 76  VFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY-------N 128
           VFG  + Q ++F   A+    + + GYNCT+  YG T TGKTYTM+GD  +        N
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDN 166

Query: 129 EELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNF 185
             L + AGIIPR+L  LF+ L  LN+++ VK SF+ELYNE LKDLL  + ++D   N + 
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDSK 226

Query: 186 KKLRIFD 192
           K++RIFD
Sbjct: 227 KQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  241 bits (614), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 197/604 (32%), Positives = 321/604 (53%), Gaps = 77/604 (12%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT---LFKEVK 344
           + I ++ +QE  I +A EG+ LL +G   R+VA+TK ND SSRSHT+FTIT   + ++ K
Sbjct: 238 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 297

Query: 345 GE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV 399
                    ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 298 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 357

Query: 400 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGS 459
           H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET STLEYA++AK+IKN PQ+  
Sbjct: 358 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 417

Query: 460 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHY----------KELTTDLQNYKT 509
            + KD  LK+   E+ K+++DL ++++K GI++ Q              E    + N + 
Sbjct: 418 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLRG 477

Query: 510 EIQECKRTIESLTSQNALLLKDKRTI------------NENNELQRIK---IQTMNESMK 554
           +I++ K    +    N  L  +K  +            N N+E+Q+I    ++ MNE   
Sbjct: 478 QIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHTNLELMNE--- 534

Query: 555 KLYAKIER---QQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSLS 611
                ++R   Q++ + +     ++ TK   ++ + +  +++     NSKF  +++    
Sbjct: 535 ---ITLQRDLSQETSQEQYTTSQELQTKITQQVLQTLSTLQSSLMNYNSKFSQVINGVTE 591

Query: 612 YVSKKLNYQ-------IENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQEC 664
            +S+ +N+        +E+  D   NQ  T+  N +L+   +++ L   RD+    Y + 
Sbjct: 592 ELSRNVNFHKLKHDSALESLFDTSANQ-LTIKLN-ELVNG-ISHSLKHFRDDSVSHYNKD 648

Query: 665 ITK-FLSDTPLLFDEIN------DNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITD 717
           + + +LS    L D  N      D++ +L   + N  SQ      D      +  QF+  
Sbjct: 649 LNEVYLSHKQFLKDLENDIKNCLDSIGSLIVASINEISQTCTTSLDSVNSLTSNHQFVVT 708

Query: 718 EFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTT 777
           E   ++     +L    I  T+  I +  +  ++ ++    EH+   +  + +  +    
Sbjct: 709 ELVEKQDLEIKKLKKDLI--TERRISNQFSQQLTRLKKYFQEHVSKTRVELYDEFN---- 762

Query: 778 ELMSNELDRLKPKLSK-----WEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 832
           E ++N    LK K SK     W ++A + N +D   NE N+    S+T++T   K T   
Sbjct: 763 EFINN----LKEKQSKLDQDIWHKTAAIFNETD---NEVNEIYTDSITSLTQSAKATLQV 815

Query: 833 INNN 836
           ++ N
Sbjct: 816 VSQN 819

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (62%), Gaps = 13/185 (7%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 107

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE------- 130
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +  +        
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNFKK 187
           L + AGIIPR+L  LF+ L  LN+++ VK +F+ELYNE LKDLL  + ++D   N + ++
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKRQ 227

Query: 188 LRIFD 192
           +RIFD
Sbjct: 228 IRIFD 232

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  241 bits (614), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 164/215 (76%), Gaps = 8/215 (3%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT---LFKEVK 344
           + I ++ +QE  I +A EG+ LL +G   R+VA+TK ND SSRSHT+FTIT   + ++ K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 345 GE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV 399
                    ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 400 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGS 459
           H+P+RESKLTRLLQDSLGG TKT +IAT+SPAK+++EET STLEYA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 460 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 494
            + KD  LK+   E+ K+K+DL ++++K GI++ Q
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQ 453

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 113/185 (61%), Gaps = 13/185 (7%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR RN+REID KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE------- 130
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +  +        
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND---NGNFKK 187
           L + AGIIPR+L  LF+ L  LN ++ VK SF+ELYNE LKDLL    ++D   N   ++
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQ 228

Query: 188 LRIFD 192
           +RIFD
Sbjct: 229 IRIFD 233

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  240 bits (613), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 164/215 (76%), Gaps = 8/215 (3%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT---LFKEVK 344
           + I ++ +QE  I +A EG+ LL +G   R+VA+TK ND SSRSHT+FTIT   + ++ K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 345 GE-----IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV 399
                    ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 400 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGS 459
           H+P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET STLEYA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 460 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQ 494
            + KD  LK+   E+ K+++DL ++++K GI++ Q
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 453

 Score =  140 bits (352), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 100/161 (62%), Gaps = 10/161 (6%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR RN+REI+ KSSVV++     G KE+ ++      +++  + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY-------NEE 130
           G  + Q  +F+  A+    + + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELK 171
           L + AGIIPR+L  LF+ L  LN+++ VK SF+ELYNE LK
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLK 209

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  240 bits (613), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 202/329 (61%), Gaps = 41/329 (12%)

Query: 287 TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTI----TLFKE 342
           ++ I ++ ++E +I +A EG++LL  G   R+VASTK ND SSRSHT+FTI    T    
Sbjct: 286 SSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDP 345

Query: 343 VKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHV 401
           + GE + +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + H+
Sbjct: 346 ISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 405

Query: 402 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFI 461
           P+RESKLTRLLQDSLGG TKT +IATISPAK+++EET STLEYA +AK+IKN PQ+   +
Sbjct: 406 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSM 465

Query: 462 MKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESL 521
            KD  +    +E+ +++ +L +++ KDGI + Q                          L
Sbjct: 466 SKDTCINEYVSEIERLRLELKTSRQKDGICITQDQL----------------------DL 503

Query: 522 TSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI----QIF 577
              N +L+ +++T          KI  M E ++K   K  RQ  +   L+  +    Q+ 
Sbjct: 504 YESNGILVDEQKT----------KIHNMEEQIQKFKEKYVRQTELNKNLESNLKENEQVT 553

Query: 578 TKTNSKLTKIIDEMKNREALVNSKFKTLL 606
            +  S+  +++D ++N +   NS  + +L
Sbjct: 554 KQLRSEKYQLMDLLENYQINSNSFVQRVL 582

 Score =  142 bits (359), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 110/182 (60%), Gaps = 16/182 (8%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR R++REI  KSSVV++     G++ +  N S  + +      K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD-EKLYNEE------ 130
           G  + Q  +F++ A+   S+ + GYNCT+  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRI 190
           L + AGIIPR+L  LF+ L  L  D+ VK SF+ELYNE LKDL   + + +    + +RI
Sbjct: 224 LGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLFAQNESEE----ETIRI 278

Query: 191 FD 192
           FD
Sbjct: 279 FD 280

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  238 bits (607), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 160/390 (41%), Positives = 224/390 (57%), Gaps = 68/390 (17%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK----EV 343
           + I ++ ++E +I +A EG++LL +G   R+VASTK ND SSRSHTIFTIT        V
Sbjct: 252 SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPV 311

Query: 344 KGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVP 402
            GE + ++ K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVIN+L D + H+P
Sbjct: 312 SGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIP 371

Query: 403 FRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIM 462
           +RESKLTRLLQDSLGG TKT +IAT+SPAK+++EET STLEYA++AK+IKN PQ+   + 
Sbjct: 372 YRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMS 431

Query: 463 KDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLT 522
           KD+ +     E+ +++ +L +++ KDG+Y+ Q+ +                       L 
Sbjct: 432 KDVCINEYVQEIERLRQELKASRQKDGVYITQEQF----------------------DLY 469

Query: 523 SQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNS 582
             N +L+ +          Q+ KI  M E +KK   K   Q +I  EL+           
Sbjct: 470 ESNGILVDE----------QKAKIVNMEEQIKKFKEKYVNQTAINKELETS--------- 510

Query: 583 KLTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLI 642
                   +KN + L N     LLD   S +S    YQ  NFK      N   + NL LI
Sbjct: 511 --------LKNSQELSND----LLDKQASLISIFGEYQ-SNFKLFETEINTIHENNLNLI 557

Query: 643 KSEMTNLLSTARDNF----EKFYQECITKF 668
                +L+ST R++     +K+Y   +  F
Sbjct: 558 -----DLISTERNDLQLSSQKYYDFLVETF 582

 Score =  145 bits (367), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 108/182 (59%), Gaps = 15/182 (8%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI V VRCR RNQREI+ KSSVV++     G KEV ++   D         KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 78  GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE-------E 130
           G  + Q ++F+  A+    + ++GYNCT+  YG T TGKTYTM+GD  +  +        
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRI 190
           L + AGIIPR+L  LF+ L + + ++ VK SF+ELYNE LKDLL      +    + +RI
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE----ESIRI 230

Query: 191 FD 192
           FD
Sbjct: 231 FD 232

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  236 bits (602), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 185/291 (63%), Gaps = 37/291 (12%)

Query: 290 IYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF----KEVKG 345
           I ++ ++E +I +A EG++LL KG   R+VA+TK ND SSRSHTIFTI         V G
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 346 EIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           E + ++ K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVIN+L + + H+P+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
            SKLTRLLQDSLGG TKT +IATISPA+++++ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
             +     E+ +++ +L +++ ++G+Y+ Q+ Y                       L   
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY----------------------DLYES 485

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQ 575
           N+LL+++          Q++ IQ M E +K+   K   Q  +  E   + Q
Sbjct: 486 NSLLVEE----------QKVVIQNMGEQIKRFKEKYVEQTKLSKEAHRQFQ 526

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  236 bits (601), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 191/291 (65%), Gaps = 37/291 (12%)

Query: 290 IYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL----FKEVKG 345
           I ++ ++EF+I +A EG++LL  G   R+VA+TK ND SSRSHT+FTIT        V  
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 346 EIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404
           E + ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN+L D + H+P+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464
           ESKLTRLLQDSLGG TKT +IATISPAK++++ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524
             L     E+ +++ +L +++ K+G+Y+ +  ++                      L   
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ----------------------LYES 465

Query: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQ 575
           N++L+++          Q+++IQ M + + K  AK   Q ++  + + +++
Sbjct: 466 NSILVEE----------QKVRIQNMEDQILKFKAKYVEQTNLSKDAEKRLK 506

 Score =  146 bits (369), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/192 (41%), Positives = 118/192 (61%), Gaps = 15/192 (7%)

Query: 8   SDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMN 67
           S++Q      N+ V VRCR RN++EI+ KSSVV++    +G+K   +  S   G  +  +
Sbjct: 31  SEQQEGRVSSNMRVYVRCRSRNEQEIEEKSSVVIST---LGAKGREVILSNGAGSLSH-S 86

Query: 68  SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 127
            +TYT D+VFG  + Q  +FDE+A+   S+ ++GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 87  KRTYTFDQVFGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL 146

Query: 128 NE-------ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNN 180
            +        L + +GIIPR+L  LF+ L +   ++ VK SF+ELYNE+LKDLL  +   
Sbjct: 147 GDLDSQDKILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL-AESEQ 205

Query: 181 DNGNFKKLRIFD 192
           +  N   +RIFD
Sbjct: 206 EEEN---IRIFD 214

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  141 bits (356), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 123/200 (61%), Gaps = 8/200 (4%)

Query: 266 NDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 325
           N+        D  K  ++       +++ L EF +   +E ++ +++G + R V  T MN
Sbjct: 173 NEQVRDLLSEDGSKCRVRERADKTTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMN 232

Query: 326 DFSSRSHTIFTITLFKE---VKGEIF-RLSKMNLVDLAGSENINRSGALNQRAKEAGSIN 381
           + SSRSH IFTI++ +    + G++  R S + LVDLAGSE ++ +GA   R KE  +IN
Sbjct: 233 NSSSRSHAIFTISIKQSETTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNIN 292

Query: 382 QSLLTLGRVINSLADKNVH--VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETC 439
           +SL TLGRV++ LA KN    +P+R+S LT +L+++LGGN+KT +IA +SP     EET 
Sbjct: 293 KSLTTLGRVVSVLAKKNRPKLIPYRDSALTWVLKENLGGNSKTVMIACVSPCD--YEETI 350

Query: 440 STLEYASKAKNIKNKPQLGS 459
           STL YA+ AK +KN  ++ S
Sbjct: 351 STLRYATTAKEVKNTARVNS 370

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 84/181 (46%), Gaps = 22/181 (12%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI VAVR R    RE        VT P     ++  I+TS  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 78  ----GPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE--------- 124
                 S  Q +I+D I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 125 KLYNEELSDSA-GIIPRILFKLFETLEKLN--EDHI-----VKCSFVELYNEELKDLLHG 176
              +  + DSA GIIPR+   LF+     N  ED I     + CS++E+YNE+++DLL  
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 177 D 177
           D
Sbjct: 183 D 183

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK---GEI 347
           +++ LQEF + +  E +  L++G + + V +T +N+ SSRSHTIFTI + ++     G +
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 348 F-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVH--VPFR 404
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA K     +P+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQL 457
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCD--FEETMSTLRYATLARSVKTFAQL 339

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 56/99 (56%), Gaps = 15/99 (15%)

Query: 83  QSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRIL 142
           Q+ +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 143 FKLFETLE-------KLNEDHIVKCSFVELYNEELKDLL 174
            +LFE  E       + +    ++CS++E+YNE ++DLL
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  133 bits (334), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 133/220 (60%), Gaps = 13/220 (5%)

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRL 350
           ++Q++  F +   +E ++ L  G   R VAST+MN  SSRSH IFT+++ ++      R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 351 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINSLADKNVH-VPFRESK 407
           S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ LA  + H +P+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 408 LTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFI------ 461
           LT +L+++LGGN+KT +IA ISP  + LEE+ STL YA+ AK IK +  +   +      
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 462 MKDILLKNITT--ELTKIKSDLLSTKSKDGIYMDQQHYKE 499
           MK  +    ++  EL  +KS++ S +S+  I  +Q    E
Sbjct: 327 MKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHE 366

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (46%), Gaps = 32/190 (16%)

Query: 69  KTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYN 128
           +++  D +F  S++Q+ I  E+        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 129 EELSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGDCNNDNGNFK 186
              + + GIIP +   LF+ LE L++  +  V  ++ E+YNE+L DLL GD +       
Sbjct: 90  ---NSNPGIIPLLCRDLFDALE-LDKTTVSSVSITYFEIYNEKLIDLL-GDTS------- 137

Query: 187 KLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNT 246
                       R    N+      + TTF  K  R E +L   +I  SKRS   T  N 
Sbjct: 138 -----------PRVRETNDKKTFVQDITTF--KVNRVEEVLEYLSIGDSKRSVASTRMNM 184

Query: 247 TTTKASATTT 256
            ++++ A  T
Sbjct: 185 ESSRSHAIFT 194

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  133 bits (334), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 116/173 (67%), Gaps = 8/173 (4%)

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK---GEI 347
           +++ L+EF +++ ++ +  +++G + R + ST +N++SSRSHTIFTI++ ++ K   G +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 348 F-RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVH--VPFR 404
             R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     +P+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQL 457
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCD--YEETLSTLRYATLARNVKTCAQL 339

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 93/192 (48%), Gaps = 35/192 (18%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVF 77
           NI VAVR R   +RE+D   S++  V D         N  +      +  ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDG--------NVIQVKDRNQKNETRSFHFDQCF 53

Query: 78  GPS----ATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
             S    A Q  ++++++       + GY+  +  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 134 SAGIIPRILFKLFETLE-------KLNEDHIVKCSFVELYNEELKDLLH-GDC----NND 181
           S GI+ R+  +LFE  E       ++N    ++CS++E+YNE ++DLL  G C      D
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 182 NGNF-KKLRIFD 192
              F + LR FD
Sbjct: 166 KTTFVEGLREFD 177

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 115/189 (60%), Gaps = 9/189 (4%)

Query: 274 PADNDKS-TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSH 332
           PAD   S ++   + +GIY++ L   ++T+ +E +  +++G   R V+ST MN  SSRSH
Sbjct: 180 PADKRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSH 239

Query: 333 TIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 391
           +I  I L K     E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VI
Sbjct: 240 SIVRINLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVI 299

Query: 392 NSLAD-------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 444
           N+L          + H+P+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL +
Sbjct: 300 NALTQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRF 359

Query: 445 ASKAKNIKN 453
            S+AK IKN
Sbjct: 360 GSRAKKIKN 368

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 69/115 (60%), Gaps = 11/115 (9%)

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
           + Q N + +T D+VF   +TQ  +++ +A  +   F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 123 DEKLYNEELSDSAGIIPRILFKLFETLEKLN-EDHI--VKCSFVELYNEELKDLL 174
            +        ++ G+IPRI   +F+ +E  + ED I  V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 109/179 (60%), Gaps = 6/179 (3%)

Query: 281 TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 340
           TI    T G+Y+Q+     ++   E +  +  G   R  +ST MN  SSRSH I  I L 
Sbjct: 207 TIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLL 266

Query: 341 KE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKN 398
           K   ++G I + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VIN+L  K+
Sbjct: 267 KRDNLEGSIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKD 325

Query: 399 ---VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNK 454
               H+P+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+NK
Sbjct: 326 KKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 13/131 (9%)

Query: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
           G   +  S+++  D VFG ++TQ  ++D +AE +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYNEELKDLLHG 176
            G          D+ G+IPRI  ++FE +  L      +++V  SF+E+Y E++ DLL G
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL-G 187

Query: 177 DCNNDNGNFKK 187
           +  N + + KK
Sbjct: 188 ESINKSASPKK 198

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 129/449 (28%), Positives = 185/449 (41%), Gaps = 110/449 (24%)

Query: 13  QEEELNITVAVRCRGRNQREIDAKSSV-VVTVPDIMGSK--EVAINTSEDIGFTAQMNSK 69
           QE   NI V  R R    RE    + + V    D  G++  EVA N     G+ +    +
Sbjct: 349 QELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKN-----GYGS--GPQ 401

Query: 70  TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE 129
            +  D++F    T   +F EI + L    + GYN  +  YG T +GKTYTM         
Sbjct: 402 IFKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 451

Query: 130 ELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDNGNFK 186
            L+ + GIIP  +  +F   + L E    + V C FVE+YNE + DLL            
Sbjct: 452 -LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL------------ 498

Query: 187 KLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNT 246
                    R     + + S   +N+NT                 I  ++ +   TI N 
Sbjct: 499 ---------RREEKPAGSASGDDTNSNTKL--------------EIRHNQETKETTITNV 535

Query: 247 TTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEG 306
           TT   ++  T   +        ANK     +     +S ++  I+I +L   ++ T +  
Sbjct: 536 TTVPLTSKNTVDELLK-----RANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGE-- 588

Query: 307 IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 366
                                  RSH I                   NLVDLAGSE IN 
Sbjct: 589 -----------------------RSHGIL------------------NLVDLAGSERINT 607

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTA 423
           S  + +R +E  SIN+SL  LG VI++L   +    H+PFR SKLT LLQ SL GN+KT 
Sbjct: 608 SQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTL 667

Query: 424 LIATISPAKVTLEETCSTLEYASKAKNIK 452
           +   IS       ET ++L +ASK  + K
Sbjct: 668 MFVNISGNPNHTNETLNSLRFASKVNSTK 696

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  125 bits (313), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 107/178 (60%), Gaps = 5/178 (2%)

Query: 281 TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 340
           T+    T G+Y++      ++   E +  +  G   R   ST MN  SSRSH I  I L 
Sbjct: 180 TVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLL 239

Query: 341 KE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA--D 396
           K   ++G I + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VIN+L   +
Sbjct: 240 KRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKE 298

Query: 397 KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNK 454
           K  H+P+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK
Sbjct: 299 KRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 81/161 (50%), Gaps = 16/161 (9%)

Query: 34  DAKSSVVVTVPDIM--GSKEVAINTSEDIGFTAQMN-SKTYTVDKVFGPSATQSLIFDEI 90
           D K  VVV +  +   GS  V       + F    + ++ +  D VFG  A Q  +FD +
Sbjct: 20  DDKMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYV 79

Query: 91  AEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLE 150
           AE +   F  GYN T+L YG T +GK+YTM G             G+IPRI  ++FE + 
Sbjct: 80  AEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIG 131

Query: 151 KLNE----DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK 187
            L      +++V  SF+E+Y E++ DLL G+  N   + KK
Sbjct: 132 LLKNCADIEYVVSVSFLEIYLEKVYDLL-GESINKASSPKK 171

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 107/172 (62%), Gaps = 7/172 (4%)

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTI----TLFKEVKGE 346
           YI+ L +  + + +E +K +++G   R VA T +N+ SSRSH I TI    T        
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 347 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV-HVPFRE 405
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L++  V  VP+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 406 SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQL 457
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCD--YEESISTLRYASTAKHVRTEAHL 342

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 86/173 (49%), Gaps = 27/173 (15%)

Query: 18  NITVAVRCRGRNQREIDAKSSVVV--TVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDK 75
           NI VA+R R +  RE  ++ SV+   T  +I   K+   N    +         T+  D+
Sbjct: 4   NIKVAIRIRDKISRET-SRPSVIKRKTSNEITLQKDNTANVITTV-------EHTFYFDQ 55

Query: 76  VFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSA 135
           VF  S+ Q  I+ E+A       ++GY+  ++ YG T  GKTYTM G E+          
Sbjct: 56  VFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EP 107

Query: 136 GIIPRILFKLFETL-----EKLNEDHIVK----CSFVELYNEELKDLLHGDCN 179
           GIIP +  +LF+ +     E  +ED +V      S+ ++YNE++ D+L G CN
Sbjct: 108 GIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCN 160

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 130/422 (30%), Positives = 205/422 (48%), Gaps = 52/422 (12%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D    I + NL +   TT +E + L+ +G   R  + T+ N+ SSRSH +  I 
Sbjct: 261 KLIIREDTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIH 320

Query: 339 LFK-----EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINS 393
           + +     ++K E      ++++DLAGSE    +     R  E  +IN+SLL LG  IN+
Sbjct: 321 IVQKNRTPDIKEE-HTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINA 379

Query: 394 LA------DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 447
           L           HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++
Sbjct: 380 LCINGNDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANR 439

Query: 448 AKNIKNK---------PQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 498
           AK IK K           +GS+      LK IT +  +I+ +L S ++K    M Q    
Sbjct: 440 AKEIKTKIIRNQQSLNRHVGSY------LKMITEQKKEIE-ELRSRENK----MIQFQLD 488

Query: 499 ELTTDLQNYKTEIQECKRTIESLTSQ----------NALLLKDKRTINEN-NELQRIKIQ 547
           +     Q     I +C   +    +Q           +L+L  +R +     E+++  IQ
Sbjct: 489 KYKLSRQQIAVAITDCVNNVRFQYTQVPKFQRIKLIKSLILCKRRFLQLVLLEMKKSPIQ 548

Query: 548 TMNES--MKKLYAKIERQ-QSIENELDGKIQIFTKTNSKLTKIIDEMKNREAL-VNSKFK 603
             + S  M  L  +I+R+ + +EN+ D   ++ T   +  T  +D +K RE    + K  
Sbjct: 549 REDSSGAMASLEEQIKRKIKQLENKFDSPDELDTVITNART--VDLLKLREMENWDDKID 606

Query: 604 TL-LDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTAR--DNFEKF 660
           TL L+  L YVS++L   I     Q   + F  D  L  ++ ++  L+S  R  D F K 
Sbjct: 607 TLTLELELDYVSEQLRNDILITASQMTEKLFDEDSPLHKVELDVEGLISIDREFDEFGKQ 666

Query: 661 YQ 662
           +Q
Sbjct: 667 FQ 668

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   ATQ  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 131 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 174
             ++ GI+ + + +LF+ +E L +     +  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 106/184 (57%), Gaps = 8/184 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D   GI + NL      T ++ + L+ +G   R  + T  N+ SSRSH +  I 
Sbjct: 241 KLVIREDSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQIN 300

Query: 339 LFKEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + ++ +     E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 301 VVQKNRTAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 360

Query: 395 A----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                    HVP+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK 
Sbjct: 361 CVSGRRSTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKE 420

Query: 451 IKNK 454
           IK K
Sbjct: 421 IKTK 424

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 16/141 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   ATQ+ +++    PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 131 LSDSAGIIPRILFKLFETLEKLNED-HI-VKCSFVELYNEELKDLLHGDCNNDNGNFKKL 188
             +  G+I   + +LF+ +E L +  H  +  S++E+YNE ++DLL  D ++     KKL
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLSPDISS-----KKL 242

Query: 189 RIF-DSLGRDSRSNSRNNSPK 208
            I  DS+   S +N  +++P+
Sbjct: 243 VIREDSIKGISVANLSHHTPQ 263

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 107/185 (57%), Gaps = 9/185 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D    I + NL      T ++ + L+  G   R  ++T  N+ SSRSH +  I 
Sbjct: 234 KLVIREDSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQIN 293

Query: 339 LFKEVK-GEI---FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +  EI      +K++++DLAGSE    +    +R +E  +IN+SLL LG  IN+L
Sbjct: 294 IVQSSRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINAL 353

Query: 395 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                  +  HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK
Sbjct: 354 CISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAK 413

Query: 450 NIKNK 454
            IK K
Sbjct: 414 EIKTK 418

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 16/141 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +ATQ  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGDCNNDNGNFKKL 188
             +  G+I   + +LF  +E+L +     +  S++E+YNE ++DLL  + +      KKL
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLLSPEMSP-----KKL 235

Query: 189 RIF-DSLGRDSRSNSRNNSPK 208
            I  DS  R S +N  ++ PK
Sbjct: 236 VIREDSENRISVANLSHHRPK 256

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 106/182 (58%), Gaps = 8/182 (4%)

Query: 281 TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 340
            I+ D  + I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH +  I + 
Sbjct: 260 VIREDTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM 319

Query: 341 KEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA- 395
           +  K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L  
Sbjct: 320 QTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCL 379

Query: 396 ---DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
               ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 453 NK 454
            K
Sbjct: 440 TK 441

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +++QS ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 174
                GII   + +LF  +  L ++    +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 111/184 (60%), Gaps = 8/184 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ DQ + I + NL        ++ I L+ +G   R  + T+ N+ SSRSH++  I 
Sbjct: 200 KLIIREDQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIH 259

Query: 339 LFKEVK-----GEIFRL-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 392
           + + +K     G   ++ S ++++DLAGSE    +     R  E  +IN+SLL LG  IN
Sbjct: 260 VKQVLKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCIN 319

Query: 393 SLA--DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
           +L    K+ H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK 
Sbjct: 320 ALCINKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKE 379

Query: 451 IKNK 454
           IK K
Sbjct: 380 IKTK 383

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (52%), Gaps = 13/120 (10%)

Query: 60  IGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYT 119
           + F  + +   +  DK+F   +TQ  IF++   PL    + G+N T+  YG T  GKTYT
Sbjct: 81  VKFNKKRSETKFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYT 140

Query: 120 MTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDH-----IVKCSFVELYNEELKDLL 174
           + G         S+  GII R + +LF  +E L +D       +  S++E+YNE ++DLL
Sbjct: 141 ING--------TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 184/376 (48%), Gaps = 58/376 (15%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D    I + NL      + ++ + L+ +G   R  + T+ N  SSRSH +  I 
Sbjct: 248 KLVIREDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIH 307

Query: 339 LFKEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  K     E      ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L
Sbjct: 308 IMQRNKLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINAL 367

Query: 395 AD-----KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                  +N HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 368 CSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAK 427

Query: 450 NIKNKPQLGSFIMKDILLKNITTELTKIKSDL-LSTKSKDGI-YMDQQHYKELTTDLQNY 507
            IK K           +++N  T    + S L + T+ K  I  ++ +  + +   + NY
Sbjct: 428 EIKTK-----------VIRNHQTLNRHVASYLKMITEQKRTIDELEARQAQMVQVGITNY 476

Query: 508 KTEIQECKRTIESLTS-----------QNALLLKDKRTINENNELQRIKIQTMNESMKKL 556
           K  I++ +R+IE +             QN  LLK   T+ +   LQ I I+   E++  +
Sbjct: 477 KLAIEKIERSIEEVVGNVCKQLSSKSFQNIKLLK-ALTLTKRTLLQLIVIEV--ENVLAI 533

Query: 557 YAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKT------LLDHSL 610
            ++   Q+ IE                  ++I +M+ +  L+  +F T      +++HS 
Sbjct: 534 VSEWTDQRIIET---------------CERVIRQMQEQVKLLEDRFDTATELNLVVEHSR 578

Query: 611 SYVSKKLNYQIENFKD 626
               K+L  ++E++ D
Sbjct: 579 EIDLKRLR-EMEHWDD 593

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 10/117 (8%)

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
           T   +   +  DK+F    +Q  ++      L    + G+N T+  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 123 DEKLYNEELSDSAGIIPRILFKLFETLEKL--NEDHIVKCSFVELYNEELKDLLHGD 177
                     ++ GII R + +LF  ++ L   +D  +  SF+E+YNE + DLL  D
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLLSPD 243

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 108/185 (58%), Gaps = 9/185 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  ++ D    I + NL    ++T ++ + L+ KG   R  ++T  N+ SSRSH +  + 
Sbjct: 230 KLVLREDSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVH 289

Query: 339 LFKEVKG----EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 290 ITQRNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 349

Query: 395 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                     HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 350 CVSGRKRGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAK 409

Query: 450 NIKNK 454
            IK K
Sbjct: 410 EIKTK 414

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D+VF   ++Q  +++    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 177

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLL 174
             ++ GII   + +LF  +E+L +     +  S++E+YNE ++DLL
Sbjct: 178 -PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  117 bits (293), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 107/197 (54%), Gaps = 28/197 (14%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  ++ ++   +YI+N+ E  ++   + IK ++ G + R   ST MN  SSRSH I +IT
Sbjct: 178 KYRVRENRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSIT 237

Query: 339 LFK-----EVKGEIFRLSKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGR 389
           + +          I   S    VDLAGSE   RS A     N R KE  SIN+SL TL R
Sbjct: 238 IKRTDIDLNTNSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRR 294

Query: 390 VINSLADK--------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 435
           V+ SL  +              N+ VPFRES LT +L+D+LGGN+KT +IA ISP     
Sbjct: 295 VLTSLKKREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NF 352

Query: 436 EETCSTLEYASKAKNIK 452
           EE+ STL YA  A+ IK
Sbjct: 353 EESASTLRYADIAQTIK 369

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 16/111 (14%)

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
           D+ FG   +QS  +         D + GYNC +L YG T +GKTYTM G+ K      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 134 SAGIIPRILFKLFETLEKL----------NEDHIVKCSFVELYNEELKDLL 174
           + G+IPR    LF  +E +            ++ V CS  E+YNE++ DLL
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLL 168

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 108/184 (58%), Gaps = 12/184 (6%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D    I + NL   +  T +E I L+ KG   R  + T+ N+ SSRSH +  I + +
Sbjct: 259 IREDGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQ 318

Query: 342 -----EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA- 395
                ++  E    + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L  
Sbjct: 319 TNRTADLTSE-HTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCL 377

Query: 396 -----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                +++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK 
Sbjct: 378 TDGGTNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKE 437

Query: 451 IKNK 454
           IK K
Sbjct: 438 IKTK 441

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   A+Q  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLL 174
             +  GII R++ +LFE +E L +     +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 106/182 (58%), Gaps = 8/182 (4%)

Query: 281 TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 340
            I+ D    I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH++  I + 
Sbjct: 260 VIREDTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIM 319

Query: 341 KEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-- 394
           +  K          + ++++DLAGSE  + +     R  E  +IN+SLL LG  IN+L  
Sbjct: 320 QTNKLVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCL 379

Query: 395 --ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
               +  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 453 NK 454
            K
Sbjct: 440 TK 441

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 10/109 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +++Q  ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLLHGD 177
                GII   + +LF  +  L ++    +  S++E+YNE + DLL  +
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLLRPE 253

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 112/190 (58%), Gaps = 15/190 (7%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D+ + I + NL   +  + ++ I L+ +G   R  +ST+ N+ SSRSH +  I 
Sbjct: 296 KLIIREDKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIH 355

Query: 339 LFK-----EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINS 393
           + +     ++  E    + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+
Sbjct: 356 IMQTNTKIDLTSE-HTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINA 414

Query: 394 LA-------DKNV--HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 444
           L         +N+  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+Y
Sbjct: 415 LCIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKY 474

Query: 445 ASKAKNIKNK 454
           A++AK IK K
Sbjct: 475 ANRAKEIKTK 484

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 64/116 (55%), Gaps = 10/116 (8%)

Query: 64  AQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 123
           A+ N   +  DK+F  +++Q  ++      L    + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 124 EKLYNEELSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGD 177
           +        ++ GII R++ +LFE +E L ++    +  S++E+YNE + DLL  D
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLLKPD 291

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 140/268 (52%), Gaps = 33/268 (12%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D  + I + NL      T ++ + L+ KG   R  ++T  N+ SSRSH +  I 
Sbjct: 251 KLVIREDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIH 310

Query: 339 LFKE------VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 392
           + +           +F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN
Sbjct: 311 ISQTNRTVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCIN 368

Query: 393 SLA-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 447
           +L       ++ HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++
Sbjct: 369 ALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANR 428

Query: 448 AKNIKNKP---------QLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 498
           AK IK K           +GS+      LK IT +  +I  D L  + ++ I +  + YK
Sbjct: 429 AKEIKTKVIRNQQSLNRHVGSY------LKMITEQKKEI--DELRQREQNMIEIQLKKYK 480

Query: 499 ELTTDLQNYKTEIQECKRTIESLTSQNA 526
                +Q     + +C R I++  +Q +
Sbjct: 481 LGREKIQ---LSMDDCLRNIQNTYAQTS 505

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 10/109 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   ++Q  ++      L    + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 131 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLLHGD 177
             +  GII   + +LF+ +E + +  +  +  S++E+YNE ++DLL+ D
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPD 246

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 104/181 (57%), Gaps = 8/181 (4%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D    I + NL   H TT ++ + L+ +G   R  + T+ N+ SSRSH +  I + +
Sbjct: 261 IREDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQ 320

Query: 342 EVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 395
             K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L   
Sbjct: 321 TNKLVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLN 380

Query: 396 --DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKN 453
              +  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 381 DGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKT 440

Query: 454 K 454
           K
Sbjct: 441 K 441

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +++Q+ ++ E   PL    + GYN T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRILFKLFETLEKLNED--HIVKCSFVELYNEELKDLL 174
                G+I   + +LF  ++ L ++    +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 105/185 (56%), Gaps = 9/185 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I  D    I + NL  ++    ++ + L+ KG   R  ++T  N+ SSRSH +  I 
Sbjct: 233 KLVILEDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIH 292

Query: 339 LFKEVKGEIFR----LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +    +     + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L
Sbjct: 293 IMQHNRTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINAL 352

Query: 395 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                  ++ HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 353 CLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAK 412

Query: 450 NIKNK 454
            IK K
Sbjct: 413 EIKTK 417

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D++F   +TQ  +++    PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 131 LSDSAGIIPRILFKLFETLEKLNE-DHI-VKCSFVELYNEELKDLL 174
             ++ GII + + +LF  +E L +  H  +  SF+E+YNE ++DLL
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 23/194 (11%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D    I + NL  +   T +E + L+ +G   R  +ST  N+ SSRSH +  I 
Sbjct: 215 KLVIREDANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIH 274

Query: 339 LFKEVK--------GEIFRLSKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTL 387
           L ++ K         ++F  S ++++DLAGSE   R+ +   R +   E  +IN+SLL L
Sbjct: 275 LTQQNKLNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLAL 329

Query: 388 GRVINSL-------ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 440
           G  IN+L       + + +H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +
Sbjct: 330 GNCINALCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLN 389

Query: 441 TLEYASKAKNIKNK 454
           TL+YA++AK IK K
Sbjct: 390 TLKYANRAKEIKTK 403

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+   ++TQ  +F    EPL    + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 131 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 174
             ++ GII   L  LF  +E L +  +  +  S++E+YNE +KDLL
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLL 207

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 112/198 (56%), Gaps = 6/198 (3%)

Query: 260 MFSSGNNDSANKFSPADNDKSTIQSDQT-AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQ 318
           +  SG     N    AD+ K  I+ DQ     YI N+    + +     K+L++  K R 
Sbjct: 491 LLRSGAPSQENNDRNADS-KHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRS 549

Query: 319 VASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSK-MNLVDLAGSENINRSGALNQRAKEA 377
            AST  N+ SSRSH+IF I L  + +G   +    +NLVDLAGSE +N S  + +R +E 
Sbjct: 550 TASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRET 609

Query: 378 GSINQSLLTLGRVI---NSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 434
            SIN+SL  LG VI   NS   +  H+PFR SKLT LLQ SL G++KT +   ISPA + 
Sbjct: 610 QSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALH 669

Query: 435 LEETCSTLEYASKAKNIK 452
           L ET ++L +ASK  N K
Sbjct: 670 LNETINSLRFASKVNNTK 687

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 57/118 (48%), Gaps = 18/118 (15%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F    T   IF E+ + L    + GYN  +  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 131 LSDSAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLLHGDC----NND 181
           L+   GI+P  +  +F  ++KL      + V C F+E+YNE + DLL        NND
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENND 503

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 104/182 (57%), Gaps = 8/182 (4%)

Query: 281 TIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF 340
            I+ D    I + NL   H  T ++ + L+ +G   R  + T+ N+ SSRSH +  I + 
Sbjct: 260 VIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIM 319

Query: 341 KEVK----GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-- 394
           +  K          + ++++DLAGSE    +     R  E  +IN+SLL LG  IN+L  
Sbjct: 320 QTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCL 379

Query: 395 --ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
               ++ H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK
Sbjct: 380 NDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIK 439

Query: 453 NK 454
            K
Sbjct: 440 TK 441

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +++Q+ ++ E   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 131 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLL 174
                GII   + +LF  +  L +  D  +  S++E+YNE ++DLL
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 9/185 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D    I + NL      T +E +  + +G   R  + T  N+ SSRSH +  I 
Sbjct: 233 KLVIREDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIH 292

Query: 339 LFKEVKGEIF----RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +          + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L
Sbjct: 293 IAQTDRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINAL 352

Query: 395 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                  +  HVP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK
Sbjct: 353 CISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAK 412

Query: 450 NIKNK 454
           +IK K
Sbjct: 413 DIKTK 417

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 65/122 (53%), Gaps = 15/122 (12%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F  +A Q+ +++     L    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 180

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVK--CSFVELYNEELKDLLHGDCNNDNGNFKKL 188
             +  GII   + +LF+ +E L +   ++   S++E+YNE ++DLL     N N + KKL
Sbjct: 181 -PEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLL-----NPNVSSKKL 234

Query: 189 RI 190
            I
Sbjct: 235 VI 236

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 107/185 (57%), Gaps = 9/185 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  ++ D    I + NL    + T ++ + L+ KG   R  ++T  N+ SSRSH +  + 
Sbjct: 230 KLVLREDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVH 289

Query: 339 LFKEVKG----EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + ++ +     E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 290 ITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINAL 349

Query: 395 A-----DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
                     HVP+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK
Sbjct: 350 CAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAK 409

Query: 450 NIKNK 454
            IK K
Sbjct: 410 EIKTK 414

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 15/116 (12%)

Query: 66  MNSKT-----YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
           MNS+      +  D+VF   A+Q  +++    PL    + G+N T+  YG T  GKTYT+
Sbjct: 115 MNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTV 174

Query: 121 TGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLL 174
           +G         +++ GII   + +LF  +E+L +     +  S++E+YNE ++DLL
Sbjct: 175 SGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 104/188 (55%), Gaps = 5/188 (2%)

Query: 266 NDSANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKM 324
           NDS  K     N K  I+ DQ T    I N+    + + +    +L+K  K R  AST  
Sbjct: 533 NDSIGKDDTNTNSKHEIRHDQETKTTMITNVTSCQLESEERVDMILKKANKLRSTASTAS 592

Query: 325 NDFSSRSHTIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQS 383
           N+ SSRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+S
Sbjct: 593 NEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKS 652

Query: 384 LLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 440
           L  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET +
Sbjct: 653 LSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLN 712

Query: 441 TLEYASKA 448
           +L +ASK 
Sbjct: 713 SLRFASKV 720

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 80/169 (47%), Gaps = 21/169 (12%)

Query: 15  EELNITVAVRCRGRNQRE-IDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73
           +EL   + V CR R   E ++   + ++ V +   ++ V       I  T Q++   +  
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEVTKIQSTTQVHE--FKF 438

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM--TGDEKLYNEEL 131
           DK+F    T   +F E+ + L    + GYN  +  YG T +GKT+TM  TGD        
Sbjct: 439 DKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD-------- 489

Query: 132 SDSAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLLHGD 177
               GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  D
Sbjct: 490 ----GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRND 534

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 100/182 (54%), Gaps = 15/182 (8%)

Query: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKE 342
           DQ+   Y+ N++ F I    + I L+ K    R  +ST +N  SSRSH IF I L  +  
Sbjct: 557 DQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNH 616

Query: 343 VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-------- 394
              E   +SK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI++L        
Sbjct: 617 KTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 395 ----ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                 K  H+PFR SKLT LL+ SL G++KT +   +S  +  L ET ++L +A+K  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 451 IK 452
            K
Sbjct: 736 TK 737

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (51%), Gaps = 21/122 (17%)

Query: 67  NSKTYTV--DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE 124
           N+ TY+   D VF      S +F+EI E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 125 KLYNEELSDSAGIIP---RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 181
                 L+ + G+IP   + +F   ++L+K   ++ V C F+ELYNE + DL       D
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFR-----D 541

Query: 182 NG 183
           NG
Sbjct: 542 NG 543

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 111/212 (52%), Gaps = 11/212 (5%)

Query: 258 TTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYR 317
            + F   N    +  S     K  I+       +++ L+E  +   +E I  + KG + R
Sbjct: 146 CSFFEIYNEQVIDLLSSLSQRKCKIRERHDHSTFVEGLEEIAVHNVEELISCIHKGNENR 205

Query: 318 QVASTKMNDFSSRSHTIFTITL-----FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 372
            V ST MN  SSRSH IF I++      K+    +   S   LVDLAGSE +  + A  +
Sbjct: 206 TVRSTNMNQESSRSHAIFHISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGK 265

Query: 373 RAKEAGSINQSLLTLGRVINSLAD----KNVHVPFRESKLTRLLQDSLGGNTKTALIATI 428
             +E  SIN+SL  LGRVI+ LA+    ++  +P+RES LT +L+++LGGN+ T L+A +
Sbjct: 266 IRQEGTSINKSLSILGRVISLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACV 325

Query: 429 SPAKVTLEETCSTLEYASKAKNIKNKPQLGSF 460
           SP      E+ STL YAS  K +K    + S 
Sbjct: 326 SPENYY--ESLSTLRYASLTKKVKTNATINSM 355

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 21/120 (17%)

Query: 68  SKTYTVDKVFGPSAT----QSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 123
           +K +  D  FG + +    QS+I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 124 EKLYNEELSDSAGIIPRILFKLFETLEKLNE---------DHIVKCSFVELYNEELKDLL 174
           +   NE      GI+PR   +LFE     ++         D  VKCSF E+YNE++ DLL
Sbjct: 109 KG--NE------GIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/155 (45%), Positives = 96/155 (61%), Gaps = 8/155 (5%)

Query: 300 ITTAKEGI-KLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF---KEVKGEIFRLSKMNL 355
           +  +KE + K+L++  K R  AST  N+ SSRSH+IF I L     + K E      +NL
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEE--SCGVLNL 659

Query: 356 VDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV--HVPFRESKLTRLLQ 413
           VDLAGSE ++ S    +R +E  +IN+SL  LG VI +L DKN   H+PFR SKLT LLQ
Sbjct: 660 VDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQ 719

Query: 414 DSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 448
            SL GN+KT +   ISP+   + ET ++L +ASK 
Sbjct: 720 YSLVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 105/184 (57%), Gaps = 8/184 (4%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D  +   + NL      T ++ + L+ +G   R  + T  N+ SSRSH +  + 
Sbjct: 233 KLIIREDSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVH 292

Query: 339 LFKEVKGEIFRLSKM----NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +    +  KM    +++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 293 VVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINAL 352

Query: 395 ADKN----VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                    HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+
Sbjct: 353 CMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKD 412

Query: 451 IKNK 454
           IK K
Sbjct: 413 IKTK 416

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 10/109 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   A+Q  +F     PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHI--VKCSFVELYNEELKDLLHGD 177
             DS GII   + +LF+ +  L +     +  S++E+YNE ++DLL  D
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLEPD 228

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  113 bits (282), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 94/150 (62%), Gaps = 8/150 (5%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSK---MNLVDLAGSENIN 365
           +L+K  K R  A+T  N+ SSRSH++F I L  + K EI   S    +NLVDLAGSE +N
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMIYL--KGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 366 RSGALNQRAKEAGSINQSLLTLGRVINSLADKN---VHVPFRESKLTRLLQDSLGGNTKT 422
            S A+  R +E  +IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 423 ALIATISPAKVTLEETCSTLEYASKAKNIK 452
            +   ISP K  L ET ++L +ASK  + K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 14/118 (11%)

Query: 68  SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 127
           S+ Y  D++F  + + + +F EI + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 128 NEELSDSAGIIPRILFKLFETLEKLNED---HIVKCSFVELYNEELKDLLHGDCNNDN 182
              L+D+ G+IP  +  +F+  E + E    + + C F+E+YNE + DLL  +  + N
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGN 533

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINR 366
           L++K  K R  A+T  N+ SSRSH+IF I L     + GE      +NLVDLAGSE +N 
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSYGILNLVDLAGSERLNS 597

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTA 423
           S     R +E  +IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL GN+KT 
Sbjct: 598 SQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTL 657

Query: 424 LIATISPAKVTLEETCSTLEYASKAKNIK 452
           +   ISP +  ++ET ++L +ASK    K
Sbjct: 658 MFVNISPTQQQIQETLNSLRFASKVNTTK 686

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 106/183 (57%), Gaps = 7/183 (3%)

Query: 276 DNDKSTIQSD-QTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTI 334
           D+ K  I+ D +  G YI N+    +T+  +   +L+K  K R  A+T+ N+ SSRSH++
Sbjct: 524 DSQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSV 583

Query: 335 FTITLFKE--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 392
           F + +       GE  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI 
Sbjct: 584 FMVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIY 642

Query: 393 SLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAK 449
           +L   +    ++PFR SKLT LLQ SL G++KT +   I P    + ET ++L +ASK  
Sbjct: 643 ALNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVN 702

Query: 450 NIK 452
           + K
Sbjct: 703 STK 705

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 113/243 (46%), Gaps = 40/243 (16%)

Query: 15  EELNITVAVRCRGR----NQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKT 70
           +EL   + V CR R    N+ + D    ++    +  G++ + IN +E      ++ S  
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINRNE-----GRILSYN 414

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D +F PS T   IF+EI + L    + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 131 LSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKK 187
           L+   G+IP  L  +F+    L E   ++ ++C ++E+YNE + DLL    ++DN +   
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSHDNID--- 520

Query: 188 LRIFDSLGRDSRSNSR------NNSPKMSNNNT----TFLKK--KLRNEALLRSRNIASS 235
             I DS   D R +         N  +M   +T    T LKK  K+R+ A  RS   +S 
Sbjct: 521 -EILDSQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSR 579

Query: 236 KRS 238
             S
Sbjct: 580 SHS 582

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 105/187 (56%), Gaps = 5/187 (2%)

Query: 267 DSANKFSPADNDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMN 325
           D+ N+   + + K  I+ DQ T    I N+    + + K    +L+K  K R  AST  N
Sbjct: 534 DNINRDDTSSSLKHEIRHDQETKTTVITNVTTCKLESEKMVDMILKKANKLRSTASTASN 593

Query: 326 DFSSRSHTIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSL 384
           + SSRSH+IF I L     K        +NLVDLAGSE IN S  +  R +E  +IN+SL
Sbjct: 594 EHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSL 653

Query: 385 LTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCST 441
             LG VI++L   +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET ++
Sbjct: 654 SCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNS 713

Query: 442 LEYASKA 448
           L +ASK 
Sbjct: 714 LRFASKV 720

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 124/237 (52%), Gaps = 25/237 (10%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D      + NL      + ++ + L+ KG   R  + T  N+ SSRSH +  I 
Sbjct: 235 KLIIREDTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIH 294

Query: 339 LFKEVKGEIFRLSK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +    +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  IN+L
Sbjct: 295 VVQSSRSVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINAL 354

Query: 395 ADKN----VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                    HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+
Sbjct: 355 CMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKD 414

Query: 451 IKNKP---------QLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYK 498
           IK K           +GS+      LK IT++  +I  D L  +    I +  Q YK
Sbjct: 415 IKTKVIRNQHSLDRHVGSY------LKMITSQKQEI--DELRNREAKMIDLRLQQYK 463

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 58/109 (53%), Gaps = 10/109 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DK+F   ATQ  +F     PL    I G+N T+  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVK--CSFVELYNEELKDLLHGD 177
             ++ GII   + +LF+ +E L +    +   S++E+YNE ++DLL  D
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLEPD 230

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE-VKGEIFRLSKMNLVDLAGSENINRS 367
           +L+K  K R  AST  N+ SSRSH+IF I L     K        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 368 GALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTAL 424
             +  R +E  +IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 425 IATISPAKVTLEETCSTLEYASKA 448
              ISP+   + ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 81/170 (47%), Gaps = 17/170 (10%)

Query: 15  EELNITVAVRCRGRNQ-REIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73
           +EL   + V CR R   + ++   + ++ V +   +  V       I  TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHE--FKF 438

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
           DK+F    T   +F E+ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 134 SAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLLHGDCNN 180
             GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  D NN
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNN 537

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 104/186 (55%), Gaps = 10/186 (5%)

Query: 279 KSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTIT 338
           K  I+ D     ++ NL +      +E + L+ KG   R  + T  N+ SSRSH +  I 
Sbjct: 229 KLVIREDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIH 288

Query: 339 LFKEVKGEIFR----LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
           + +  +    +     + ++++DLAGSE    +    +R  E  +IN+SLL LG  IN+L
Sbjct: 289 VAQMNRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINAL 348

Query: 395 ADKN------VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 448
              +       HVP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++A
Sbjct: 349 CVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRA 408

Query: 449 KNIKNK 454
           K IK K
Sbjct: 409 KEIKTK 414

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D++F    TQ  +++    PL    + G+N T+  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 131 LSDSAGIIPRILFKLFETLEKLNE--DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKL 188
            S+  GII   + +LF  +E+L +     ++ SF+E+YNE++ DLL     + N + KKL
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL-----DPNISSKKL 230

Query: 189 RIF-DSLGRDSRSNSRNNSPK 208
            I  DS  R   SN   +SP+
Sbjct: 231 VIREDSYNRTFVSNLSKHSPE 251

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 89/149 (59%), Gaps = 4/149 (2%)

Query: 308 KLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF-KEVKGEIFRLSKMNLVDLAGSENINR 366
           K+L +  K R  ASTK N+ SSRSH+IF I L  K  K        +NLVDLAGSE IN 
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINS 613

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSL---ADKNVHVPFRESKLTRLLQDSLGGNTKTA 423
           S    +R +E   IN+SL  LG VI++L     K  H+PFR SKLT LL+ SL GN+KT 
Sbjct: 614 SQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTL 673

Query: 424 LIATISPAKVTLEETCSTLEYASKAKNIK 452
           +   IS +   + ET ++L +ASK  + K
Sbjct: 674 MFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (51%), Gaps = 14/116 (12%)

Query: 62  FTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMT 121
            T   N+  Y  DK+F    + S IF E+ + L    + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 122 GDEKLYNEELSDSAGIIP---RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL 174
                    L+ S GIIP   R +F   + L++   ++ + C FVE+YNE + DLL
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 101/177 (57%), Gaps = 5/177 (2%)

Query: 277 NDKSTIQSDQ-TAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIF 335
           N K  I+ DQ T    I N+    + + +   ++L++  K R  AST  N+ SSRSH+IF
Sbjct: 543 NLKHEIRHDQETKTTMITNVTSCKLESEEMVDRVLKRANKLRSTASTASNEHSSRSHSIF 602

Query: 336 TITLFK-EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL 394
            I L     K        +NLVDLAGSE IN S  +  R +E  +IN+SL  LG VI++L
Sbjct: 603 IIHLSGLNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHAL 662

Query: 395 ADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 448
              +    H+PFR SKLT LLQ SL G++KT +   ISP+   + ET ++L +ASK 
Sbjct: 663 GQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 719

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 15  EELNITVAVRCRGRNQRE-IDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73
           +EL   + V CR R   E ++   + ++ V +   ++ V       I  T Q++   +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHE--FKF 438

Query: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133
           DK+F    T   +F E+ + L    + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 134 SAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLLHGDCNNDNGN 184
             GIIP  +  +F  + KL     D+ V C F+E+YNE + DLL  + N D+ N
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENNKDDTN 541

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 110/421 (26%), Positives = 174/421 (41%), Gaps = 130/421 (30%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF    T   +++   +P+    + G+N T+  YGMT +GKT+TM+G+E    +E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNE----QE 218

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDH----IVKCSFVELYNEELKDLLHGDCNNDNGNFK 186
           L    G+IP  +  LF  + + + D      V  S++E+YNE + DLL            
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEE------ 268

Query: 187 KLRIFDSLGRDSRSNSRNNSPKM-----SNNNTTFLKKKLRNEALLRSRNIASSKRSSMQ 241
                        S SR  +P       SN+N   ++ K+R+++    + I  ++R    
Sbjct: 269 -------------SGSRPGTPSRSYMGKSNSNAMGVELKIRDDSKYGVKVIGLTER---- 311

Query: 242 TIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHIT 301
                        +T   +   G  D + K    + D +T  S   A + I         
Sbjct: 312 ----------RCESTEELLRWIGIGDKSRKI--GETDYNTRSSRSHAIVLI--------- 350

Query: 302 TAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGS 361
                           ++ ST +N+ +SRS T                   ++L DLAGS
Sbjct: 351 ----------------RLTSTDVNNGTSRSST-------------------LSLCDLAGS 375

Query: 362 ENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-------DKNV--------------- 399
           E   R+    +R KE   IN+SLL LG VI+ L+       D N+               
Sbjct: 376 E---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSI 432

Query: 400 ---------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                    H+P+R+SKLTRLLQ +L G++    I T+        ET +TL +AS+AKN
Sbjct: 433 TGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKN 492

Query: 451 I 451
           +
Sbjct: 493 V 493

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 91/149 (61%), Gaps = 6/149 (4%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINR 366
           LL+K  + R  AST  N+ SSRSH++F I L     + GE      +NLVDLAGSE IN 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSD-GILNLVDLAGSERINS 624

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTA 423
           S  L +R +E  +IN+SL  LG V+++L   +    H+PFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 424 LIATISPAKVTLEETCSTLEYASKAKNIK 452
           +   IS  +  L ET ++L +ASK  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 87/178 (48%), Gaps = 20/178 (11%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTV---PDIMGSKEVAINTSEDIGFTAQMNSKTY 71
           +EL   + V CR R   + +  ++  +TV    D  G + + I  S + G +   N   +
Sbjct: 372 QELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---F 428

Query: 72  TVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEEL 131
             D++F  + T   +F+EI + L    + GYN  +  YG T +GKTYTM          L
Sbjct: 429 KFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------L 477

Query: 132 SDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDNGNFK 186
           +   GIIP  +  +F  +E L E   ++ + C F+E+YNE + DLL  D ++   N K
Sbjct: 478 NPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQDDIQANAK 535

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 92/154 (59%), Gaps = 11/154 (7%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINR 366
           +L++  K R  AST  N+ SSRSH+IF I L    E+ GE      +NLVDLAGSE IN 
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK-SYGILNLVDLAGSERINS 661

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLAD--------KNVHVPFRESKLTRLLQDSLGG 418
           S    +R +E  +IN+SL  LG VI++L          K  H+PFR SKLT LLQ SL G
Sbjct: 662 SQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIG 721

Query: 419 NTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
           N+KT +   ISP+   + ET ++L +ASK  + K
Sbjct: 722 NSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/149 (45%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE--VKGEIFRLSKMNLVDLAGSENINR 366
           +L++  K R  AST  N+ SSRSH+IF I L     + GE      +NLVDLAGSE IN 
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGE-ESYGILNLVDLAGSERINS 606

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTA 423
           S     R +E  +IN+SL  LG VI++L   +    H+PFR SKLT LLQ SL GN+KT 
Sbjct: 607 SQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTL 666

Query: 424 LIATISPAKVTLEETCSTLEYASKAKNIK 452
           +   ISP+   + ET ++L +ASK  + K
Sbjct: 667 MFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 82/186 (44%), Gaps = 33/186 (17%)

Query: 15  EELNITVAVRCRGRNQ-REIDAKSSVVVTVPD-----------IMGSKEVAINTSEDIGF 62
           +EL   + V CR R     I++K +  + V D           +M   EV  N +  I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQI-- 400

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
                 + +  DK+F  + T + +F E+ + L    + GYN  +  YG T +GKTYTM  
Sbjct: 401 -----PQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-- 452

Query: 123 DEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCN 179
                   L    GIIP  +  +F   + L E    + + C FVE+YNE + DLL    N
Sbjct: 453 --------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSN 504

Query: 180 NDNGNF 185
           +D  N 
Sbjct: 505 DDTRNI 510

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 88/145 (60%), Gaps = 6/145 (4%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINR 366
           LL++  K R  A+T  N+ SSRSH++F I L  +    GE  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTA 423
           S     R +E  +IN+SL  LG VI++LA  +    H+PFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 424 LIATISPAKVTLEETCSTLEYASKA 448
           +   ISP      ET ++L +ASK 
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKV 697

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 111/243 (45%), Gaps = 28/243 (11%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           +EL   + V CR R   + +   S  V + ++    E     ++ +  T       +  D
Sbjct: 362 QELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSKKHEFKFD 416

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           K+F P  +   IF+EI + L    + GYN  +  YG T +GKTYTM          L   
Sbjct: 417 KIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LHPQ 465

Query: 135 AGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIF 191
            G+IP  L  +F+ +  L E   ++ +   F+E+YNE + DLL G  NND  +     I 
Sbjct: 466 NGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRG-LNNDTED-----IT 519

Query: 192 DSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTKA 251
           +SL  + R +  + +  ++N  T  L  +   + LL+    A+  RS+  T  N  ++++
Sbjct: 520 ESLKHEIRHDQESQTTHVTNVTTCKLTDRDMVDTLLKR---AAKLRSTAATGSNERSSRS 576

Query: 252 SAT 254
            + 
Sbjct: 577 HSV 579

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 15/181 (8%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ +  L E    + +E +  ++ G K+R+ +ST  N  SSRSH I  I L  
Sbjct: 223 IRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLIS 282

Query: 342 E--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK-- 397
                GE+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG VI+ L+ +  
Sbjct: 283 SDLSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGTVISKLSAEVN 338

Query: 398 -------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN 450
                  N H+P+R+SKLTR+LQ +L GN+    I TI  +     E+ +TL +AS+AKN
Sbjct: 339 NSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKN 398

Query: 451 I 451
           +
Sbjct: 399 V 399

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (54%), Gaps = 12/111 (10%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           YT D VF P A+   ++    +PL      G+N T+  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 131 LSDSAGIIP----RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGD 177
           +  +AG+IP     +  K+F++    N+ +    S++E+YNE++ DLL  D
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETD 206

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/294 (32%), Positives = 151/294 (51%), Gaps = 36/294 (12%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 340
           ++ D   G+ +  L E ++++ KE +K +  G   R+   T  N  SSRSH +  I +F 
Sbjct: 228 LRDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFC 287

Query: 341 -KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA---- 395
             E+ GE   +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+    
Sbjct: 288 TDEITGEQV-MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESS 343

Query: 396 --DKNV-HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
               NV H+P+R+SKLTR+LQ +L G++  A I T+     T  E+ +T+ +AS+AKNI 
Sbjct: 344 GLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNIS 403

Query: 453 ------------NKPQLGSFIMKDILLKNITTE-LTKIKSDLLSTKSKDG--------IY 491
                       +K QL   + K +  + IT + LT+ K  + S  S D         + 
Sbjct: 404 LAVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLK 463

Query: 492 MDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIK 545
           M  +HY+ L T L+    +  E    I+ L     ++L+ K  +N +++LQ  K
Sbjct: 464 MKVEHYERLET-LEPSILKDTELVEIIDMLPQDIGVMLETK-LVNMDSQLQESK 515

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF P      +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 131 LSDSAGIIPRILFKLFETLEK--LNEDHIVKCSFVELYNEELKDLL 174
                GIIP  +  +F+ +      +   V+ S++E+YNE + DLL
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLL 203

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 179/423 (42%), Gaps = 128/423 (30%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF    T   ++++ ++P+    + G+N T+  YGMT +GKT+TM+G+E    +E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNE----QE 218

Query: 131 LSDSAGIIPRILFKLFETL--EKLNEDHI--VKCSFVELYNEELKDLLHGDCNNDNGNFK 186
           L    G+IP  +  LF  +  + +N D    V  S++E+YNE + DLL            
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSR-- 272

Query: 187 KLRIFDSLGRDSRSN-SRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRN 245
                  LG  SRS  S+NNS      N   ++ K+R+++    + I  ++R        
Sbjct: 273 -------LGTPSRSYMSKNNS------NALGVELKIRDDSQYGVKVIGLTER-------- 311

Query: 246 TTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKE 305
               +  ++       + G  D + K    D +  + +S                     
Sbjct: 312 ----RCESSEDLLRWIAVG--DKSRKIGETDYNARSSRS--------------------H 345

Query: 306 GIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENIN 365
            I L+       ++ ST + D +SRS T                   ++L DLAGSE   
Sbjct: 346 AIVLI-------RLTSTDVRDGTSRSST-------------------LSLCDLAGSE--- 376

Query: 366 RSGALNQRAKEAGSINQSLLTLGRVINSL-ADK--------------------------- 397
           R+    +R KE   IN+SLL LG VI+ L ADK                           
Sbjct: 377 RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPTTPTSSGNSSSSSSSSSG 436

Query: 398 ---------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKA 448
                    + H+P+R+SKLTRLLQ +L G++    I T+        ET +TL +AS+A
Sbjct: 437 SIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRA 496

Query: 449 KNI 451
           KN+
Sbjct: 497 KNV 499

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 110/196 (56%), Gaps = 15/196 (7%)

Query: 262 SSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVAS 321
           S+ +N   +K    D  K+T+         ++NL+   +T+ +    +L+  +K R  AS
Sbjct: 485 SNSSNGPRHKIHHDDASKTTV---------VENLETITLTSKESVDAVLKNAMKLRATAS 535

Query: 322 TKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGS 379
           T  N+ SSRSH+IF I +    E  GE  R   +NL+DLAGSE ++ S   ++R KE   
Sbjct: 536 TSSNERSSRSHSIFIIKIHGINEGLGE-ERNGLLNLIDLAGSERLSVSKVQSERIKETQH 594

Query: 380 INQSLLTLGRVINSLADKNV---HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 436
           IN+SL  LG V+NSL   +    H+ FR+SKLT LLQ SL GN+KT ++  IS +   + 
Sbjct: 595 INKSLSFLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHIN 654

Query: 437 ETCSTLEYASKAKNIK 452
           ET  +L +A K  + K
Sbjct: 655 ETIKSLNFAKKVNSTK 670

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 60/115 (52%), Gaps = 14/115 (12%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           Y+ DKVF  + T   IF E++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 131 LSDSAGIIPRILFKLFETLE---KLNEDHIVKCSFVELYNEELKDLLHGDCNNDN 182
           L+   GIIP     +F+ ++   K    + V C F+E+YN+E+ DLL  D N  N
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSN 486

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/186 (37%), Positives = 103/186 (55%), Gaps = 20/186 (10%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ +  L+E    +++E +K +++G  +R+ A T  N  SSRSH I  I L  
Sbjct: 271 IRDDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTN 330

Query: 342 E--VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL----- 394
              + G     S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L     
Sbjct: 331 TNVIDGTSIS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAEST 386

Query: 395 ---------ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYA 445
                    A+ N H+P+R+SKLTR+LQ +L G++    I TI   K +  ET +TL +A
Sbjct: 387 AASHGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFA 446

Query: 446 SKAKNI 451
           S+AKN+
Sbjct: 447 SRAKNV 452

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 8/108 (7%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D V+ P  +   I++ I +P+     +G+N T+  YGMT +GKTYTM         +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMM----GSGGD 190

Query: 131 LSDSAGIIPRILFKLFETLEKLN----EDHIVKCSFVELYNEELKDLL 174
             D  G+IP  +  LF  + ++         V  S++E+YNE + DLL
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL 238

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 99/149 (66%), Gaps = 12/149 (8%)

Query: 308 KLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKG-----EIFRLSKMNLVDLAGSE 362
           +L+Q+  K R+ A T MN+ SSRSH++F +    EV+G     E      +NLVDLAGSE
Sbjct: 550 ELVQRLNKVRRTAKTAMNNRSSRSHSVFIV----EVEGFNKDSEERCKGVLNLVDLAGSE 605

Query: 363 NINRSGALN-QRAKEAGSINQSLLTLGRVINSL--ADKNVHVPFRESKLTRLLQDSLGGN 419
            +NRSG ++ +R +E   IN+SL ++G VI++L     ++H+PFR +KLT LL+ SL G+
Sbjct: 606 RMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGS 665

Query: 420 TKTALIATISPAKVTLEETCSTLEYASKA 448
           +KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 666 SKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 90/200 (45%), Gaps = 24/200 (12%)

Query: 1   MSDPTVSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60
           + D T+      Q +EL   + V CR R   + D     V       G++ + +    DI
Sbjct: 343 VKDETLRRKVHNQIQELRGNIRVFCRVRPTDD-DTNIIKVHGFDSDTGTQSLTL----DI 397

Query: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120
                  S  +  DK+F    +   +F E+ E L    + G+N  +  YG T +GKTYTM
Sbjct: 398 KRPMTNGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM 456

Query: 121 TGDEKLYNEELSDSAGIIPRILFKLFE---TLEKLNEDHIVKCSFVELYNEELKDLLHGD 177
                     L++  GIIP  L  + +   +++KL   + +K  FVE+YN+ + DLL   
Sbjct: 457 ----------LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLL--- 503

Query: 178 CNNDNGNFKKLRI-FDSLGR 196
            N+  G  K+  +  D +GR
Sbjct: 504 -NDGKGKHKECEVRHDDIGR 522

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 116/233 (49%), Gaps = 42/233 (18%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ I  L E    T++E +K ++ G   R+ + T+ N  SSRSH +  + L  
Sbjct: 259 IRDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRL-- 316

Query: 342 EVKGEIFRLSK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA-- 395
            V   +   SK    + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+  
Sbjct: 317 -VTHNVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAE 372

Query: 396 ----------------------DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 433
                                 + N H+P+R+SKLTRLLQ +L GN+    I TI P   
Sbjct: 373 SLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRME 432

Query: 434 TLEETCSTLEYASKAKNI-------KNKPQLG-SFIMKDILLKNITTELTKIK 478
           T  ET +TL +AS+AKN+       KN   +  S + KD ++K +T  L K K
Sbjct: 433 TYAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (51%), Gaps = 9/120 (7%)

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
           T   N+  Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 123 DEKLYNEELSDSAGIIPRILFKLF-ETLEKLNE-DHIVKCSFVELYNEELKDLLHGDCNN 180
           D    NE   +  GI+P  +  LF + L   N+  + V  S++E+YNE++ DLL  D  N
Sbjct: 185 D----NE---NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 100/167 (59%), Gaps = 14/167 (8%)

Query: 299 HIT-------TAKEGI-KLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIF 348
           HIT       T++E + ++L++ LK R  A+T  N  SSRSH++F I L  +  + GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 349 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRE 405
               +NLVDLAGSE I+      +R +E  +IN+SL  LG VI++L   +    H+PFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 406 SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
           SKLT LLQ SL G++KT +   +SP   ++ ET ++L +A+K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKT--YT 72
           +EL   + V CR R   E +  SS  + +     S E  + +      T + +SK   +T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKF--SDETGMQS-----ITIKRDSKQHKFT 410

Query: 73  VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 132
            D+ F    T   +F EI + L    + GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 133 DSAGIIPRILFKLFETLEKLNEDHIV---KCSFVELYNEELKDLL 174
            + GIIP  L  +F  +EKL E   V      FVE+YNE +KDL 
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 93/147 (63%), Gaps = 4/147 (2%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK--EVKGEIFRLSKMNLVDLAGSENINR 366
           +L+   K + +A+T  N+ SSRSH++FTI +     + GE      +NLVDLAGSE I+ 
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD-GVLNLVDLAGSERIDT 599

Query: 367 SGALNQRAKEAGSINQSLLTLGRVINSLADKNV-HVPFRESKLTRLLQDSLGGNTKTALI 425
           S     R +E  +IN+SL  LG VI +L  K++ H+PFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 426 ATISPAKVTLEETCSTLEYASKAKNIK 452
             +SP+   ++ET ++L +ASK  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 85/166 (51%), Gaps = 23/166 (13%)

Query: 13  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIM-GSKEVAINTSEDIGFTAQMNSKTY 71
           QE   NI V  R R   + E+   S + V+  D   GS+ + I ++ED       NS+ +
Sbjct: 353 QELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEI-SNED------RNSR-F 404

Query: 72  TVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEEL 131
             DKVF  +A+   +F+E+ + L    + GYN  +  YG T +GKTYTM          +
Sbjct: 405 LFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------M 453

Query: 132 SDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL 174
           +D  G+IP  L  +F+    L E   D+  +  F+E+YNE++ DLL
Sbjct: 454 NDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 100/180 (55%), Gaps = 13/180 (7%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL-F 340
           I+ D   G+ +  L E  + T+++ +K +  G   R+   T  N  SSRSH I  I L  
Sbjct: 265 IRDDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTC 324

Query: 341 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 399
            ++K  +   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L+ ++  
Sbjct: 325 TDLKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQ 381

Query: 400 --------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 451
                   H+P+R+SKLTR+LQ +L G+     I T+     +  ET +T+ +AS+AKNI
Sbjct: 382 NMGVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 61/107 (57%), Gaps = 11/107 (10%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           ++ D VF P+     +++E A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 131 LSDSAGIIPRILFKLFETL--EKLNEDHI-VKCSFVELYNEELKDLL 174
            S+  G+IP  +  +F  +  + LN     VK S++E+YNE++ DLL
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLL 245

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 109/203 (53%), Gaps = 25/203 (12%)

Query: 269 ANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFS 328
            N F+ A + +  I+ D   GI +  L E   ++  + +K ++ G K ++++ T+ N  S
Sbjct: 230 GNSFNSAQDLR--IRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRS 287

Query: 329 SRSHTIFTITLFK-EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 387
           SRSH+I  + L   +++  I   S ++L DLAGSE   ++ +  +R KE   IN+SLL L
Sbjct: 288 SRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLAL 344

Query: 388 GRVINSLADK-------------------NVHVPFRESKLTRLLQDSLGGNTKTALIATI 428
           G VI  L+ +                   N H+P+R+SKLTR+LQ +L GN+    I T+
Sbjct: 345 GTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTV 404

Query: 429 SPAKVTLEETCSTLEYASKAKNI 451
                   ET +TL +AS+AKN+
Sbjct: 405 DIRSDASSETLNTLRFASRAKNV 427

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 79/150 (52%), Gaps = 31/150 (20%)

Query: 43  VPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGY 102
           V +I+ +K +A    +D+G         + +D++F    +   I+ E+ +PL      GY
Sbjct: 92  VWNIVDNKRIA---HDDVG--------EFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGY 140

Query: 103 NCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVK--- 159
           N T+  YGMT +GKT+TM+G +        +  G+IP  +  LF T   +NE++++    
Sbjct: 141 NATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNT---INEENLLGKKK 189

Query: 160 ----CSFVELYNEELKDLLHGDCNNDNGNF 185
                S++E+YNE+L DLL  D N +  NF
Sbjct: 190 YEMLVSYMEIYNEKLYDLL--DTNVEGVNF 217

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 111/208 (53%), Gaps = 20/208 (9%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL-F 340
           ++ D   G+ +  L E  + ++++ +K +  G   R+   T  N  SSRSH I T+ L  
Sbjct: 270 VRDDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLAC 329

Query: 341 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK--- 397
            ++       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+     
Sbjct: 330 TDLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMH 386

Query: 398 ------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 451
                 N H+P+R+SKLTR+LQ +L G +    I TI      + ET +T+ +AS+AKN+
Sbjct: 387 TTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNV 446

Query: 452 -----KNKPQLGSFIMKDILLKNITTEL 474
                +N+ +L     KD L+ N+  +L
Sbjct: 447 SMTVKRNEAELAH--EKDALIHNLRRQL 472

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 11/107 (10%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF P +    ++ +I +P+     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 131 LSDSAGIIPRILFKLFETL--EKL-NEDHIVKCSFVELYNEELKDLL 174
             + AG+I   +  +F  +  E L N+   V  S++E+YNE++ DLL
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLL 237

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 292 IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFR 349
           I N+ +  +T+ ++   +L++  + R  A T+ N+ SSRSH++F + +    +  GE+  
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVSH 602

Query: 350 LSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV---HVPFRES 406
             K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI +L   +    H+PFR S
Sbjct: 603 -GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 407 KLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK 452
           KLT LLQ SL G++KT +   I   +    ET ++L +ASK  + K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 102/209 (48%), Gaps = 24/209 (11%)

Query: 68  SKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLY 127
           S  +  DK+F P  T + +F EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 128 NEELSDSAGIIPRILFKLFETLEKLNED---HIVKCSFVELYNEELKDLLHGDCNNDNGN 184
              L+   G+IP  L  +F+  E L E    + + C ++E+YNE + DLL    +NDN +
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSNDNID 522

Query: 185 FKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIR 244
                I +S   + R +  N++  ++N     +  + + +++L+    AS  RS+  T  
Sbjct: 523 ----DILESQKHEIRHDHDNHATSITNVTKMKMTSQEQVDSMLKR---ASRMRSTACTRS 575

Query: 245 NTTTTKASATTTTTTMFSSGNNDSANKFS 273
           N    ++S + +   +  +G+ND   + S
Sbjct: 576 N---ERSSRSHSVFMVHINGHNDQTGEVS 601

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 103/196 (52%), Gaps = 29/196 (14%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 340
           I+ D   G+ +  L +    T++E +  + KG K R+ + T+ N  SSRSH I  I L  
Sbjct: 261 IRDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLIS 320

Query: 341 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN-------- 392
           K+++     +  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+        
Sbjct: 321 KDIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNG 377

Query: 393 ------------SLADKNV-----HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 435
                       SLA  N      H+P+R+SKLTRLLQ +L G++    + TI  A  + 
Sbjct: 378 SHHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESS 437

Query: 436 EETCSTLEYASKAKNI 451
            ET +TL +AS++KN+
Sbjct: 438 SETLNTLRFASRSKNV 453

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 61/108 (56%), Gaps = 12/108 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +T D VF    +   I+ +  +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 131 LSDSAGIIPRILFKLFET-LEKL---NEDHIVKCSFVELYNEELKDLL 174
             +  G+IP  +  LF + LEK    NE   V  S++E+YNE++ DLL
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL 232

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 103/197 (52%), Gaps = 21/197 (10%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           ++ D   G+ I  L E    ++ E +K ++ G K R+   T  N  SSRSH I  I L K
Sbjct: 254 LREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTK 313

Query: 342 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV- 399
            ++K      S ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ ++  
Sbjct: 314 TDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTS 370

Query: 400 ------------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASK 447
                       H+P+R+SKLTR+LQ +L GN     I TI        ET +TL +AS+
Sbjct: 371 HRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASR 430

Query: 448 AKNIK----NKPQLGSF 460
           AKN+      KP L S 
Sbjct: 431 AKNVSLHIFRKPLLPSM 447

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 14/115 (12%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF  +     ++ + ++P+     +G N T+  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 131 LSDSAGIIPRILFKLFETL--EKLNEDHI--VKCSFVELYNEELKDLLHGDCNND 181
             ++ G+IP  +  L+  +  E L  D    +  S++E+YNE++ DLL  DC N+
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLL--DCENE 226

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 100/191 (52%), Gaps = 19/191 (9%)

Query: 277 NDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFT 336
           N++  ++ D   G+ +  + E    TA+E +K +  G   R+   T  N  SSRSH I  
Sbjct: 230 NEELKVRDDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQ 289

Query: 337 ITLFKE-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA 395
           + L    +       + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L+
Sbjct: 290 VKLITTNLLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLS 346

Query: 396 DK---------------NVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCS 440
            +               N H+P+R+SKLTRLLQ +L  ++    I TI P K  + ET +
Sbjct: 347 AESNAHDSSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVN 406

Query: 441 TLEYASKAKNI 451
           TL +AS+AKN+
Sbjct: 407 TLRFASRAKNV 417

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (51%), Gaps = 6/118 (5%)

Query: 64  AQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGD 123
           A  +   +  D VFGP+AT   +F E+   L      G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 124 EKLYNEELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND 181
              +N+ +    G    +  ++    ++      V  S++E+YNE++ DLL+ +C N+
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRNE 231

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 145/311 (46%), Gaps = 42/311 (13%)

Query: 274 PADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHT 333
           P    +  ++ D   G+ +  L E  + ++++ ++ ++ G   R+   T  N  SSRSH 
Sbjct: 259 PGAGAELPVRDDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHA 318

Query: 334 IFTITL-FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 392
           I TI +   E+       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+
Sbjct: 319 IVTIKVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVIS 375

Query: 393 SLAD----------------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 436
            L+                  N HVP+R+SKLTR+LQ +L G++    I TI      + 
Sbjct: 376 KLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMS 435

Query: 437 ETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQH 496
           ET +T+ +AS+AKN+             + +K    E T  K +LL +  +    +D+Q 
Sbjct: 436 ETVNTIRFASRAKNV------------SMTVKRNEAEATHDKDELLHSLRRQ---LDEQ- 479

Query: 497 YKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKL 556
            ++L  +L+  +    +       L     +L+     +   NE  + K+Q     + K 
Sbjct: 480 -QDLICELRRAQPPADQSSCEATPLGPSATVLM-----LRRENETLKKKLQHCERLLDKD 533

Query: 557 YAKIERQQSIE 567
            A +E +Q +E
Sbjct: 534 DAAVEDEQFVE 544

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 104/204 (50%), Gaps = 17/204 (8%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  DKVF P      +++EI +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 131 LSDSAGIIPRILFKLFETLEKL---NEDHIVKCSFVELYNEELKDLL-HGDCNNDNGNFK 186
             D AG+I   + ++F  + K    N+ + V+ S++E+YNE++ DLL +    +  G + 
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLNYPSAKSPGGTYG 251

Query: 187 KLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLR-NEALLRSRNIASSKRSSMQTIRN 245
             +  +  G  +    R+++ +         ++++  +E +LR   + +S R + +T  N
Sbjct: 252 SFQSKNVPGAGAELPVRDDA-RHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYN 310

Query: 246 TTTTKASATTT---TTTMFSSGNN 266
           T ++++ A  T   T T   SG +
Sbjct: 311 TRSSRSHAIVTIKVTCTELLSGTD 334

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 101/202 (50%), Gaps = 35/202 (17%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ +  L E    +++E ++ +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295 IRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTS 354

Query: 342 E-VKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-ADK-- 397
             VK    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK  
Sbjct: 355 TNVKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMN 411

Query: 398 ----NV------------------------HVPFRESKLTRLLQDSLGGNTKTALIATIS 429
               N+                        H+P+R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412 SVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 430 PAKVTLEETCSTLEYASKAKNI 451
                  ET +TL +AS+AKN+
Sbjct: 472 TRNDAAAETMNTLRFASRAKNV 493

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 12/108 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF    T   +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E    +E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNE----QE 218

Query: 131 LSDSAGIIPRILFKLFETL--EKLNEDHI--VKCSFVELYNEELKDLL 174
           L    G+IP  +  LF  +  + +N D    V  S++E+YNE + DLL
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLL 262

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 101/198 (51%), Gaps = 31/198 (15%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLF- 340
           I+ D   G+ +  L E    +++E +  + KG K R+ A T  N  SSRSH I  I L  
Sbjct: 273 IRDDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTT 332

Query: 341 KEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLA---DK 397
            ++K      S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+   +K
Sbjct: 333 SDMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNK 389

Query: 398 N------------------------VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 433
           N                         H+P+R+SKLTRLLQ +L G++    I TI     
Sbjct: 390 NRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNE 449

Query: 434 TLEETCSTLEYASKAKNI 451
           +  ET +TL +AS+AKNI
Sbjct: 450 SSAETLNTLRFASRAKNI 467

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 79/164 (48%), Gaps = 28/164 (17%)

Query: 19  ITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVDKVFG 78
           ITVA+R +  +     + SS +VT       K +A    +D+G         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVT-----DEKTIA---HDDVG--------EFKFDHVFN 144

Query: 79  PSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGII 138
              +   I+  I  P+     +G+N T+  YGMT +GKTYTM G       E     G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGLI 199

Query: 139 PRILFKLF-----ETLEKLNEDHIVKCSFVELYNEELKDLLHGD 177
           P  +  LF     ETL+   +  IV  S++E+YNE++ DLL GD
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIV-LSYLEIYNEKIYDLL-GD 241

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 125/248 (50%), Gaps = 35/248 (14%)

Query: 255 TTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGL 314
           +T + MF SG   S+    P +     I+ D   G+ I  L E    +++E  + +Q G 
Sbjct: 221 STPSRMFLSGTPRSSG--GPVE---LRIRDDLKYGVRITGLTEKRCESSEELSRWIQIGD 275

Query: 315 KYRQVASTKMNDFSSRSHTIFTITL--FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQ 372
           K R+ + T  N  SSRSH I  + L       GE    S ++L DLAGSE   ++ +  +
Sbjct: 276 KNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGETVS-STLSLCDLAGSE---KAVSQYE 331

Query: 373 RAKEAGSINQSLLTLGRVINSL------------------ADKNVHVPFRESKLTRLLQD 414
           R KE   IN+SLL LG VI+ L                   + N H+P+R+SKLTR+LQ 
Sbjct: 332 RRKEGAFINKSLLALGTVISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQP 391

Query: 415 SLGGNTKTALIATISPAKVTLEETCSTLEYASKAKN----IKNKPQL--GSFIMKDILLK 468
           +L GN+    I TI        ET +T+ +AS+AKN    +  +P +  GS+  KD  ++
Sbjct: 392 ALSGNSIITTICTIDTRNEAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIE 451

Query: 469 NITTELTK 476
           N+T +L K
Sbjct: 452 NLTQQLEK 459

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 95/206 (46%), Gaps = 46/206 (22%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +T D+VF  + T   I++  + P+    ++G+N T+  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 131 LSDSAGIIP----RILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDN---- 182
             D AG+IP     +  K+ E   +    + V  S++E+YNE++ DLL  DC ++N    
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLL--DCESENKFNS 221

Query: 183 --------------GNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLR-NEALL 227
                         G   +LRI D L             K     T   +K+   +E L 
Sbjct: 222 TPSRMFLSGTPRSSGGPVELRIRDDL-------------KYGVRITGLTEKRCESSEELS 268

Query: 228 RSRNIASSKRSSMQTIRNTTTTKASA 253
           R   I    R + +TI NT ++++ A
Sbjct: 269 RWIQIGDKNRKTSETIYNTRSSRSHA 294

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 97/189 (51%), Gaps = 24/189 (12%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ + +L E  + +  E IK +  G K R+   T  N  SSRSH I  + L +
Sbjct: 268 IRDDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTR 327

Query: 342 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINSL---- 394
            E+K      S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 328 CELKTGTEVTSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANS 382

Query: 395 ------------ADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTL 442
                       +    H+P+R+SKLTR+LQ +L G++    I TI     +  ET +T+
Sbjct: 383 AGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTV 442

Query: 443 EYASKAKNI 451
            +AS+AKNI
Sbjct: 443 RFASRAKNI 451

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF    T S ++  + +P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 131 LSDSAGIIPRILFKLF-----ETLEKLNEDHIVKCSFVELYNEELKDLL 174
                G+IP  +  +F     ET +     + VK S++E+YNE++ DLL
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 112/211 (53%), Gaps = 23/211 (10%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ + +L E  +++ ++ +K +  G + R+   T  N  SSRSH I  + L +
Sbjct: 267 IRDDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTR 326

Query: 342 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINSLA--- 395
            ++K      S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L+   
Sbjct: 327 YDLKTGSEATSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 396 ---------DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 446
                        H+P+R+SKLTR+LQ +L G++    I TI     +  ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 447 KAKNIK---NKPQLGSFIMKDILLKNITTEL 474
           +AKNI     K ++ S   KD +++N+  +L
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 22/134 (16%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF        ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHI------VKCSFVELYNEELKDLLH------GDC 178
                G+IP+ +  +F+ +   +E H       VK S++E+YNE++ DLL+      G  
Sbjct: 201 ---EPGLIPQCVGNIFDRIS--SEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGST 255

Query: 179 NNDNGNFKKLRIFD 192
              + N   L+I D
Sbjct: 256 GQPSRNATGLKIRD 269

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 101/202 (50%), Gaps = 35/202 (17%)

Query: 282 IQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFK 341
           I+ D   G+ +  L E    +++E +K +  G K R++  T  N  SSRSH I  I L  
Sbjct: 295 IRDDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTS 354

Query: 342 -EVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL-ADK-- 397
            +++    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK  
Sbjct: 355 TDLESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKIN 411

Query: 398 ----NVHV-P-----------------------FRESKLTRLLQDSLGGNTKTALIATIS 429
               N+H  P                       +R+SKLTRLLQ +L G++    I T+ 
Sbjct: 412 PTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVD 471

Query: 430 PAKVTLEETCSTLEYASKAKNI 451
                  ET +TL +AS+AKN+
Sbjct: 472 TRNDAAAETINTLRFASRAKNV 493

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 12/108 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  D VF    T   +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E    +E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNE----QE 218

Query: 131 LSDSAGIIPRILFKLFETLEKL----NEDHIVKCSFVELYNEELKDLL 174
           L    G+IP  +  LF  + +L    ++   V  S++E+YNE + DLL
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLL 262

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 88/150 (58%), Gaps = 12/150 (8%)

Query: 307 IKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINR 366
           ++L+ +G + R+V ST+ N  SSRSH +  + +   + G   R+  + L DLAGSE    
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAGSER--- 294

Query: 367 SGALNQRA--KEAGSINQSLLTLG---RVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 421
             +++ R    E G+IN+SL+ LG   R++N     + HVP+R+SKLTRLL+ SL GN  
Sbjct: 295 -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 422 TALIATISPAKVTLEETCSTLEYASKAKNI 451
             ++ T+S +    E++  TL +A +A  +
Sbjct: 354 VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 25/111 (22%)

Query: 86  IFDEIAEPLF----SDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRI 141
           IF    +PL     +D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQ-- 168

Query: 142 LFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192
              + + L +L+++  +  S++E+YNE L DLL   C+      K+LRI D
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLL---CDGT----KELRILD 211

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 105/201 (52%), Gaps = 30/201 (14%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE--VKG 345
           + I I+NL+  ++T+  E +   +KG   R +AS       SRS  I  IT+ +   VK 
Sbjct: 187 SSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVK- 235

Query: 346 EIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD--------- 396
           E+F+     LVDL  S+ I++   L    +    INQS++TL  V  SLA          
Sbjct: 236 EVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGR 295

Query: 397 ---KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIK- 452
               N ++P++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K 
Sbjct: 296 PRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKN 355

Query: 453 ----NKPQLGSFIMKDILLKN 469
               NK    S  M D+L+K+
Sbjct: 356 LFQQNKAGTNSKAMLDLLMKD 376

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (54%), Gaps = 21/119 (17%)

Query: 64  AQMNSKTYTVDKVFGPSA-----TQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTY 118
           A  N K + VD++F P A     T S+I D +A+ LF+    GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-LFN----GYNVAIMAYGQTDSGKTS 118

Query: 119 TMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLL 174
           TM G    YN+      G+I  +  ++F T+E  +E   D+ +  S +E+  E ++DLL
Sbjct: 119 TMFG----YNK----GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 5/145 (3%)

Query: 308 KLLQKGLKYRQVASTKMNDFSSRSHTIFT--ITLFKEVKGEIFRLSKMNLVDLAGSENIN 365
           +L++ G   R   ST MN+ SSRSH++F   IT    +  E     ++NLVDLAGSE + 
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQ 584

Query: 366 RSGALNQRA--KEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTA 423
           +   +  +   KE  SIN+SL  L  VI+S+  +  ++PFR SKLT LL++SL   +KT 
Sbjct: 585 QQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTL 644

Query: 424 LIATISPAKVTLEETCSTLEYASKA 448
           +   ISP   ++ ET ++L  A K 
Sbjct: 645 MYVNISPNINSIRETINSLRLARKV 669

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 103/226 (45%), Gaps = 32/226 (14%)

Query: 15  EELNITVAVRCRGRNQREIDAKSS-----VVVTVPDI-MGSKEVAINTSEDIGFTAQMNS 68
           +EL   + V CR R   + +A +S     + +   D   G + + +N  + +        
Sbjct: 330 QELRGNIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVNDLKQL-------- 381

Query: 69  KTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYN 128
             +T DK+FG       +FD+I   L    + GYN  +  YG T +GKTYTM        
Sbjct: 382 HAFTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM-------- 432

Query: 129 EELSDSAGIIPR---ILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNF 185
             L++  GII +    +      L KL  ++ ++  F+E+YNE ++DLL+ +  + +   
Sbjct: 433 --LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLNPEAKHQHV-- 488

Query: 186 KKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRN 231
             +R  D  G    +N+   + K+++N    + K  +   L+R+ N
Sbjct: 489 --IRHDDKKGTTEVTNTHKITIKLTHNEDDEIAKSAQIRQLIRNGN 532

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 113/248 (45%), Gaps = 37/248 (14%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           +EL   + V CR R   + + + S  +++           N ++ I    +     +T D
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCITIKREAKYHKFTFD 411

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           + FG   +   IF EI + L    + GYN  +  YG T +GKTYTM          L+  
Sbjct: 412 RCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPE 460

Query: 135 AGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG-DCNNDNGNFKKLRI 190
            GIIP  L  +F  +EKL E    + +   F+E+YNE +KDL    D  ND+G+      
Sbjct: 461 DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDGS------ 514

Query: 191 FDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTK 250
            ++L  + R +S + +  ++N        KL N  ++ S  + + K      +R+T  T 
Sbjct: 515 -EALKHEIRHDSDSQTTHITNITVC----KLTNREMVNSILVRAMK------MRSTAATS 563

Query: 251 ASATTTTT 258
           A+A ++ +
Sbjct: 564 ANARSSRS 571

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGE 346
           +L + +K R  A+T  N  SSRSH++F I L  +  + GE
Sbjct: 549 ILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 113/248 (45%), Gaps = 37/248 (14%)

Query: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74
           +EL   + V CR R   + + + S  +++           N ++ I    +     +T D
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDE-----NGTQCITIKREAKYHKFTFD 411

Query: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134
           + FG   +   IF EI + L    + GYN  +  YG T +GKTYTM          L+  
Sbjct: 412 RCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPE 460

Query: 135 AGIIPRILFKLFETLEKLNE---DHIVKCSFVELYNEELKDLLHG-DCNNDNGNFKKLRI 190
            GIIP  L  +F  +EKL E    + +   F+E+YNE +KDL    D  ND+G+      
Sbjct: 461 DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDGS------ 514

Query: 191 FDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTK 250
            ++L  + R +S + +  ++N        KL N  ++ S  + + K      +R+T  T 
Sbjct: 515 -EALKHEIRHDSDSQTTHITNITVC----KLTNREMVNSILVRAMK------MRSTAATS 563

Query: 251 ASATTTTT 258
           A+A ++ +
Sbjct: 564 ANARSSRS 571

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGE 346
           +L + +K R  A+T  N  SSRSH++F I L  +  + GE
Sbjct: 549 ILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 93/186 (50%), Gaps = 17/186 (9%)

Query: 289 GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK-GEI 347
           G  ++NL+   + T +E +K+L       Q    + N+   RSHTI  +++ K  K  E 
Sbjct: 192 GFQVENLRTTQVLTLEE-LKILINICLLNQ--KERHNNLIQRSHTIMEVSIEKRNKLDES 248

Query: 348 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKN--------- 398
             +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L   N         
Sbjct: 249 ITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDI 308

Query: 399 ---VH-VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNK 454
              +H VP++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+    
Sbjct: 309 STLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTN 368

Query: 455 PQLGSF 460
           P++  F
Sbjct: 369 PRINRF 374

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 75/141 (53%), Gaps = 24/141 (17%)

Query: 61  GFTA-QMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYT 119
           GF+  Q+ +  Y  DKVF  + T  +   E  E      ++GYN +++ YG + TGK++ 
Sbjct: 62  GFSKDQVVNTQYKFDKVFASNDT-GVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFE 120

Query: 120 MTGDEKLYNEELSDSAGIIPRILFKLFETLEK------LNEDHIVKCSFVELYNEELKDL 173
           + G+++          G+I ++L KLF  +++       N  + VK SF+E+Y E++ DL
Sbjct: 121 LYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDL 171

Query: 174 LHGDCNNDNGNFKK-LRIFDS 193
           +      D+ + KK L+I DS
Sbjct: 172 M------DSPSVKKHLKINDS 186

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 70  TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE 129
           T+  DKVF  +ATQ  + D +  P   D + GYN T+L YG + +GK+Y++ G +  YNE
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YNE 131

Query: 130 ELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYNEELKDLL 174
                 G++P I   LFETLE+  E    +  V     E+Y E+  DLL
Sbjct: 132 ------GVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 143/305 (46%), Gaps = 47/305 (15%)

Query: 329 SRSHTIFTITLFKEVKGE-IFRLSKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 385
           S+SH +F + + +  + E I + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 386 TLGRVINSLADKNVHVPF----------RESKLTRLLQDSLGGNTKTALIATISPAKVTL 435
            L  ++  LA KN    +          RES+LT +L+DSLGGN K  +I T   + V  
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 436 EETCSTLEYASKAKNIKNKPQLGS----------FIMKDILLK--NITTELTKIKSDLLS 483
             T STLE+    + I NK    +            ++D+ +K  N  +++  +KS+L S
Sbjct: 351 --TISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDS 408

Query: 484 TKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQR 543
            K    +  +    +++ T+L+NY+ E  + K  ++S+T     LL      N NN +  
Sbjct: 409 LKD---LSNESSSREDMKTELENYEKENVKLKLQLDSITQ----LLSSSTNENPNNNID- 460

Query: 544 IKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFK 603
                 +E  + L  + E+   +E   D ++      NSKL K  +  K++E  + S   
Sbjct: 461 ------DEVAEILMKRCEQIAQLELSFDRQMN----ANSKLRKEFEYKKSKEEALESMNV 510

Query: 604 TLLDH 608
            LL+ 
Sbjct: 511 RLLEQ 515

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 95/185 (51%), Gaps = 16/185 (8%)

Query: 289 GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK-GEI 347
           G+ + NL++ H+ + KE +    + +    V ++K ++   R++TIF I + K  K  E 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 348 FRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLAD------KNVH- 400
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I SL+       KN   
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 401 -----VPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKP 455
                VP+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 456 QLGSF 460
           Q+  F
Sbjct: 385 QINKF 389

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 14/106 (13%)

Query: 76  VFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSA 135
           +F   +   LI + I   +  + ++GYN  ++ YG   +GKTY+      LY  ++ DS 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 136 GIIPRILFK-LFETLEKLNED------HIVKCSFVELYNEELKDLL 174
           G + +I+FK LF  + K   D       IVK SF+E++ +++ DLL
Sbjct: 143 G-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 14/110 (12%)

Query: 70  TYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNE 129
           T+  DKVF  +ATQ  + D + +P  +D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 130 ELSDSAGIIPRILFKLFETLE-----KLNEDHIVKCSFVELYNEELKDLL 174
              D  GI+P I   LF TLE     K N   +   +F E+Y E+  DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAF-EIYMEKTYDLL 175

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 74/139 (53%), Gaps = 17/139 (12%)

Query: 329 SRSHTIFTITL-FKEVKGEIFRLSKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 385
           SRSH +F + +  +  + +I + S + L+DL G+E  ++     L+Q + +   +NQS+ 
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKK--LNQSIE 291

Query: 386 TLGRVINSLADKNV----------HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 435
            L   + SL  K++             +RES+LT +L+DSLGGN KT +I T   + V  
Sbjct: 292 ALKNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVP- 350

Query: 436 EETCSTLEYASKAKNIKNK 454
             T STL++    + I N+
Sbjct: 351 -TTLSTLKFGDSIRQINNR 368

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%), Gaps = 12/127 (9%)

Query: 52  VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 111
           V   T+  +  T +    T+  DKVF  +ATQ  +   +  P+ +D + GYN T++ YG 
Sbjct: 56  VLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGP 115

Query: 112 TSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYN 167
           + +GK+Y++ G +        +S GI+P I   LF+TLEK  E       V     E+Y 
Sbjct: 116 SFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYM 167

Query: 168 EELKDLL 174
           E+  DLL
Sbjct: 168 EKTYDLL 174

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)

Query: 329 SRSHTIFTITL-FKEVKGEIFRLSKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 385
           SRSH +F + +  +  K +I + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 386 TLGRVINSLA---------DKNVHV-PFRESKLTRLLQDSLGGNTKTALIATISPAKVTL 435
            L   + SL+          K  H   +RES+LT +L+DSLGGN KT +I T   + V  
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 436 EETCSTLEYASKAKNIKNK 454
             T STLE+    + I NK
Sbjct: 351 --TLSTLEFGDSIRQINNK 367

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 63/127 (49%), Gaps = 12/127 (9%)

Query: 52  VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 111
           V   TSE    T      T+  DKVF  +ATQ  + D +  P   D + GYN T++ YG 
Sbjct: 56  VLFRTSEPSHETTGDTYSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGP 115

Query: 112 TSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLFETLEKLNE----DHIVKCSFVELYN 167
           + +GK+Y++ G +        +  GI+P I   LFETLEK  E    +  V     E++ 
Sbjct: 116 SFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFM 167

Query: 168 EELKDLL 174
           E+  DLL
Sbjct: 168 EKTYDLL 174

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 13/137 (9%)

Query: 329 SRSHTIFTITLFKEVK-GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 387
           S+SH +F + + +  +  +I R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 388 GRVINSLADKNVHVPF----------RESKLTRLLQDSLGGNTKTALIATISPAKVTLEE 437
             ++  L+ K+    +          RES+LT +L+DSLGGN KT +I T   + V+   
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 438 TCSTLEYASKAKNIKNK 454
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 63/108 (58%), Gaps = 10/108 (9%)

Query: 69  KTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYN 128
           +T+++DKVF PSA+Q+ +   +  P+  +   G N  M   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 129 EELSDSAGIIPRILFKLFETLEKLNEDHIVKCSF--VELYNEELKDLL 174
                S G++ RIL K+F+ + + NE   V+ S   VEL N+++ DLL
Sbjct: 100 -----SQGLLQRILTKVFQLMNE-NEGVTVQYSLSAVELVNDKVYDLL 141

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 131/293 (44%), Gaps = 51/293 (17%)

Query: 329 SRSHTIFTITL-FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 387
           SRS     IT+  +  K E  + S + L+DLA S+ ++++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 388 GRVINSLAD-----------KNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLE 436
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K   E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 437 ETCSTLEYASKAKNIKNKP-----QLGSFIMKDILLKNITTE----LTKIKSDLLSTKSK 487
            T  TL   S+ ++I N P      L S  + D+ LKN++T     LT+IK         
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTREDSYLTRIK--------- 391

Query: 488 DGIYMDQQHYKELTTDLQNYKTEIQECKRTIE---SLTSQNALLLKDKRTINENNE---- 540
              Y++ +  K L   +Q  K ++   K   E    L  Q  L  K ++T    +E    
Sbjct: 392 ---YLEDEVSK-LGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENL 447

Query: 541 --LQRIKIQT-MNESMKKLYAKIER----QQSIENELDGKIQIFTKTNSKLTK 586
              Q  +IQ  M+E +  L  K ER    Q  ++ EL  K Q+  + N K +K
Sbjct: 448 TSQQNGRIQNEMSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQLNYKESK 500

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 63/117 (53%), Gaps = 12/117 (10%)

Query: 62  FTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMT 121
           F+   ++  +  +KV+     Q  + ++I      + + G+N +++ +G   +GKTYTM 
Sbjct: 59  FSDANDTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMF 118

Query: 122 GDEKLYNEELSDSAGIIPRILFKLFETLEKLNED----HIVKCSFVELYNEELKDLL 174
           G++   +EE     GI+ R+   +F+ L+KL+ED      +  +F EL+ E + DLL
Sbjct: 119 GND---HEE-----GIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           Y  D +F   + ++  +D I + L  D  KGYN T++ YG TS+GK++ + GD    N+ 
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLL 174
           L +   I  R+LF   E     N   +   S  ELY +++ DLL
Sbjct: 146 LINH--IADRLLFPQCED----NLKTLCSISMWELYIDKVYDLL 183

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 153/332 (46%), Gaps = 36/332 (10%)

Query: 289 GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIF 348
           G +I++L + H+T+  E    L+ G  Y+ ++   ++   S+    F +    + K ++ 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNG--YKNISP--LHHSKSQIFVRFEVQCI-DRKDDVT 250

Query: 349 RLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADK----NVHVPFR 404
           R S +  +DL GS+ + +  A    + +    NQ +  L  +I +L ++    + H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMK- 463
           +S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +    +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 464 ----DILLKNITTE----LTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECK 515
               D+L++++  +    L KI  +LL T+ K     +       +  L+N   E  + K
Sbjct: 366 KRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQENSKLK 423

Query: 516 RTIESLTS-QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKI 574
             +ESL      + L +  + N+N      ++   +E +KKL +  E   +++  +D   
Sbjct: 424 LQLESLQQILGTMSLANPSSSNKN------EMNEHDELLKKLMSTCEDVANLQLSVDNGK 477

Query: 575 QIFTKTNSKLTKIIDEMKNREALVNSKFKTLL 606
            I    N KL K ID   ++E +  +   TLL
Sbjct: 478 HI----NRKLKKQIDANSSKEDVFETMNSTLL 505

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 139/285 (48%), Gaps = 41/285 (14%)

Query: 344 KGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPF 403
           K ++++LS ++ +DL G +   +   +     E   +N  + +   +I +L+D    +P+
Sbjct: 261 KDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSDPK-SLPY 318

Query: 404 -----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTLEETCSTLEYASKAKNIKNKPQL 457
                ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+IKN   +
Sbjct: 319 TSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIM 378

Query: 458 GSF---IMKDILL---------KNITTELTKIKSDL-LSTKSKDGIYMDQQHYKELTTDL 504
             F   + K +LL         +N  T++  ++S+L L  K  + +  D  H++E   D 
Sbjct: 379 NVFGLNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPVATD--HHEENYNDE 436

Query: 505 QNY--KTEIQECKRTIESL--------TSQNALLLKDKRTINENNELQRIKIQTMNESMK 554
            +   K  I + K  IESL        TS+N    K K   NE++EL + K+    E + 
Sbjct: 437 SSCSDKETIMKLKLKIESLEQVLEHISTSENP---KSKTETNEHDELLK-KLMDKCEDVA 492

Query: 555 KLYAKIERQQSIENELDGKIQIFTKTNSKL----TKIIDEMKNRE 595
           KL  +IE +++  ++L   ++        L     K++++++N+E
Sbjct: 493 KLQVEIEAEKNTNSKLKQDLKYSASKQHALETMNLKLLEQLQNQE 537

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 30/144 (20%)

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
           T +++S+ +  D +F  ++ Q+   + +      D   GYN + + YG +++GK+ T   
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDLFDGYNQSFITYGKSNSGKSDT--- 114

Query: 123 DEKLYNEELSDSAGIIPRILF-KLFETLEKLNEDHI--------------VKCSFVELY- 166
              L+NE+     G+I R+LF +LF+ ++ L  D+                  S +E++ 
Sbjct: 115 ---LFNEK----DGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFS 166

Query: 167 NEELKDLLHGDCNNDNGNFKKLRI 190
           +E++ DLL  +   DN   K L++
Sbjct: 167 SEKIYDLLSNEYTKDNPILKSLKV 190

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 69/172 (40%), Gaps = 50/172 (29%)

Query: 52  VAINTSEDIGFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGM 111
           + +N+S + G     N   Y  DK+F P      I   ++    +D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQ--YRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 112 TSTGKTYTMTGDEKLYNEELSD-------------------------------------- 133
           T TGKTYT+ G    +N+  +D                                      
Sbjct: 99  TGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSIL 156

Query: 134 ---SAGIIPRILFKLFETLEKLNE-----DHIVKCSFVELYNEELKDLLHGD 177
              + G+I ++   LFE ++++         +V  SFVE+Y EE+ DLL  D
Sbjct: 157 QKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLLQHD 208

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 107/233 (45%), Gaps = 33/233 (14%)

Query: 330 RSHTIFTITLFKEVKGEIFRL-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 388
           RS TI  I L +  + E     S +  VDLAGS+  ++        + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 389 RVINSLAD-KNVHV---PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEY 444
            ++ +LA+ +++ +    +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 445 ASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDL 504
           +S A ++ N+                     KI    +    K  I  D  +  E     
Sbjct: 385 SSYASSMSNQ--------------------IKINQTAIGGDKKRAILTDDWNLME----- 419

Query: 505 QNYKTEIQECKRTIESLTSQNALLLKDKRTINEN---NELQRIKIQTMNESMK 554
           + Y+  I+  K  +  ++ QN ++ +  +T+ ++   NE+ R ++ ++ + +K
Sbjct: 420 EYYRNRIELLKDELHEVSMQNVMMTRGMQTLEQSERENEILRDQLNSLVQLIK 472

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 83/167 (49%), Gaps = 18/167 (10%)

Query: 288 AGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKE-VKGE 346
           + + I+NL++ ++ + +E    L +G   R      M   +SRS+ +  I L +  ++ +
Sbjct: 235 SSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLEDQ 289

Query: 347 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRE- 405
           + + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN LA+     P+ + 
Sbjct: 290 LMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYDQQ 348

Query: 406 ----------SKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTL 442
                     S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 349 INGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 56  TSEDIGFTAQMNSKT-YTVDKVFGPSATQS-LIFDEIAEPLFSDFIKGYNCTMLVYGMTS 113
           T   I FT++    T + VDKVF     QS L+  +I +   S+   G+N +++ +G + 
Sbjct: 35  TGTRIIFTSETTGNTEFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSG 94

Query: 114 TGKTYTMTGDEKL 126
           TGK++TM G+  L
Sbjct: 95  TGKSFTMFGNNSL 107

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 88/199 (44%), Gaps = 29/199 (14%)

Query: 289 GIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL--FKEVKGE 346
           G+Y Q     +I + KE  ++++     ++ +  KM+   S SH +   ++     V G 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHGT 264

Query: 347 IFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSL---ADKN----- 398
           I   S +   DL GS    +        +    +N S+  L  V+NS+     KN     
Sbjct: 265 ITS-SNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIE 323

Query: 399 ------------VHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYAS 446
                         VP+++S+LT L+Q++LGGN++T ++      K   EET +TL +  
Sbjct: 324 NKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGV 383

Query: 447 KAKNIKNKPQLGSFIMKDI 465
           + +NI N      F+  D+
Sbjct: 384 QLQNILN------FVRADV 396

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 71  YTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEE 130
           +  +KV+        I   ++E +  D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 131 LSDSAGIIPRILFKLFETLEKLNEDH--IV--KCSFVELYNEELKDLLH 175
             DS GII      + +   +L +D   IV  + S +E+  E++ D+LH
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDMLH 187

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 63  TAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTG 122
             ++  ++++  KV    AT++  F E+A  +  D + G NC +  YG      +  M G
Sbjct: 82  VVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFG 141

Query: 123 DEKLYNEELSDS---AGIIPRILFKLFETLEK-LNEDHIVKCSFVELYNEELKDLL 174
            +   ++E  DS   +G++ +    +F  ++     ++ V  S  E+Y +++ DLL
Sbjct: 142 PQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL 197

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 158/367 (43%), Gaps = 85/367 (23%)

Query: 328 SSRSHTIFT---ITLFKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSL 384
           S +SH IF    IT   E+K +  +   +  V+LA   +   S  ++Q   +  S   +L
Sbjct: 260 SKKSH-IFVRMKITQVNELK-DTLKEGIVQFVNLAS--DFKDSPGISQEESKKSSAGVAL 315

Query: 385 LTLGRVINSLA-DKNVHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLE 443
           L    V+  L+ D++    ++E+ LT+L+ + L  N KT+ +   S       +T   L+
Sbjct: 316 LR--EVVADLSSDESKASRYKEAHLTKLMYEPLMVNFKTSFVLCCSNNSKNRNDTLQLLQ 373

Query: 444 YASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTD 503
           + ++ + I+ +     F                     L++K K  +Y+     KE    
Sbjct: 374 FGAQLQQIRTQVSGNVFG--------------------LNSKRKMELYLSDMKLKE---- 409

Query: 504 LQNYKTEIQECKRTIES---LTSQNALLLKDKRTINENNELQRIKI-------------- 546
            +NYK  I+  +R +ES   L +  A    +K      + L +I+I              
Sbjct: 410 -ENYKERIRFLQRQLESSKNLNNGTAGTTSNKPANPVMDRLMKIQIENFKLKEQVKLLHS 468

Query: 547 --------QTMNES--MKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREA 596
                   +T NE   M+ L  K E+  +++ E+D + +  TK N KL K+I+E      
Sbjct: 469 LKKAKASGETFNEEKIMQTLLEKCEQLATLQIEVDDEGEAITKLNGKL-KLIEEK----- 522

Query: 597 LVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEM---TNLLSTA 653
                     DHSL  ++ KL  Q+ NF++Q + +   V E+  ++ SE+    NL++T 
Sbjct: 523 ----------DHSLEKMNAKLVEQM-NFQEQSLEK---VIEHNSVLVSELNHWKNLITTQ 568

Query: 654 RDNFEKF 660
           +DN E  
Sbjct: 569 KDNIEAL 575

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 77/170 (45%), Gaps = 9/170 (5%)

Query: 291 YIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDF--SSRSHTIFTITL-FKEVKGEI 347
           Y ++L    +T+  E I  +      R   S    ++   S+SH I  I +  + +  ++
Sbjct: 179 YFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRNLNEDV 238

Query: 348 FRLSKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINSLAD----KNVHV 401
            +   ++  DLA  + I++    +L   + E   +N    TL   I S+++     N  +
Sbjct: 239 VKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSENPNAVI 298

Query: 402 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNI 451
           P++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I
Sbjct: 299 PYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESI 348

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 55/124 (44%), Gaps = 18/124 (14%)

Query: 86  IFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKL 145
           +++ I   L ++  +GY+  ++ YG   TGK+    G +  Y        G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTY------EGGVVLMFVQDL 128

Query: 146 FETLEKLNED-HI-VKCSFVELYNEELKDLL----------HGDCNNDNGNFKKLRIFDS 193
           ++ ++ +  D H  V  S +E++ E++ DLL          H    +D   FK L +   
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLLVNDRRPLKLHHETKQDDEYYFKDLHVAFV 188

Query: 194 LGRD 197
             RD
Sbjct: 189 TSRD 192

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 14/64 (21%)

Query: 91  AEPLFSDFI----KGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDSAGIIPRILFKLF 146
            EPL  D I    +G +C+M+ YG ++TGKT+ +               GIIP  + +L+
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLY 114

Query: 147 ETLE 150
             LE
Sbjct: 115 IYLE 118

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 67/156 (42%), Gaps = 36/156 (23%)

Query: 312 KGLKYRQVAS-TKMNDF--------SSRSHTIFTITL-FKEVKGEIFRLSKMNLVDLAGS 361
           KGLK   V+S  ++ D+        +S  HT   I+L       + FR   +  VDL   
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQ 225

Query: 362 ENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTK 421
           E++                 Q + +L  V+++  DK +     +S+  +LL +S+GGN K
Sbjct: 226 EDVL----------------QLVCSLVAVLSNDNDKKIGK--EKSQFCKLLSNSIGGNRK 267

Query: 422 TALIATISP----AKVTLEETCSTLEYASKAKNIKN 453
           T  I   S      K++LE    TLE+  K   + N
Sbjct: 268 TTFILACSTLEQNEKISLE----TLEFGLKVSQVVN 299

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 305 EGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRL---------SKMNL 355
           + I+LL    K   V S  +N     S T   + L + V+   F           S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 356 VDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHV---PFRESKLTRLL 412
           VD+ G++++ +S  +  +  E   +N SLLTLG+ IN+L    + +   P  E  + R L
Sbjct: 432 VDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 413 QDSLGGN 419
           ++S  GN
Sbjct: 489 KNSRLGN 495

>KNAG0F02460 Chr6 (463897..464328) [432 bp, 143 aa] {ON} Anc_6.131
           YGL121C
          Length = 143

 Score = 31.6 bits (70), Expect = 4.8,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 630 NQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECIT----KFLSDTPLLFDEINDNVLN 685
           +QN    E++ +    M  LL  +R+  ++ Y+E ++    +F  D   LFDE+   +L 
Sbjct: 69  HQNLPPSEDVMMNLPRMLGLLMESRERAKRLYRETLSIKTAEFTCDAQRLFDELQQEILR 128

Query: 686 LKALTSNY 693
              + S Y
Sbjct: 129 TDEMLSLY 136

>TPHA0H00260 Chr8 (43951..44490) [540 bp, 179 aa] {ON}  YER134C
          Length = 179

 Score = 32.0 bits (71), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 667 KFLSDTPLLFDEINDNVLNLKALTSNYYSQIAEN-LSDLSEEYNNFKQFITDEF 719
           KF  D PLLF ++ DN + + A +  +  +IA+  L     EY+   Q + D F
Sbjct: 52  KFFKDIPLLFRDLKDNGVKIVAASRTWAPEIAQELLKGFRIEYDGKVQSMYDFF 105

>KAFR0E00310 Chr5 complement(63266..70663) [7398 bp, 2465 aa] {ON}
           Anc_1.515 YKL203C
          Length = 2465

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 19/108 (17%)

Query: 636 DENLQLIKSEMTNLL----STARDNFEKFY-QECITKFL-------------SDTPLLFD 677
           D   ++++ E+ N+L    S  +++F K Y  + +  +L             SD PL+F 
Sbjct: 356 DHKFEVVRLEVYNILPLLASFDKESFIKLYLDQIMLHYLNVFKTLKSNSTNGSDKPLIFV 415

Query: 678 EINDNVLNLKALTSNYYSQIAENLSD-LSEEYNNFKQFITDEFYNQEK 724
            I D    +    S Y +QI +N+ D L  +Y   + F  + FY  EK
Sbjct: 416 SIGDIAFEVGHSISPYMNQILDNIRDGLRTKYKMRRNFEREVFYCIEK 463

>Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON}
           (44769..46265) [1497 nt, 499 aa]
          Length = 498

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 470 ITTELTKIKSDL-----LSTKSKDGIYMDQQHYKELTTDLQNYK----TEIQECKRTIES 520
           ITTE   +  DL       TK K+ + M +  Y  L    + YK     EI + KR++E 
Sbjct: 169 ITTEKKVLDDDLNKTSASETKLKEEMSMIENQYNSLIDSHEYYKDKYLQEINQLKRSLED 228

Query: 521 LTSQNALLLKDKRTINENNELQRIKIQTMNESMKKL 556
           LT++    LK  RT NENN+L   KI   N S  +L
Sbjct: 229 LTTEQENYLK--RT-NENNKLVEEKIDNYNNSFNQL 261

>SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 aa]
           {ON} similar to uniprot|Q750B4 Ashbya gossypii AGR043W
           AGR043Wp and weakly similar to YDR150W uniprot|Q00402
           Saccharomyces cerevisiae YDR150W NUM1 Protein required
           for nuclear migration localizes to the mother cell
           cortex and the bud tip may mediate interactions of
           dynein and cytoplasmic microtubules with the cell cortex
          Length = 3729

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 20/188 (10%)

Query: 676 FDEINDNVLNLKALTSNYYSQIAENLSDL---SEEYNNFKQFITDEFYNQEKGHQHELLN 732
           F+EI + +  L+A T  Y    AE L       EEYN+       +  ++ +    ++L+
Sbjct: 543 FNEIKEKLDLLEAPTGEYLKSKAEKLGKTLIDDEEYNSLINLSIPDIISKAENAGFDVLS 602

Query: 733 KYINNT-QTVIESSSNDVM----------STIQNLLNEHLRANKELIINSLSNVTTELMS 781
           K  +NT    +E+ + D +          +  +N   E +   K+ ++     +  EL+ 
Sbjct: 603 KDAHNTILKALETPTLDYLEEKLKGYNKITVSENEYTEFINPTKDYLLGKAEGLGYELVE 662

Query: 782 ----NELDRL--KPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINN 835
               N+L+ L  KP L    + A  IN+     N+F+D V  S       I+QT  ++  
Sbjct: 663 SKTLNDLNALVEKPSLDYLSKKASAINQVIVSKNQFDDLVSKSENPSLKIIQQTAPNLGC 722

Query: 836 NIKKINEH 843
            + KI E+
Sbjct: 723 KLLKIEEY 730

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 98/212 (46%), Gaps = 32/212 (15%)

Query: 467 LKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNY---KTEIQECKRTIESLTS 523
           +KNI  E TK+  +++  K K  + + Q+  K+L +  + Y   + EI   +  ++ L  
Sbjct: 685 IKNIENENTKLNDEIVVIKRK--LALIQEELKKLNSQREKYFRVENEINSMENKLKDLEK 742

Query: 524 QNALLLKDKRTINENNELQRIK-----IQTMNESMKKLY--------AKIERQQS--IEN 568
           Q  + + DK    E+  LQ +K     I  MNE MKK+Y        + +E  ++  IE 
Sbjct: 743 QTQVDVSDKIREIESKLLQSVKEESNLIFRMNEKMKKVYRCQKDVLHSDVEYLEALNIEK 802

Query: 569 ELDGKIQIFTKTNSKLTKIIDEMKNREALVNS--KFKTLLDHSLSYVSKK---LNYQIEN 623
            +   I +F+    +L  ++  +KN     N+   ++   + + SY  ++   +   IE 
Sbjct: 803 SIGDIINLFSNKEKELEDVVASLKNELRTKNNTEDYERWKEETRSYTEERKKIIEKYIEK 862

Query: 624 FKDQGINQNFTVDENLQLIKSEMTNLLSTARD 655
            KD+    N TVD     I  E++ L ST ++
Sbjct: 863 CKDK---DNLTVD----FIDREISRLESTLKN 887

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,170,013
Number of extensions: 5579591
Number of successful extensions: 50133
Number of sequences better than 10.0: 2858
Number of HSP's gapped: 47462
Number of HSP's successfully gapped: 4222
Length of query: 963
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 844
Effective length of database: 39,836,145
Effective search space: 33621706380
Effective search space used: 33621706380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)