Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003606.14ON50250226620.0
SAKL0E01012g6.14ON54443915330.0
TBLA0A073006.14ON57343815110.0
Kwal_56.223876.14ON54349915030.0
Smik_5.276.14ON60847915000.0
KLTH0C11396g6.14ON55043214900.0
YEL060C (PRB1)6.14ON63543814960.0
Skud_5.296.14ON60843714910.0
NDAI0K028806.14ON70442014980.0
NCAS0F002206.14ON69542314870.0
KLLA0D00979g6.14ON56146314680.0
Suva_5.76.14ON66442814640.0
TDEL0G045506.14ON56445614470.0
KNAG0E009206.14ON53145814090.0
CAGL0B03619g6.14ON46842213750.0
Kpol_1032.56.14ON68043813930.0
ACR012C6.14ON54143613780.0
Kpol_1045.756.14ON47742313670.0
ZYRO0C07942g6.14ON54842313610.0
Ecym_30186.14ON57542413410.0
TPHA0M002306.14ON58546513371e-180
Suva_15.1786.14ON47648211871e-159
Skud_15.1646.14ON48248711791e-158
Smik_15.1726.14ON47842911711e-156
YOR003W (YSP3)6.14ON47848211581e-154
CAGL0E02651g6.14ON48543610771e-142
KAFR0B065506.14ON45642110691e-141
NCAS0D026306.14ON45147710041e-131
NDAI0I022806.14ON4824509621e-125
KNAG0F02970singletonON4203279041e-117
CAGL0L13266gsingletonON5794907966e-99
NCAS0D043906.313ON4924175552e-64
ZYRO0D08822g6.313ON4903125361e-61
Kpol_1028.616.313ON5183235292e-60
SAKL0A02002g6.313ON4794015221e-59
TDEL0A072806.313ON4363655172e-59
Smik_3.1496.313ON4913135203e-59
CAGL0L10802g6.313ON5173415162e-58
KLTH0A06094g6.313ON4963115124e-58
KNAG0I024706.313ON4753735011e-56
YCR045C (RRT12)6.313ON4913135021e-56
Kpol_1018.56.313ON4653134956e-56
Suva_3.846.313ON5273984996e-56
Skud_3.1246.313ON5403134981e-55
Kwal_23.61836.313ON4933164942e-55
TPHA0D037606.313ON6073135002e-55
KAFR0J024506.313ON4783554932e-55
NDAI0I005606.313ON4833954835e-54
AAR069W6.313ON7682984684e-50
Ecym_21056.313ON6103154624e-50
TBLA0F039706.313ON7342704659e-50
KLLA0F06028g6.313ON5083204434e-48
TBLA0A067006.313ON4973194022e-42
Kpol_2000.691.78ON3863093803e-40
Kwal_33.133721.78ON3772853662e-38
KLTH0F02288g1.78ON3803113629e-38
TPHA0B045201.78ON3882693111e-30
ZYRO0F16764g1.78ON3863472961e-28
TBLA0A054101.78ON3822822731e-25
TDEL0C062301.78ON3643192607e-24
TDEL0G024002.310ON7751740.19
TPHA0A052005.85ON99150761.0
NCAS0F004905.85ON98764751.4
TBLA0B001302.6ON842251751.4
SAKL0F13178g7.422ON416235741.9
NDAI0K02490singletonON37769731.9
CAGL0F08041g5.85ON99160723.1
Kpol_1050.725.85ON98934723.7
KNAG0C033607.422ON420143714.3
Skud_7.5745.85ON98733714.8
YGR240C (PFK1)5.85ON98733714.8
NDAI0D026205.85ON98733714.9
Suva_7.5325.85ON98733714.9
Smik_16.665.85ON98733715.0
ZYRO0B08140g5.85ON98433705.6
YCR034W (FEN1)1.140ON34795695.6
Suva_3.681.140ON34795697.1
YBL091C (MAP2)7.422ON421143688.0
KNAG0A041808.463ON85659698.4
Smik_2.297.422ON421143689.2
NCAS0A145907.422ON417143689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00360
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...  1030   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   595   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   586   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   583   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   582   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   578   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   580   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   578   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   581   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   577   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   570   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   568   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   561   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   547   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   534   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   541   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   535   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   531   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   528   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   521   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   519   e-180
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   461   e-159
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   458   e-158
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   455   e-156
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   450   e-154
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   419   e-142
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   416   e-141
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     391   e-131
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   375   e-125
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              352   e-117
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   311   6e-99
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   218   2e-64
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   211   1e-61
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   208   2e-60
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   205   1e-59
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   203   2e-59
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   204   3e-59
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   203   2e-58
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   201   4e-58
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   197   1e-56
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   197   1e-56
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   195   6e-56
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   196   6e-56
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   196   1e-55
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   194   2e-55
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   197   2e-55
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   194   2e-55
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    190   5e-54
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   184   4e-50
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   182   4e-50
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   183   9e-50
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   175   4e-48
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   159   2e-42
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   150   3e-40
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   145   2e-38
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   144   9e-38
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   124   1e-30
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   118   1e-28
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   109   1e-25
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   104   7e-24
TDEL0G02400 Chr7 (460300..460533) [234 bp, 77 aa] {ON} Anc_2.310...    33   0.19 
TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa] ...    34   1.0  
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    33   1.4  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   1.4  
SAKL0F13178g Chr6 (1041547..1042797) [1251 bp, 416 aa] {ON} high...    33   1.9  
NDAI0K02490 Chr11 complement(554669..555802) [1134 bp, 377 aa] {...    33   1.9  
CAGL0F08041g Chr6 complement(792575..795550) [2976 bp, 991 aa] {...    32   3.1  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    32   3.7  
KNAG0C03360 Chr3 complement(662617..663879) [1263 bp, 420 aa] {O...    32   4.3  
Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON...    32   4.8  
YGR240C Chr7 complement(970771..973734) [2964 bp, 987 aa] {ON}  ...    32   4.8  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    32   4.9  
Suva_7.532 Chr7 complement(925240..928203) [2964 bp, 987 aa] {ON...    32   4.9  
Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C...    32   5.0  
ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly...    32   5.6  
YCR034W Chr3 (190592..191635) [1044 bp, 347 aa] {ON}  FEN1Fatty ...    31   5.6  
Suva_3.68 Chr3 (103937..104980) [1044 bp, 347 aa] {ON} YCR034W (...    31   7.1  
YBL091C Chr2 complement(47363..48628) [1266 bp, 421 aa] {ON}  MA...    31   8.0  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    31   8.4  
Smik_2.29 Chr2 complement(40990..42255) [1266 bp, 421 aa] {ON} Y...    31   9.2  
NCAS0A14590 Chr1 (2871918..2873171) [1254 bp, 417 aa] {ON} Anc_7...    31   9.7  

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/502 (100%), Positives = 502/502 (100%)

Query: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENIIPH 60
           MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENIIPH
Sbjct: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENIIPH 60

Query: 61  RYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVS 120
           RYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVS
Sbjct: 61  RYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVS 120

Query: 121 DFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRE 180
           DFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRE
Sbjct: 121 DFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRE 180

Query: 181 SLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGT 240
           SLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGT
Sbjct: 181 SLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGT 240

Query: 241 HVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGS 300
           HVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGS
Sbjct: 241 HVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGS 300

Query: 301 VANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISD 360
           VANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISD
Sbjct: 301 VANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISD 360

Query: 361 ERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEK 420
           ERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEK
Sbjct: 361 ERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEK 420

Query: 421 SSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQNSKIPG 480
           SSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQNSKIPG
Sbjct: 421 SSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQNSKIPG 480

Query: 481 SNYIGYNYFSKLKTLFDDLNFY 502
           SNYIGYNYFSKLKTLFDDLNFY
Sbjct: 481 SNYIGYNYFSKLKTLFDDLNFY 502

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 348/439 (79%), Gaps = 7/439 (1%)

Query: 46  LAP-VHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTD 104
           LAP V +    NIIPHRYIIVFK   + E+I FHKE+I+  H +  +   +  + +  T 
Sbjct: 65  LAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATK 124

Query: 105 INVPE---SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTT 161
            +  E   + + S GGI   FDI+++L+GYI Y +DE++ FIR+N  + FIE D++V  +
Sbjct: 125 GSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFAS 184

Query: 162 DFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAH 221
           +F+TQN APWGL+RISHRE LNL +FNKYLYDDDAGK V +YVIDTG++VNH +F+ RA 
Sbjct: 185 EFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAV 244

Query: 222 WGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVE 281
           WGKT+P ND+D DGNGHGTH AGTI S+HYGVAK+  ++A+KVLRSNGSG+MSDVVKGVE
Sbjct: 245 WGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVE 304

Query: 282 FAVSSHLE-RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNAC 340
           FA  SH E   KN+K  KGS ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ+AC
Sbjct: 305 FAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDAC 364

Query: 341 NSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTS 400
           N+SPA+AE A+TVGAST+SD+RAYFSNWG+CVDIFAPGLN+LSTYIG+ +  TATLSGTS
Sbjct: 365 NTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGS-ETATATLSGTS 423

Query: 401 MASPHVAGLLAYYLSLQPEKSSE-FSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLI 459
           MASPHVAGLL Y+LSLQP+  SE F    I+ +QLKKKLI Y+TKDVL +LPE TPN LI
Sbjct: 424 MASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPNYLI 483

Query: 460 YNGGGQDLSDFWNLQNSKI 478
           YNGGGQDLSDFW     ++
Sbjct: 484 YNGGGQDLSDFWGKSEEQV 502

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/438 (65%), Positives = 351/438 (80%), Gaps = 19/438 (4%)

Query: 45  SLAPVHNAD--AENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND---FTE 99
           ++AP+++     +NIIPHRYII FK  V+ E+I FH++ I  L  Q  +   +D   F  
Sbjct: 110 AIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169

Query: 100 YLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVH 159
               D+  P         I+  F+I+SLL GYI Y +D+++ FIRLNPL+ F+E D+ V+
Sbjct: 170 VEGLDLQQP---------IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVN 220

Query: 160 TTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219
             +F+TQN APWGLARISHRE LNL +FNKYL+DD AG+ V AYVIDTGV+V H +F  R
Sbjct: 221 INEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGR 280

Query: 220 AHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKG 279
           A WGKTIP ND+D+DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSGSMSDV+KG
Sbjct: 281 ASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKG 340

Query: 280 VEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338
           VE+A +SHL  +KN+K+  KGS ANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNENQ+
Sbjct: 341 VEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQD 400

Query: 339 ACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSG 398
           ACN+SPASA+ A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ DD TATLSG
Sbjct: 401 ACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSG 459

Query: 399 TSMASPHVAGLLAYYLSLQPEKSSEFSTR---AISTSQLKKKLIEYATKDVLEDLPEGTP 455
           TSMASPHVAGLL+Y+LSLQPE+ SEF+T     I+ +QLKK+LI Y TKD+L D+PE TP
Sbjct: 460 TSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTP 519

Query: 456 NVLIYNGGGQDLSDFWNL 473
           NVL++NG GQDLSDFWN+
Sbjct: 520 NVLVFNGAGQDLSDFWNI 537

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/499 (58%), Positives = 371/499 (74%), Gaps = 31/499 (6%)

Query: 1   MQLLIHL-LLVCSTLVNALVIPSLKDS-------------------IDKFSDDI-HGLLD 39
           M+L   L + + + L +ALV+P ++++                   +  FS ++     +
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAE 60

Query: 40  SAKFSSLAPVHNA-DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF-SND- 96
           S    +L+P+  A +  + IPHRYI+VFKD V  E++ FH E+++  H Q      +ND 
Sbjct: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120

Query: 97  -FTEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHD 155
            F   +  ++ +  + R+  GGI+  FD++ +L GYI Y + E++ FIR+NPL+AF+E D
Sbjct: 121 FFEATMDEEMGIMATSRE--GGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQD 178

Query: 156 TMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVE 215
           +MV+  +F+TQN APWGL+RISHRE LNL +FNKYLYDD AGK V +YVIDTG++++H +
Sbjct: 179 SMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKD 238

Query: 216 FHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
           F  RA WGKT+P ND D DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSGSMSD
Sbjct: 239 FEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSD 298

Query: 276 VVKGVEFAVSSHLERM-KNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 334
           VVKGVEFA  SH + + KN+K  KGS ANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGN
Sbjct: 299 VVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGN 358

Query: 335 ENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTA 394
           ENQ+ACNSSPA+AE A+TVGAST++D+RAYFSNWG+CVDIFAPGLN+LSTYIG+ +  TA
Sbjct: 359 ENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-ETATA 417

Query: 395 TLSGTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPE 452
           TLSGTSMASPHVAGLL Y+LSLQP+  SE+  +   I+ SQLKKKLI Y+TK+ L DLPE
Sbjct: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPE 477

Query: 453 GTPNVLIYNGGGQDLSDFW 471
            T N LIYNGGGQDL DFW
Sbjct: 478 DTVNYLIYNGGGQDLDDFW 496

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/479 (60%), Positives = 360/479 (75%), Gaps = 30/479 (6%)

Query: 46  LAPV-----HNADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--- 96
           LAP+      N DA   IIP+RYI+VFK GV +E++ FHKE +    LQ     S +   
Sbjct: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193

Query: 97  FTEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDT 156
           FT    T ++  E+     GGI   F+I ++ SGYI Y + E++  IR NPL+ F+E D+
Sbjct: 194 FTSTRDTYLSTSEA-----GGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248

Query: 157 MVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216
           +V  T+F+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV++NH +F
Sbjct: 249 VVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 308

Query: 217 HSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDV 276
             RA WGKTIPLND+D+DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSG+MSDV
Sbjct: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDV 368

Query: 277 VKGVEFAVSSHLER-MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           VKGVE+A  +H ++  + +K  KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNE
Sbjct: 369 VKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428

Query: 336 NQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTAT 395
           NQ+ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ D+ TAT
Sbjct: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATAT 487

Query: 396 LSGTSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPE 452
           LSGTSMASPHVAGLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+PE
Sbjct: 488 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE 547

Query: 453 GTPNVLIYNGGGQDLSDFWNLQNSKIPGSN--------YIGYN---YFSKLKTLFDDLN 500
            TPN LIYNGGGQDLS FWN      P  +        +IG      F +++ + D LN
Sbjct: 548 DTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLN 606

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/432 (65%), Positives = 339/432 (78%), Gaps = 15/432 (3%)

Query: 58  IPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF---------SNDFTEY--LQTDIN 106
           IPHRYI+VFK  +S E++ FHK++++  HLQ  +           + +F E    + D  
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138

Query: 107 VPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQ 166
              S +   GGI   FD+S LL+GYI Y +DE++ FIR+NPL+ F+E D++V   +F TQ
Sbjct: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198

Query: 167 NNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTI 226
           N APWGL+RISHRE LNL +FNKYLYDDDAGK V +YVIDTGV+V+H +F  RA WGKTI
Sbjct: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258

Query: 227 PLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSS 286
           P ND D DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSGSMSDVVKGVEFA  S
Sbjct: 259 PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKS 318

Query: 287 HLERMK-NEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPA 345
           H + +K N+K  KGS ANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQ+ACNSSPA
Sbjct: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378

Query: 346 SAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPH 405
           SAE AVTVGAST++D+RAYFSNWG+CVDIFAPGLN+LSTYIG+ D  TATLSGTSMASPH
Sbjct: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-DTATATLSGTSMASPH 437

Query: 406 VAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGG 463
           VAGLL Y+LSLQP+  SE+  +   I+ SQLKKKLI Y+TK+VL D+P+ T N LI+NGG
Sbjct: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497

Query: 464 GQDLSDFWNLQN 475
           G+ L DFW  ++
Sbjct: 498 GEGLDDFWGKES 509

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/438 (65%), Positives = 345/438 (78%), Gaps = 15/438 (3%)

Query: 46  LAPV-----HNADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTE 99
           LAP+      N DA   IIP+RYIIVFK G  +E+I FHKE +    LQ     S +   
Sbjct: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220

Query: 100 YLQT-DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMV 158
           ++ T D ++  S     GGI   F+I +L SGYI Y + E++  IR NPL+ F+E D++V
Sbjct: 221 FISTKDTSLSTS---EAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277

Query: 159 HTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHS 218
             T+F+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV++NH +F  
Sbjct: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337

Query: 219 RAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVK 278
           RA WGKTIPLND+D+DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSG+MSDVVK
Sbjct: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVK 397

Query: 279 GVEFAVSSHL-ERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 337
           GVE+A  +H  E  + +K  KGS ANMSLGGGKSPALDLAVNAAV+ GIHFAVAAGNENQ
Sbjct: 398 GVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457

Query: 338 NACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLS 397
           +ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ DD TATLS
Sbjct: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLS 516

Query: 398 GTSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGT 454
           GTSMASPHVAGLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+PE T
Sbjct: 517 GTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDT 576

Query: 455 PNVLIYNGGGQDLSDFWN 472
           PNVLIYNGGGQDLS FWN
Sbjct: 577 PNVLIYNGGGQDLSAFWN 594

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/437 (65%), Positives = 341/437 (78%), Gaps = 9/437 (2%)

Query: 41  AKFSSLAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEY 100
           A   S A    A    IIP+RYIIVFK GV +E   FHKE +    LQ     S +   +
Sbjct: 135 APLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFF 194

Query: 101 LQT-DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVH 159
           + T D ++  S     GGI   F+I ++ SGYI Y + E++  IR NPL+ F+E D++V 
Sbjct: 195 ISTRDSSLSTS---ETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251

Query: 160 TTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219
            TDF+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV+VNH +F  R
Sbjct: 252 ATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 311

Query: 220 AHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKG 279
           A WGKTIPLND+D+DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSG+MSDVVKG
Sbjct: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKG 371

Query: 280 VEFAVSSHLER-MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338
           VE+A  +H ++  + +K  KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQ+
Sbjct: 372 VEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431

Query: 339 ACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSG 398
           ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG+ DD TATLSG
Sbjct: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGS-DDATATLSG 490

Query: 399 TSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTP 455
           TSMASPHVAGLL Y+LSLQP   SEF      +++  QLK KLI Y+TKD+L D+PE TP
Sbjct: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTP 550

Query: 456 NVLIYNGGGQDLSDFWN 472
           N LIYNGGGQDLS FWN
Sbjct: 551 NALIYNGGGQDLSAFWN 567

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/420 (67%), Positives = 337/420 (80%), Gaps = 6/420 (1%)

Query: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLG 116
           I+P++YIIVFKD ++ ++I +HKELI+ +  Q +S        +  T     ES R   G
Sbjct: 238 ILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRN--G 295

Query: 117 GIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176
           GI+S F+I+++LSGY  Y + E++  IRLNPL+ ++E D++V TT+FNTQNNAPWGL+RI
Sbjct: 296 GIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRI 355

Query: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236
           SHRE LNL +FNKYLYDDDAGK V  +VIDTG++VNHV+F  RA WGKTIP NDQDIDGN
Sbjct: 356 SHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQDIDGN 415

Query: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKN 296
           GHGTH AGTI S HYGVAK+  ++AVKVLRSNGSGSMSDV+KGVEFA  +HL   KN+K+
Sbjct: 416 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEKNKKD 475

Query: 297 LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGAS 356
            KGS ANMSLGGGKSP LDLAVNAAV+AGIHF+VAAGNENQ+ACNSSPASAE A+TVGAS
Sbjct: 476 YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVGAS 535

Query: 357 TISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSL 416
           T+SD+RAYFSNWG CVD+FAPGLNILSTY+G  +D TATLSGTSMASPHVAGLL Y+LSL
Sbjct: 536 TLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFLSL 595

Query: 417 QPEKSSEF----STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472
           QP+  S F    S   I+  QLKKKLI Y+T D+L DLP+GTPN LIYNG G D+SD WN
Sbjct: 596 QPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDLWN 655

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/423 (66%), Positives = 341/423 (80%), Gaps = 6/423 (1%)

Query: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLG 116
           IIP+RYI+VFK  +  E++ FHKELI  + L+ ++    D   +  + I   ES+ Q  G
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIED-ESINQ--G 154

Query: 117 GIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176
           GI++ F+IS+LL+GY+ Y +DE+L  IR+NPL+ ++E D++V  T+F+ QNNAPWGLARI
Sbjct: 155 GILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARI 214

Query: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236
           SHRE LNL +FNKYLYDDDAGK V  YVIDTG++  H +F+ RA WGKTIPLND+DIDGN
Sbjct: 215 SHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGN 274

Query: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKN 296
           GHGTH AGTI S HYGVAK+  ++AVKVLRSNGSGSMSDV+KGVEFA  SH++  K +K 
Sbjct: 275 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKK 334

Query: 297 -LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA 355
             KGS ANMSLGGGKSP LDLAVNAAV AGIHFAVAAGNENQ+ACN+SPASAE+A+TVGA
Sbjct: 335 GFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGA 394

Query: 356 STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLS 415
           ST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG +DD TATLSGTSMASPHVAGLL Y+LS
Sbjct: 395 STLSDDRAYFSNWGKCVDIFAPGLNILSTYIG-DDDATATLSGTSMASPHVAGLLTYFLS 453

Query: 416 LQPEKSSE-FSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQ 474
           LQP   SE F    ++ +Q+KKKLI Y++KDVL DLPEGTPN LI+NG G +L D WN +
Sbjct: 454 LQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNKK 513

Query: 475 NSK 477
           + +
Sbjct: 514 SQE 516

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/463 (62%), Positives = 349/463 (75%), Gaps = 20/463 (4%)

Query: 39  DSAKFSSLAPVHNA-----------DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHL 87
           DS KF  L PV +A           D  N IP+RYIIVFK   S ++++FH+EL++  H 
Sbjct: 67  DSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHA 126

Query: 88  QQSSAFSNDFTEYLQTDINVPE--SMRQSL-GGIVSDFDISSLLSGYIAYLSDELLHFIR 144
           +   + +++   +  T     E      SL GGI   FDI+  LSGY+ Y + E++ FIR
Sbjct: 127 KALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIR 186

Query: 145 LNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYV 204
            +PL+ F+E D+MV +  FNTQN+APWGLARISHRE LNL +FNKYLYDDDAGK V AYV
Sbjct: 187 RSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYV 246

Query: 205 IDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKV 264
           +DTGV+VNH +F  RA WGKTIP +D D+DGNGHGTH AGTIGS HYGVAK+ +I+AVKV
Sbjct: 247 VDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKV 306

Query: 265 LRSNGSGSMSDVVKGVEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVK 323
           LRSNGSG+MSDVVKGVE+   +H + ++ +K   KGS ANMSLGGGKSPALDLAVNAAVK
Sbjct: 307 LRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVK 366

Query: 324 AGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILS 383
           AG+HFAVAAGNENQ+ACN+SPA+AE A+TVGAST+SDERAYFSNWG+CVDIF PGLNILS
Sbjct: 367 AGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILS 426

Query: 384 TYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEY 441
           TYIG+ D  TATLSGTSMA+PHV GLL Y+LSLQP+  SE+  +   I+ SQLKKKLI++
Sbjct: 427 TYIGS-DTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDF 485

Query: 442 ATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQNS--KIPGSN 482
           +TK+VL DLPE T N LIYNGGGQDL D W    S  K P +N
Sbjct: 486 STKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSAN 528

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/428 (65%), Positives = 339/428 (79%), Gaps = 10/428 (2%)

Query: 51  NADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQT-DINVP 108
           N DA   IIP+RYIIVFK  V  E+  FH+E +    LQ     + +   ++ T D  + 
Sbjct: 199 NPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALS 258

Query: 109 ESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNN 168
            S     GGI   F+I SL SGYI Y + E++  IR NPL+ F+E D++V  TDF+TQN+
Sbjct: 259 SS---EAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNS 315

Query: 169 APWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPL 228
           APWGLAR+SHRE LNL +FNKYLYDDDAG+ V +YVIDTGV+VNH +F  RA WGKTIPL
Sbjct: 316 APWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPL 375

Query: 229 NDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHL 288
           ND+D+DGNGHGTH AGTI S+HYGVAK+ N++AVKVLRSNGSG+MSDV+KGVE+A  +H 
Sbjct: 376 NDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAHQ 435

Query: 289 ERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASA 347
           ++ + +K   KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQ+ACN+SPASA
Sbjct: 436 KQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASA 495

Query: 348 EQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVA 407
           ++A+TVGAST+SD+RAYFSN+G+CVD+FAPGLNILSTYIG+ D+ TATLSGTSMASPHVA
Sbjct: 496 DKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVA 554

Query: 408 GLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGG 464
           GLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+P+ TPN LIYNGGG
Sbjct: 555 GLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGG 614

Query: 465 QDLSDFWN 472
           QDLS FWN
Sbjct: 615 QDLSAFWN 622

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/456 (60%), Positives = 341/456 (74%), Gaps = 20/456 (4%)

Query: 56  NIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSL 115
           N  PHRYI+V K   S E+I  H E IT   LQ          E  Q D        ++ 
Sbjct: 109 NAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQS-------VGELAQDDPFFSAQGVRTT 160

Query: 116 GGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLAR 175
           GGI   FD++ LL+GY+ Y +D ++  IR +P++ F+E D+ VH ++F+TQN APWGL+R
Sbjct: 161 GGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSR 220

Query: 176 ISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDG 235
           ISHRE LNL +FNKYL+DD+AGK V +YVIDTG++V H +F  RAHWGKTIP ND+D+DG
Sbjct: 221 ISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDG 280

Query: 236 NGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEK 295
           NGHGTH AGTI S+HYGVAK  +++AVKVLRSNGSGSMSDV+KGVEFA  SH + +K++K
Sbjct: 281 NGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKK 340

Query: 296 N-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVG 354
              KGS ANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ+ACN+SPA+AEQAVTVG
Sbjct: 341 KGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVG 400

Query: 355 ASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYL 414
           AST+SD+RAYFSN+G+CVDIFAPGLNILSTYIG+ DD TATLSGTSMASPHVAGLL Y+L
Sbjct: 401 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFL 459

Query: 415 SLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFW 471
           SLQP+  S+F    ++ ++  QLKKKLI Y+TKD+L DLPE TPN LIYNGGG  L  FW
Sbjct: 460 SLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFW 519

Query: 472 NLQNSKIPGSNY-------IGYNYFSKLKTLFDDLN 500
           +  + +   + +       +  N  +K   LFD + 
Sbjct: 520 DGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVR 555

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/458 (60%), Positives = 335/458 (73%), Gaps = 39/458 (8%)

Query: 61  RYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVS 120
           +YII+FK+GV+ EQI  HK+L+  + L+ S                       S  GIV+
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQVLLETSDV---------------------SAQGIVA 135

Query: 121 D----FDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARI 176
           D    FD+  +LSGY+A LS  +L  +R +P +  +E D+ VHT +F+TQNNAPWGLARI
Sbjct: 136 DVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARI 195

Query: 177 SHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGN 236
           SHR+ L+L +FNKYLYDD AG+ VD+Y+IDTG++V H EF  RA WGKTIP ND D DGN
Sbjct: 196 SHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGN 255

Query: 237 GHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMK-NEK 295
           GHGTH AGTI S+HYGVAK  N+IAVKVLRSNGSGSMSDV+ GVEFA   H  + K N+K
Sbjct: 256 GHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDK 315

Query: 296 NLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA 355
             KGS ANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQ+ACN+SPA++E+A+TVGA
Sbjct: 316 KFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGA 375

Query: 356 STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLS 415
           ST+SD+RAYFSNWG CVDIFAPGLNILSTY G+ DD TATLSGTSMASPHVAGLL Y+LS
Sbjct: 376 STLSDDRAYFSNWGSCVDIFAPGLNILSTYTGS-DDATATLSGTSMASPHVAGLLTYFLS 434

Query: 416 LQPEKSSEFSTRA-ISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWNLQ 474
           LQPEKSS+F T A I+  QLKKKL++Y+TK VL DLPE TPN LIYNGGG DLSDFW  +
Sbjct: 435 LQPEKSSQFGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDK 494

Query: 475 NSKIPGSNYIGYNY----------FSKLKTLFDDLNFY 502
             K        + Y          F +++ +F  LN +
Sbjct: 495 GKK-SHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/422 (61%), Positives = 323/422 (76%), Gaps = 13/422 (3%)

Query: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQ--QSSAFSNDFTEYLQTDINVPESMRQS 114
           ++PH+YI+V K GVS E +      ++  H    +     +DF  ++  +  +P      
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAE-GLPR----- 54

Query: 115 LGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLA 174
            GGI   F+I+ L  G I Y  + ++  +  + ++ F+E D++VH ++F+TQNNAPWGLA
Sbjct: 55  -GGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113

Query: 175 RISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDID 234
           RISHR+ LNL NFNKYLYD+  G+ V AYVIDTG++V HVEF  RA WGKTIPLND DID
Sbjct: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173

Query: 235 GNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNE 294
           GNGHGTH AGTI S+HYG+AK  N++AVKVL+S+GSG+MSDV+KGVE+A  +HL+  KN 
Sbjct: 174 GNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNN 233

Query: 295 KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVG 354
           K  KGS ANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQ+ACN+SPASAE+A+TVG
Sbjct: 234 KKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVG 293

Query: 355 ASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYL 414
           AST+SD+RAYFSNWG+CVDIFAPGLNILSTYIG  +  TA+LSGTSMASPHVAGLL Y+L
Sbjct: 294 ASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFL 353

Query: 415 SLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPE-GTPNVLIYNGGGQDLSDF 470
           SLQP+  SEF   S   ++ +QLKKKLI Y+TK+VL DLP+  +PN+LIYNG G DL  F
Sbjct: 354 SLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVF 413

Query: 471 WN 472
           WN
Sbjct: 414 WN 415

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/438 (60%), Positives = 341/438 (77%), Gaps = 21/438 (4%)

Query: 39  DSAKFSSLAPVHNADAEN-IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDF 97
           +  K++ L  + N   EN +IP++YIIVFK  VS + +Q HK+LI     Q +S      
Sbjct: 212 EKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSD--- 268

Query: 98  TEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTM 157
                      E+    LGGI   F++++L  GYI + +++L+ FIRL+P++ F+E D++
Sbjct: 269 -----------ETSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSI 317

Query: 158 VHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFH 217
           VH  + +TQNNAPWGLARISHR+ LNL ++NKYLYDD AG+ V AYVIDTG+++ H EF 
Sbjct: 318 VHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFG 377

Query: 218 SRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVV 277
            RA WGKTIP NDQD+DGNGHGTH AGTI S++YGVAK+  ++AVKVLRS+GSG+MSDV+
Sbjct: 378 GRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVL 437

Query: 278 KGVEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336
           KGVE+A  SH + ++ +K   KGS ANMSLGGGKS +LDLAV+AAVK+GIHFAVAAGNEN
Sbjct: 438 KGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNEN 497

Query: 337 QNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATL 396
           Q+ACNSSPA++E A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ D+ TATL
Sbjct: 498 QDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATL 556

Query: 397 SGTSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEG 453
           SGTSMASPHVAGLL+Y+LS+QP+  SEF    + +IS +QLKKKLI Y+TK++ +DLPE 
Sbjct: 557 SGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEK 616

Query: 454 TPNVLIYNGGGQDLSDFW 471
           TPN+L+YN  G ++SDFW
Sbjct: 617 TPNLLVYN-AGHNISDFW 633

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/436 (58%), Positives = 325/436 (74%), Gaps = 6/436 (1%)

Query: 53  DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE--- 109
           D    IPH+YI+VF++GVS E+  FH EL+   H +  +        +  T     E   
Sbjct: 66  DVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGI 125

Query: 110 SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169
           +  ++ GGI  +F +   L GY+ Y +++++  +R NP + F+E D+MV  +DF TQN A
Sbjct: 126 AATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGA 185

Query: 170 PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229
           PWGLAR+SHRE LN  +FNKYLYDD++G+ V +YVIDTG++++HV+F  RA WGKTIP N
Sbjct: 186 PWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNN 245

Query: 230 DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289
           D D DGNGHGTH AGTI S+ YGVAK  N++AVKVLRSNG+GSMSDV++GVE+AV +H +
Sbjct: 246 DADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRK 305

Query: 290 RM-KNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAE 348
              K +K  KGS ANMSLGGG+S ALDLAV+AAV AGIHFAVAAGNENQ+ACN+SPA+++
Sbjct: 306 AAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQ 365

Query: 349 QAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAG 408
           +A+TVGAST++D+RAYFSNWG CVD+FAPG+NILSTYIG+ D   ATLSGTSMASPHVAG
Sbjct: 366 KAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSGTSMASPHVAG 424

Query: 409 LLAYYLSLQPEKSSEFSTR-AISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDL 467
           LL Y+LSLQP+  SEF  +  IS   LKKK+I++ TKD L  LP  T NVLIYNGGG DL
Sbjct: 425 LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484

Query: 468 SDFWNLQNSKIPGSNY 483
           SDFW  +  K+ G  +
Sbjct: 485 SDFWGNKPKKVSGPKF 500

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/423 (61%), Positives = 321/423 (75%), Gaps = 13/423 (3%)

Query: 57  IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND---FTEYLQTDINVPESMRQ 113
           +IP+ YI+VF +GV++ +I  H E ++ L LQ  +    D   FT    +D+N       
Sbjct: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVN----SNG 89

Query: 114 SLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGL 173
            LGG+   F I + L GY    +DE++ F+RL+PL+ FIE D+MVHTT+  TQ NAPWGL
Sbjct: 90  LLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGL 149

Query: 174 ARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI 233
           ARISHR  LNL+ FNKYLYDD  GK V AYVIDTG+++ +V+F  RA+WGKTIP  + ++
Sbjct: 150 ARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANV 209

Query: 234 DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKN 293
           DGNGHGTHVAGTI S HYGVAK V + AVKVLRSNG+GSMSDV+KGVE+ V +H +R   
Sbjct: 210 DGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAH-QRDVG 268

Query: 294 EKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTV 353
               KGSVANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQ+ACN+SPA+AE+A+TV
Sbjct: 269 TAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITV 328

Query: 354 GASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYY 413
           GAST+SD RAYFSNWG+CV IFAPGLNILSTYIG+  D TATLSGTSMASPH+AGL+AY+
Sbjct: 329 GASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGS-PDATATLSGTSMASPHIAGLVAYF 387

Query: 414 LSLQPEKSSEFSTR----AISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469
           LSLQP   S+F ++    AI+  QLKKK++ + TK+ L DLP  TPNV+ YNG G+ L D
Sbjct: 388 LSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLED 447

Query: 470 FWN 472
           FWN
Sbjct: 448 FWN 450

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/423 (62%), Positives = 326/423 (77%), Gaps = 9/423 (2%)

Query: 53  DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--FTEYLQTDINVPES 110
           D   ++ +RYII+FK GV+ ++I FH+ELI  +HLQ+ S    +  F E ++ D  V +S
Sbjct: 84  DTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLD-GVYDS 142

Query: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170
               LGGI   FDI+ +L GY  Y   ++L  IR++PLI  +E D++V+T   +T+N AP
Sbjct: 143 ---PLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAP 199

Query: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230
           WGLARISHRE LNL ++NKYLYD+  G  V +YVIDTGV+V+H +F  RA WGKTIP  D
Sbjct: 200 WGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGD 259

Query: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290
            D DGNGHGTH AGTIGS  YGVAK  +I+AVKVLRSNGSGSMSDV+KGVE+A   H   
Sbjct: 260 LDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNA 319

Query: 291 MKNEK-NLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349
           +K +K   KGS ANMSLGGGKSP+LD AVNAAV AG++FAVAAGNE+Q+ACN+SPASA  
Sbjct: 320 VKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASG 379

Query: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409
            +TVGAST+SD+RAYFSN+G+CVD+FAPGLNILSTYIG+ D  TATLSGTSMASPHVAGL
Sbjct: 380 PITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DSSTATLSGTSMASPHVAGL 438

Query: 410 LAYYLSLQPEKSSEF-STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLS 468
           LAY+LSLQP   SEF +  +IS  QLKKKL+ ++TKDVL D+P GTPN+LIYNGGG DLS
Sbjct: 439 LAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLS 498

Query: 469 DFW 471
            FW
Sbjct: 499 GFW 501

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/424 (59%), Positives = 319/424 (75%), Gaps = 5/424 (1%)

Query: 52  ADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE-- 109
           +D    IPHRYI++FKDGV+   +  H++L+TT H++  +      + +  T+    E  
Sbjct: 103 SDNSRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGI 162

Query: 110 SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169
           S R   GGI   F+I+  L GY  Y +D +L  IR + L+  IE D++VH +DF TQ  A
Sbjct: 163 SARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGA 222

Query: 170 PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229
           PWGLAR+SHRE LNL +FNKYLYDD+AGK V AYVIDTG++++HVEF  RA WGKTIP N
Sbjct: 223 PWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSN 282

Query: 230 DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289
           D D DGNGHGTH AGTI S+ YGVAK+  ++AVKVLR+NG+G+MSDV++GVE+ V+ H  
Sbjct: 283 DADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-R 341

Query: 290 RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349
           +   + N KGS ANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQ+ACN+SPAS+++
Sbjct: 342 KASGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKK 401

Query: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409
            +TV AST+SD+RAYFSNWG CVDIFAPGLNILSTYIG+ D   ATLSGTSMASPHVAGL
Sbjct: 402 CITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGL 460

Query: 410 LAYYLSLQPEKSSEFST-RAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLS 468
           LAY+LSLQP+  SE+ T  +IS   LKKK++ Y +K++L ++P  T N LI+NGGG  L 
Sbjct: 461 LAYFLSLQPDSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLD 520

Query: 469 DFWN 472
            FWN
Sbjct: 521 SFWN 524

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  519 bits (1337), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 275/465 (59%), Positives = 340/465 (73%), Gaps = 26/465 (5%)

Query: 46  LAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDI 105
           LA +H+         RYIIVFK GV KEQ+  H ++++ L  + S           Q   
Sbjct: 120 LAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEE---------QRPA 170

Query: 106 NVP--ESMRQSLGGIVSDFDISSLLSGYIAYL-SDELLHFIRLNPLIAFIEHDTMVHTTD 162
             P   ++R     ++  F+++   SGYIA + S +++ FIRLNPL+ ++E D++VH+ D
Sbjct: 171 AAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD 230

Query: 163 FNTQNNAPWGLARISHRESLNLANFNKYLY-DDDAGKNVDAYVIDTGVDVNHVEFHSRAH 221
             TQNNAPWGLARISHRE LNL NFNKYLY  + AGK V AYV+DTG+ V+H+EF  RA 
Sbjct: 231 -ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAK 289

Query: 222 WGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVE 281
           WGKTIP+ND DIDGNGHGTH AGTIGS+HYGVAK  N++AVKVLRS+GSG+MSDV+KGVE
Sbjct: 290 WGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVE 349

Query: 282 FAV---SSHLERMKNEKN--LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336
           +     + HLE  + +KN   KG+ ANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNEN
Sbjct: 350 WVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNEN 409

Query: 337 QNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATL 396
           Q+ACNSSPA+AE A+TVGAST+SD+RAYFSN+G+CVDIFAPGLNILSTYIG N D TATL
Sbjct: 410 QDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTN-DATATL 468

Query: 397 SGTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGT 454
           SGTSMASPHVAGLL Y LSLQP+K SEF      ++  Q+KKK+I+YATK+ L DLP  T
Sbjct: 469 SGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADT 528

Query: 455 PNVLIYNGGGQDLSDFWNLQNSKIPGSNYIGYNYFSKLKTLFDDL 499
           PN LIYNGG    +DFW   ++  P S+ +  N +S L +  D +
Sbjct: 529 PNKLIYNGGFNS-TDFW--ASAAAPQSHKVKTNRYS-LGSFLDSI 569

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  461 bits (1187), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 233/482 (48%), Positives = 326/482 (67%), Gaps = 17/482 (3%)

Query: 1   MQLLIHLLLVCSTLVNALVIPSL------KDSIDKFSD----DIHGLLDSAKFSSLAPVH 50
           M+LL  LL +C+     ++IP L       +SI+ F +    +  G  ++  F    P  
Sbjct: 1   MKLLTVLLALCAGCGVCMIIPGLDEIVYLTESIEDFRNAKGQEGLGQQETGNFHLQEPKV 60

Query: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110
              AE++ P+RYII F +  S   I+ HK +I  +  +  S  + D   ++ T  + P  
Sbjct: 61  VYKAESL-PYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSD 117

Query: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170
           ++   GGI S FDI+ L  GY  Y ++E++  +  +P+I FIE ++ V  T+   Q  AP
Sbjct: 118 LQ--FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAP 175

Query: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230
           WGL RISHRE        +YLY+D AG+ V +YV+DTG+D+NH +F  RA WG  IP ND
Sbjct: 176 WGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDND 235

Query: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE- 289
           +  D NGHGTH AG IGS+H+GV K+ N++AVKVLRSNG G++SDV+KG+E+ V  H++ 
Sbjct: 236 EASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDS 295

Query: 290 RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349
             K     KGS AN+SLG  KSPA+++AVNAAV++G+HFA+AAGNE+++AC SSPA AE+
Sbjct: 296 SKKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEK 355

Query: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409
           ++TVGAST SD+RA+FS+WG CVD+FAPG+NILSTYIG+  + + +LSGTSMA+PHVAG+
Sbjct: 356 SITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSR-NASLSLSGTSMAAPHVAGI 414

Query: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469
           L+Y+LSLQP   SEF    +S  QLK+K+I ++T+ VL D+ E TPN LIYNGGG+ L +
Sbjct: 415 LSYFLSLQPSSDSEFFDSTVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDN 474

Query: 470 FW 471
           FW
Sbjct: 475 FW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  458 bits (1179), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 228/487 (46%), Positives = 321/487 (65%), Gaps = 21/487 (4%)

Query: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENI--- 57
           M+L   LL++C+     ++IP L + I  +S+      ++     L      + EN+   
Sbjct: 3   MKLFNILLILCAGGTLCMIIPELNE-IAYYSETFENFRNAKAQDGLG---QQNIENLHLG 58

Query: 58  ----------IPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINV 107
                     +P+RYIIVF + ++   I+ H ++I        S  + D   +L+T ++ 
Sbjct: 59  RQKVLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITED-DSFLRT-VSA 116

Query: 108 PESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQN 167
             S     GGI   FDI+ L  GY  Y +DE++  +  +PL+ FIEH++ V  ++ + Q 
Sbjct: 117 SASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQE 176

Query: 168 NAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIP 227
           +APWGL RISHRE        +YLY+D AG  V +YV+DTG+D  H +F  RA WG  IP
Sbjct: 177 DAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIP 236

Query: 228 LNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSH 287
            ND+  D NGHGTH AG IGS+H+GVAK+ NI+AVKVLRSNG G++SDV+KG+E+   +H
Sbjct: 237 ENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNH 296

Query: 288 LERMKNE-KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPAS 346
           +   K      KGS AN+SLG  KSPA+++AVNAAV  G+HFA+AAGNE+++AC SSPA 
Sbjct: 297 IASSKKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAG 356

Query: 347 AEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHV 406
           AE+++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMA+PHV
Sbjct: 357 AEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHV 415

Query: 407 AGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQD 466
           AG+L+Y LSLQP + SEF    +S  QLK+K+++++T+ VL D+ E TPN L+YNGGG+ 
Sbjct: 416 AGILSYLLSLQPAQDSEFFYDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKK 475

Query: 467 LSDFWNL 473
           L +FW  
Sbjct: 476 LDEFWRF 482

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  455 bits (1171), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 304/429 (70%), Gaps = 8/429 (1%)

Query: 46  LAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--FTEYLQT 103
           +  + N     +IP+RYI+VF + +S + I+ H++++   H    S  + D  F E + +
Sbjct: 55  MGGLDNTHKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS 114

Query: 104 DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDF 163
            I  P+     LGGI S FDI+ L  GY  Y +DE+L+ +  +PLI FIE ++ V  ++ 
Sbjct: 115 SI-APD---LQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNT 170

Query: 164 NTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWG 223
           + Q +APWGL RISHRE        +YLY+D AG+ V +YV+DTG+D  H +F  RA WG
Sbjct: 171 SMQKDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWG 230

Query: 224 KTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFA 283
             IP ND+  D NGHGTH AG IGS+HYGVAK+  ++AVKVLRSNG G++SDV+KG+E+ 
Sbjct: 231 AVIPGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYV 290

Query: 284 VSSHLE-RMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNS 342
              H+E   K  K  KGS AN+SLG  KS A+++AV+AAV +G+HFA+AAGNEN++AC S
Sbjct: 291 AREHIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLS 350

Query: 343 SPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMA 402
           SPA A++++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMA
Sbjct: 351 SPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMA 409

Query: 403 SPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNG 462
           +PHVAG+L+Y+LSLQP   SE+   A+S  +LK+K+++++T  VL D+ + TPN LIYNG
Sbjct: 410 APHVAGMLSYFLSLQPAPDSEYFDNALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNG 469

Query: 463 GGQDLSDFW 471
           GG+ L D W
Sbjct: 470 GGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  450 bits (1158), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 316/482 (65%), Gaps = 15/482 (3%)

Query: 1   MQLLIHLLLVCSTLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAP----------VH 50
           M+    L ++ +     ++IP   D I +F ++I G         L             H
Sbjct: 1   MKFSTILPILWANCCLCMIIPDF-DGIVRFIENIDGTRSVRAGEGLGQHDPGNFHTEHQH 59

Query: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110
            A     +P+RY+IVF + +S +QIQ H +++   H       + +  +     I+   S
Sbjct: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTEN--DAFWRVISSSVS 117

Query: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170
            +   GGI + FDI+ L  GY  Y +DE++  I  +P+I F+E +T V  ++ + Q  AP
Sbjct: 118 SKSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAP 177

Query: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230
           WGL R+SHRE        +YLY+D AGK V +YV+DTG+D  H +F  RA WG  IP ND
Sbjct: 178 WGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND 237

Query: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290
           +  D NGHGTH AG IGS+H+GVAK+  I+AVKVLRSNG G++SDV+KG+E+    H+E 
Sbjct: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297

Query: 291 MKNE-KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQ 349
            K + K  KGS AN+SLG  KS A+++AVNAAV +G+HFA+AAGNE+++AC SSPA AE+
Sbjct: 298 SKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEK 357

Query: 350 AVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409
           ++TVGAST SD+RA+FSNWG CVD+FAPG+NI+STYIG+  + T +LSGTSMASPHVAG+
Sbjct: 358 SITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMASPHVAGI 416

Query: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469
           L+Y+LSLQP   SEF   A S  +LK+K+++++T+ VL D+ + TPN LIYNGGG+ L  
Sbjct: 417 LSYFLSLQPAPDSEFFNDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDG 476

Query: 470 FW 471
           FW
Sbjct: 477 FW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  419 bits (1077), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 227/436 (52%), Positives = 299/436 (68%), Gaps = 16/436 (3%)

Query: 43  FSSLAPVHNADAEN--IIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF--SNDFT 98
           F++ + ++   A+N  IIP+RYI++FKD V+ ++IQ H   I    +  SS F   +DF 
Sbjct: 57  FNTGSKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIE--EINSSSIFLQDSDFG 114

Query: 99  EYLQ-TDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTM 157
           +  Q  DI    S R    G+  +F I   ++GYI Y ++    FI  +PL+  +EHD++
Sbjct: 115 KATQYNDI----STRGI--GLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSI 168

Query: 158 VHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFH 217
           V   ++  Q + PWGL RIS RE L +     Y YDD  GK+   +VIDTG+ V+H +F 
Sbjct: 169 VRINNYKMQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFE 228

Query: 218 SRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVV 277
            RA WGKTI  ND D D NGHGTH AGTI S+HYG+AK   +IAVKVLRS+GSGSMSDV+
Sbjct: 229 GRASWGKTIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVI 288

Query: 278 KGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 337
           +GVE+ V ++ +  K + NLKG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ 
Sbjct: 289 RGVEYTVEAYNDLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESD 348

Query: 338 NACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLS 397
           +ACNSSPASA   +TVG ST+SD+ A+FSN+G CVDIFAPG+NI+STYIG+  + T +LS
Sbjct: 349 DACNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSK-NATESLS 407

Query: 398 GTSMASPHVAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGTP 455
           GTSM+SPHVAG+LAYYLSLQP+  S+F     AIS   LKKK++ YAT   L  LP  T 
Sbjct: 408 GTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETV 467

Query: 456 NVLIYNGGGQDLSDFW 471
           N+L+YNGGG++LS FW
Sbjct: 468 NLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/421 (48%), Positives = 285/421 (67%), Gaps = 20/421 (4%)

Query: 51  NADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPES 110
           +A   +II  +YI++FK+     + + H + +   +  ++ ++  D  +  ++++N+   
Sbjct: 53  SAKQNDIIKDQYIVIFKNSAMMAEKELHFKQLK--NFIKTYSYEWDEKDDHKSNLNI--- 107

Query: 111 MRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAP 170
                      F I + LSGYI     E L  +R +P++  IE D+ VH      Q + P
Sbjct: 108 -----------FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTP 156

Query: 171 WGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230
           WGL+RIS R  + +     Y YDD    NV AYV+DTG+ ++H +F+ RA WGKTI  ND
Sbjct: 157 WGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPND 216

Query: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290
            D D +GHGTHVAG I S  +GVAK+  ++AVKVLRSNG G MSDV+KG+EF V  H   
Sbjct: 217 VDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH--- 273

Query: 291 MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQA 350
            KN+   KGSV N+SLG  KSPAL LA++AA+   IHFAVAAGNEN +AC +SPA A +A
Sbjct: 274 SKNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRA 333

Query: 351 VTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLL 410
           +TVGAS  SDERA+FSNWGECVD+FAPG+N++STYIG+ D+ T +LSGTS A+P+ AGL+
Sbjct: 334 ITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGS-DNATLSLSGTSAAAPYTAGLI 392

Query: 411 AYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDF 470
           AYYLSLQP+K S + T  ++ S+LK+K++ + +KDVL +LPE TPN++IYNG G++LS F
Sbjct: 393 AYYLSLQPDKDSGYFTGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHF 452

Query: 471 W 471
           W
Sbjct: 453 W 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 209/477 (43%), Positives = 295/477 (61%), Gaps = 37/477 (7%)

Query: 4   LIHLLLVC--STLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENIIPHR 61
           L+ L+ +C  + +  +LVIPS+     K     +  +DS   S++  +H+A +   IP++
Sbjct: 3   LLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFN--IDSDSPSNI--IHHAASP--IPNQ 56

Query: 62  YIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVSD 121
           YI++FK   +  Q + H   + +  L     ++                       I+  
Sbjct: 57  YIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT-----------------------ILHS 93

Query: 122 FDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRES 181
           F ++  L GY + L ++L+  +  +P+I  IE D+ VH      Q ++PWGLARIS RE 
Sbjct: 94  FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRER 153

Query: 182 LNLANFNKYLYDDD-AGKNVDAYVIDTGVDVNHVEFHSRAHWGKTI-PLNDQDIDGNGHG 239
           L L     Y YDD  A  N   Y++DTG++ NH EF  RA WG    P+     D NGHG
Sbjct: 154 LKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHG 213

Query: 240 THVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMK--NEKNL 297
           TH AG IGS  YGVAK+  +IAVKVL + G G MS V++G+E+    H + MK  ++   
Sbjct: 214 THCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGF 273

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGAST 357
           KGSV N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ +AC++SPA +  A+TVGAS+
Sbjct: 274 KGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS 333

Query: 358 ISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQ 417
            SD+R +FSNWG CVD+FAPG+NI+STYIG +++ T +LSGTSM++P V GL+AY+LSLQ
Sbjct: 334 FSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQ 393

Query: 418 PEKSSEFSTRAISTS--QLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472
           P+  S+F T   S +  QLK K+I ++T+ VL ++PEGTPN ++YNGGG  L DFWN
Sbjct: 394 PDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  375 bits (962), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 201/450 (44%), Positives = 285/450 (63%), Gaps = 32/450 (7%)

Query: 38  LDSAKFSSLAPVHNADAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDF 97
           LD  +   + P H    +N IP +YI++F++  +  QI   ++ +++L  + +  ++   
Sbjct: 44  LDKNQIPFIIPTH-GPQKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYN--- 99

Query: 98  TEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIA------YLSDELLHFIRLNPLIAF 151
                        +  +   ++S F IS+   G I       +L D   +      +I  
Sbjct: 100 -------------VNDNYSKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKI 146

Query: 152 IEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDD-AGKNVDAYVIDTGVD 210
           IE D+ VH   F TQ ++ WGL+RIS R  L L     Y YDD+ +GK VD Y++DTG++
Sbjct: 147 IERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGIN 206

Query: 211 VNHVEFHSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNG 269
            NH+EF  RA WG ++P+ +  + D NGHGTH AG IGS+ YGVAK  N+IAVKVL   G
Sbjct: 207 SNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKG 266

Query: 270 SGSMSDVVKGVEFAVSSHLERMKN-------EKNLKGSVANMSLGGGKSPALDLAVNAAV 322
            GSMSDV+ G+EF  +SH  +  N           KGSV N+SLG  KSP+LD+A+ +A 
Sbjct: 267 DGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAK 326

Query: 323 KAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNIL 382
           K GIH  VAAGNE+++AC +SPA +   +TVGAS+ SD+RA+FSNWG CVD+FAPG+NI 
Sbjct: 327 KIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIK 386

Query: 383 STYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYA 442
           STYIG N++ T +LSG+SM+SP V+GL AYYLSLQP+ SS+F    ++  QLK+K+I+++
Sbjct: 387 STYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSLMTPDQLKRKIIDFS 446

Query: 443 TKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472
           T  +L++LP  T N L+YNGGG+DLS FWN
Sbjct: 447 TNGMLKELPLDTANKLVYNGGGKDLSGFWN 476

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  352 bits (904), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 232/327 (70%), Gaps = 3/327 (0%)

Query: 140 LHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDD-AGK 198
           ++F+   P +  +E ++ V+  +   Q + PWGL R+S R+ + + +   Y YD   + K
Sbjct: 96  VYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGSAK 155

Query: 199 NVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVN 258
           +V+ Y++DTG+ V+H EF  RA WGKTI  ND D D NGHGTH AG +G   YGVAK  N
Sbjct: 156 DVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIVGGATYGVAKEAN 215

Query: 259 IIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAV 318
           +IAVKVL + G G MSDV++G+EFAV+ HL R  N+  ++GS+ N+SLG G+SPAL   V
Sbjct: 216 LIAVKVLHATGDGEMSDVIRGIEFAVNEHLTR--NQDEVRGSIINLSLGAGESPALQRVV 273

Query: 319 NAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPG 378
            AA+  G+HFAVAAGNE+ NAC SSPA+ +  VTVG ST SD+RA+FSNWG C+D+FAPG
Sbjct: 274 TAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCIDVFAPG 333

Query: 379 LNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKL 438
           +N+ S+Y+GA  + T +LSGTS ++PHVAGL+AY LSL+P+  S+F T   + +QLK+KL
Sbjct: 334 VNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPAQLKQKL 393

Query: 439 IEYATKDVLEDLPEGTPNVLIYNGGGQ 465
           +  AT+  L ++P+ T N++I+NG  Q
Sbjct: 394 VSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  311 bits (796), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 175/490 (35%), Positives = 287/490 (58%), Gaps = 20/490 (4%)

Query: 4   LIHLLLVCSTLVNALVIPSLKDSIDKFSD--DIHGLLDSAKFSS------LAPVHNADA- 54
           +I L++   +L NA+V+P + +++++ S+  +       +K         +AP+   D  
Sbjct: 6   IITLVIGIISLSNAIVLPDI-NTLEQTSESQEYDNFFKQSKRPGNVKAPLVAPLGENDEI 64

Query: 55  -ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQ 113
             NI+P+RYI++FK+     +I+ H + +  L L+ S + + +   +  T     E   +
Sbjct: 65  QNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDK--EFSTE 122

Query: 114 SLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGL 173
            LGG++  FDI S  +GY+ Y +DE++ FIR   ++ ++E D+++   D  T +N+ W L
Sbjct: 123 ELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHWHL 182

Query: 174 ARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI 233
           ARISHR  L L+NFN+Y +D + G+N+DAY++DTGV   H  +  R   G  I  N+ + 
Sbjct: 183 ARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVITPNEDER 242

Query: 234 DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKN 293
           D NGHGT +AG +G +  GVA+   +I VKVL   G G++S+++KG+ F    H +R+  
Sbjct: 243 DMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQRI-- 300

Query: 294 EKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVT 352
           EKN + G+V   S+ G KS +L+ A +  V +GIH  V AG +  NACNSSPAS+ + +T
Sbjct: 301 EKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASSSKPIT 360

Query: 353 VGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDV---TATLSGTSMASPHVAGL 409
           V   +I+DE     NWG CVDI+ PG  + +TY     +      +++G+S A+  VAGL
Sbjct: 361 VAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAAQVAGL 420

Query: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSD 469
           LAY+ SLQP   +      ++  +LK++LI++ TK  L +L   +PN++ +NG G +L  
Sbjct: 421 LAYFASLQPGLGTP-DVIPLTPEELKERLIDFGTKGKLTNLERMSPNIIAFNGAGGNLDS 479

Query: 470 FWNLQNSKIP 479
           F+N  +  +P
Sbjct: 480 FFNDGSEIVP 489

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  218 bits (555), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 155/417 (37%), Positives = 215/417 (51%), Gaps = 61/417 (14%)

Query: 85  LHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIR 144
           + L+Q+ +  +     +    +V E +R  +G     F I S   G+   L+D+LL  I+
Sbjct: 28  VSLKQNDSIQSFMDSTITRGRSVKEYLRDKIG---KTFSIGSF-KGFTVDLTDDLLEAIK 83

Query: 145 LNPLIAFIEHDTMVHT------------------------TDFNTQNNAPWGLARISHRE 180
            NPL++ +  +  VH                              Q  AP  LAR+S R+
Sbjct: 84  KNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGAPRHLARLSRRK 143

Query: 181 SLNLANFN---------KYLYDDDA-GKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLND 230
            L   +F          KY YD  + G +V+AY+ID+G+ + H EF+ RA  G  +   +
Sbjct: 144 QLPY-DFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHEEFNGRAIPGIDL-TGE 201

Query: 231 QDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLER 290
              D NGHGTHVAG +GS+ YGVAK V +I +KVL   G GS++ V+ G+EFAV    E 
Sbjct: 202 GSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLGGIEFAVKHCQET 261

Query: 291 MKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQA 350
            K  +     VAN+SLG  ++  L+ A+ AA+ AG+   VAAGN N NAC  SPASA +A
Sbjct: 262 SKKGR----CVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNNLNACWYSPASAPEA 317

Query: 351 VTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGL 409
           +TVGA     D  A FSNWG+C+DIFAPG+ I S  I   D    T SGTSMASP VAGL
Sbjct: 318 ITVGAFDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSI-FKDKEDVTYSGTSMASPTVAGL 376

Query: 410 LAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED----LPEGTPNVLIYNG 462
            A  L            + +S  ++K  ++E  T +V          GTPN + +NG
Sbjct: 377 AALTLD-----------QGVSAEEVKDYILEMGTDNVFHRRSLLFKPGTPNKICFNG 422

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  211 bits (536), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 176/312 (56%), Gaps = 32/312 (10%)

Query: 165 TQNNAPWGLARISHRESLNLA---------NFNKYLYDDDAGKNVDAYVIDTGVDVNHVE 215
            Q  AP  LAR+S R  L            +FN Y Y    G+N++AY+IDTG+   H +
Sbjct: 125 VQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKD 184

Query: 216 FHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
           F  RA +G+     +   D NGHGTHVAG +GS ++GVAK VN+I VK L + G G+++ 
Sbjct: 185 FCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTT 243

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           V+  VEFAV+      K     KG VAN+SLG  ++  ++ A+ AA +AG+   VAAGN 
Sbjct: 244 VISAVEFAVNHCKSSGK-----KGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNS 298

Query: 336 NQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTA 394
           N NAC +SPASA +A+TVGA    +D  A FSNWG CVDIFA G+ + S          A
Sbjct: 299 NINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA 358

Query: 395 TLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED----L 450
             SGTSMASP V GL+A  L            + +    +K KL+E AT D+L+      
Sbjct: 359 -FSGTSMASPSVTGLVAILLD-----------KGVEPENIKAKLVELATHDLLQRRTLFF 406

Query: 451 PEGTPNVLIYNG 462
             GTPN + +NG
Sbjct: 407 KPGTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  208 bits (529), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/323 (42%), Positives = 182/323 (56%), Gaps = 33/323 (10%)

Query: 164 NTQNNAPWGLARISHRESL--------NLANFNKYLYDDD-AGKNVDAYVIDTGVDVNHV 214
           N Q  AP  L RIS R  L            F  Y Y+D   G N+ AY++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 215 EFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMS 274
           +F +R   G  +   +   D NGHGTHVAG +GS+ +GVAK+V ++ VKVL   GSG+++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 275 DVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 334
            V+ G++FAV  H  R+  E   K  VANMSLG  ++  ++ A++ A KAG+   VAAGN
Sbjct: 271 TVLSGIQFAV-DHC-RLMRETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGN 328

Query: 335 ENQNACNSSPASAEQAVTVGASTISDER-AYFSNWGECVDIFAPGLNILS-TYIGANDDV 392
            N +AC +SPASA+ A+TVGA     E  AYFSNWG CVDIFAPG+ I S +    +   
Sbjct: 329 SNVSACWTSPASAKNAITVGAFDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPESHHK 388

Query: 393 TATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDL-- 450
             T SGTSMASP VAGL A  L            + +    +K KL+  +TKDV   L  
Sbjct: 389 HVTHSGTSMASPVVAGLAAILLD-----------KGVEPFDVKDKLLHLSTKDVFNKLTL 437

Query: 451 --PEGTPNVLIYNGGGQDLSDFW 471
               GTPN + YNG    + DF+
Sbjct: 438 FFKYGTPNKIAYNG----IEDFF 456

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  205 bits (522), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/401 (35%), Positives = 213/401 (53%), Gaps = 57/401 (14%)

Query: 99  EYLQTDINVPESMRQSLGGIVSDFDISSLLS-------------GYIAYLSDELLHFIRL 145
           EYL   +  P+S+ + +   + D  + S +S             G+ A    + +  ++ 
Sbjct: 20  EYL-VRLKSPKSLTKFMESKIGDMSLKSFVSTRISKTFSFGKFEGFTADFPKDFVEKLKK 78

Query: 146 NPLIAFIEHDTMVHTTD------------FNTQNNAPWGLARISHRESLNLAN------- 186
           NPL+A +  +++ +  D            +  Q +AP  LAR+S R  L  +        
Sbjct: 79  NPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQE 138

Query: 187 FNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTI 246
           FN Y      G +V+AY+IDTG+   H +   RA++G  + + +   D NGHGTHVAG +
Sbjct: 139 FNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-VGEGPGDYNGHGTHVAGIV 197

Query: 247 GSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSL 306
           GS+ +GVAK VN++ VK L + G G+++ V+  +EF+V +H      +K+    VAN+SL
Sbjct: 198 GSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSV-NHC-----KKSGMLCVANLSL 251

Query: 307 GGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA-STISDERAYF 365
           G  ++  L+ AV AAV++G+   VAAGN N NAC +SPASA  A+TVGA    +D  A F
Sbjct: 252 GSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISAITVGAFDDRTDTIAKF 311

Query: 366 SNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFS 425
           SNWG CVD+FA G+ ++S          A  SGTSMASP VAGL A  L           
Sbjct: 312 SNWGMCVDVFASGVKVMSLSNMPPFKPVA-YSGTSMASPSVAGLAAVLLD---------- 360

Query: 426 TRAISTSQLKKKLIEYATKDVLED----LPEGTPNVLIYNG 462
              I    +K+K+I+ AT++V +        GTPN + +NG
Sbjct: 361 -SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  203 bits (517), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 194/365 (53%), Gaps = 50/365 (13%)

Query: 138 ELLHFIRLNPLIAFI----------EHDTMVHTTDFNT-----QNNAPWGLARISHRESL 182
           +L+  IR +PL+A +          EHD      +FN+     Q  AP  L+R+S R  L
Sbjct: 73  DLVDRIRRSPLVAEVVPNIQFVAYDEHD--FEGWNFNSRFIRRQRGAPRHLSRLSRRSQL 130

Query: 183 NL----------ANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQD 232
                        +FN Y  +   G  ++AY+IDTG+   H EF  RA +G+ +   +  
Sbjct: 131 PYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGP 189

Query: 233 IDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMK 292
            DGNGHGTHVAG +GS  YGVAK + ++ VK L + G G+++ V+  +EFAV +H    +
Sbjct: 190 GDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHCRSSE 248

Query: 293 NEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVT 352
                KG V N+SLG  ++  ++ AV AA +AGI   VAAGN N NAC +SPASA +A+T
Sbjct: 249 G----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAIT 304

Query: 353 VGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLA 411
           VGA    +D  A FSNWG CVDIFAPG+ + S    A        SGTSMASP + GL A
Sbjct: 305 VGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKS-LASAPHLKPILFSGTSMASPSITGLAA 363

Query: 412 YYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED----LPEGTPNVLIYNGGGQDL 467
             L              +   ++K  +++ AT DV +        GTPN + +NG  ++ 
Sbjct: 364 ILLD-----------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKKND 412

Query: 468 SDFWN 472
             F N
Sbjct: 413 DKFSN 417

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  204 bits (520), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 181/313 (57%), Gaps = 33/313 (10%)

Query: 166 QNNAPWGLARISHRESLNL---------ANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216
           Q++AP  LARIS    L           + FN Y  DD  G++V+AY++DTG+  +H EF
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 217 HSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
             R   G  I L  +   D NGHGTHVAG +GS+ YG AK VN++ VKVL  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           V+ G+EF V  H  R+   +  K  VAN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 243 VLSGLEFIV-EHCTRVSRPQG-KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 336 NQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILS-TYIGANDDVT 393
           N +A  +SPASAE  +TVGA     D  A FSNWG CV+IFAPG+ I S +++  ND  T
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFND--T 358

Query: 394 ATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED---- 449
             LSGTSM++P V G+ A  LS           + I    + ++L   +T++V       
Sbjct: 359 LVLSGTSMSTPIVTGVAAVLLS-----------KGIEPEMIAQELEYLSTRNVFHRRTLF 407

Query: 450 LPEGTPNVLIYNG 462
               TPN ++YNG
Sbjct: 408 FKPSTPNQILYNG 420

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  203 bits (516), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 182/341 (53%), Gaps = 47/341 (13%)

Query: 164 NTQNNAPWGLARISHRESLNL---------ANFNKYLYDDDAGKNVDAYVIDTGVDVNHV 214
            TQ+ AP  LAR+S R  L           ++FN Y Y    G++V+AYV+D+GV ++H 
Sbjct: 158 KTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHC 217

Query: 215 EFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMS 274
           +F  RA++G     +    D NGHGTHVAG IGS+ YGV+K VNII VKVL S GSG++ 
Sbjct: 218 DFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLD 277

Query: 275 DVVKGVEFAVSSHL--------------------ERMKNEKNLKGSVANMSLGGGKSPAL 314
            V+ G+EF VS+H                     +   ++   K  V N+SLG  +S  +
Sbjct: 278 TVMSGLEF-VSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTII 336

Query: 315 DLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVD 373
           + A+   +K GI   VAAGN N NAC +SPAS    +TVGA     D  A FSNWG CVD
Sbjct: 337 NEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIAKFSNWGNCVD 396

Query: 374 IFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQ 433
           IFAPG+ ++ +            +GTSMA+P V GL+A  L              I  +Q
Sbjct: 397 IFAPGV-LVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD-----------SGIKPTQ 444

Query: 434 LKKKLIEYATKDVLED----LPEGTPNVLIYNGGGQDLSDF 470
           +KK+L E AT ++          GTPN + +NG  +D  D+
Sbjct: 445 IKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  201 bits (512), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 176/311 (56%), Gaps = 33/311 (10%)

Query: 166 QNNAPWGLARISHRESL-----NLA----NFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216
           Q  AP  LARIS R +L     N++    NF+ Y  D+ +G  V+AYVIDTG+   H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 217 HSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDV 276
             RA +G  + + +   D NGHGTHVAG IGS+ +GVAK V++I VK L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 277 VKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336
           +  +EF V+         K+ +G VAN+SLG  ++  L+ AV AA++AG+   VAAGN N
Sbjct: 254 ISAIEFTVN------HCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNSN 307

Query: 337 QNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTAT 395
            NAC SSPAS+  A+TVGA    +D  A FSNWG CVDIFAPG+ I S            
Sbjct: 308 ANACWSSPASSLSAITVGAFDDRTDTIARFSNWGNCVDIFAPGVKIESLS-NVPPFKPVA 366

Query: 396 LSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED----LP 451
            SGTSMASP V+G++A  L              I    +K +LI+ AT  V         
Sbjct: 367 FSGTSMASPIVSGMVANLLD-----------SGIHPFDIKTELIDLATDSVFHKRTLLFK 415

Query: 452 EGTPNVLIYNG 462
            GTPN + + G
Sbjct: 416 PGTPNRVAFTG 426

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  197 bits (501), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 141/373 (37%), Positives = 189/373 (50%), Gaps = 45/373 (12%)

Query: 116 GGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTD------------F 163
           G I   F I  L  G    LS ++L  I+ +P +  +  + MV   +             
Sbjct: 50  GKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 164 NTQNNAPWGLARISHRESLNLANFNKYLYDDD---------AGKNVDAYVIDTGVDVNHV 214
             Q  AP  LARIS R  L     NK  Y D           G    AY++DTGV  +H 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 215 EFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMS 274
           EF  R  +G T    + + D NGHGTHVAG +GS+ +GVAK V ++ VK L + G+G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 275 DVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 334
            ++  +EFAV    E   ++      V NMSLG  KS  L+ A+N   K GI   VAAGN
Sbjct: 228 SILSALEFAVQDCQEHEDSQ-----CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGN 282

Query: 335 ENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVT 393
            N NAC +SP+SA  A+TVGA     D  A FSNWG CVDIFAPG+N+ S     N D  
Sbjct: 283 FNMNACWTSPSSATGAITVGAFDDRFDTIAKFSNWGPCVDIFAPGVNVASL---VNRDWP 339

Query: 394 ATL--SGTSMASPHVAGLLAYYL--SLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED 449
           + +  SGTSMASP V G++A  L   + PE   ++     +    KK+ + +        
Sbjct: 340 SFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELATDGVFKKRTLVFKP------ 393

Query: 450 LPEGTPNVLIYNG 462
              GTPN ++YNG
Sbjct: 394 ---GTPNSVLYNG 403

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  197 bits (502), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 179/313 (57%), Gaps = 33/313 (10%)

Query: 166 QNNAPWGLARISHRESLNL---------ANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216
           Q +AP  LARIS    L           + FN Y   D  G++V+AY++DTG+  +H EF
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 217 HSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
             R   G  I L  +   D NGHGTHVAG +GS+ YG AK VN++ VKVL  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASN 242

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           V+ G+EF V  H  ++   +  K  VAN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 243 VLSGLEFIV-EHCTKVSRPQG-KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 300

Query: 336 NQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILS-TYIGANDDVT 393
           N +A  +SPASAE  +TVGA     D  A FSNWG CV+IFAPG+ I S +++  ND  T
Sbjct: 301 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYND--T 358

Query: 394 ATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED---- 449
             LSGTSM++P V G+ A  LS           + I    + +++   +T++V       
Sbjct: 359 LILSGTSMSTPIVTGVAAILLS-----------KGIEPEMIAQEIEYLSTRNVFHRRTLF 407

Query: 450 LPEGTPNVLIYNG 462
               TPN ++YNG
Sbjct: 408 FKPSTPNQILYNG 420

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  195 bits (495), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 178/313 (56%), Gaps = 36/313 (11%)

Query: 166 QNNAPWGLARISHRESL--NLANFNKYL----YDDDA---GKNVDAYVIDTGVDVNHVEF 216
           Q  AP  L+R+S R  L  ++ N ++Y     Y  DA   G +V+AY+IDTG+   H EF
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 217 HSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
             R  +   I L  +   D NGHGTH+AG +GS+ +GVAK VNII VK L   G G +S 
Sbjct: 175 EGRVKFA--IDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           ++K +EF +     R   E   K  VAN+S G  ++  +D A+  A  AGI   VAAGN 
Sbjct: 233 ILKALEFTI-----RHCKESVDKKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNS 287

Query: 336 NQNACNSSPASAEQAVTVGASTISDER-AYFSNWGECVDIFAPGLNILS-TYIGANDDVT 393
           N +AC +SPAS++  +TVGA     E  A FSNWG CVD+FAPG+ + S ++I  +D   
Sbjct: 288 NIDACWNSPASSKDVITVGAFDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD--V 345

Query: 394 ATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED---- 449
             LSGTSMASP V+G+ A  L            + ++   +K K+IE +TK++       
Sbjct: 346 LLLSGTSMASPSVSGIAAILLD-----------KGLNPKFVKSKIIESSTKNIFHQGTIM 394

Query: 450 LPEGTPNVLIYNG 462
           +   TPN++++NG
Sbjct: 395 IKPNTPNLIVFNG 407

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  196 bits (499), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 153/398 (38%), Positives = 211/398 (53%), Gaps = 64/398 (16%)

Query: 109 ESMRQSLG-GIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIA-------FIEHDT---- 156
            S RQ +   I   F I S   G    LS  L++ ++ +PLIA       F   DT    
Sbjct: 79  RSWRQFIDHRIEKKFSIGSF-RGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAEL 137

Query: 157 --MVHTT------------DFNTQNNAPWGLARIS--HRESLNLAN-------FNKYLYD 193
             M +TT            +   Q +AP  LARIS  H+   +L +       FN Y  D
Sbjct: 138 SYMFNTTAKYAYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYED 197

Query: 194 DDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYG 252
           +  G+ V+AY++DTG+   H EF  R   G  + L  +   D NGHGTHVAG +GS+ +G
Sbjct: 198 EYQGQGVNAYIMDTGIHAEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFG 255

Query: 253 VAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSP 312
            AK V+++ VKVL  +GSG  S+V+ G+EF V  H  ++   +  K  VAN+SLG  +SP
Sbjct: 256 AAKKVSLVEVKVLGKDGSGEASNVLSGLEFIV-EHCTKVSRPQG-KKCVANLSLGSFRSP 313

Query: 313 ALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGEC 371
            +++AV  A++ GI F  AAGN N +A  +SPASAE  +TVGA     D  A FSNWG C
Sbjct: 314 IINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPC 373

Query: 372 VDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLS--LQPEKSSEFSTRAI 429
           V+IFAPG+ I S     ND+ +  LSGTSM++P V G+ A  LS  ++PE          
Sbjct: 374 VNIFAPGVEIESLS-HLNDNESLVLSGTSMSTPIVTGVAAVLLSKGIEPE---------- 422

Query: 430 STSQLKKKLIEY-ATKDVLED----LPEGTPNVLIYNG 462
               L  + IEY +T++V           TPN ++YNG
Sbjct: 423 ----LIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNG 456

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  196 bits (498), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/313 (41%), Positives = 180/313 (57%), Gaps = 33/313 (10%)

Query: 166 QNNAPWGLARISHRESLNL---------ANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216
           Q++AP  LARIS    L           + FN Y  DD  G++V+AY++DTG+  +H EF
Sbjct: 174 QSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEF 233

Query: 217 HSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
             R   G  I L  +   D NGHGTHVAG +GS+ YG AK VN++ VKVL  +GSG  S+
Sbjct: 234 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 291

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335
           V+ G+EF V  H  R+   +  K  VAN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 292 VLSGLEFIV-EHCTRVSRPQG-KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 349

Query: 336 NQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILS-TYIGANDDVT 393
           N +A  +SPASAE  +TVGA     D  A FSNWG CV+IFAPG+ I S +++   D  T
Sbjct: 350 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYED--T 407

Query: 394 ATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED---- 449
             LSGTSM++P V G+ A  LS           + I  + + +++   +T++V       
Sbjct: 408 LILSGTSMSTPIVTGVAAVLLS-----------KGIEPALIAQEIEYLSTRNVFHRRTLF 456

Query: 450 LPEGTPNVLIYNG 462
               T N ++YNG
Sbjct: 457 FKPSTANQILYNG 469

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  194 bits (494), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 181/316 (57%), Gaps = 35/316 (11%)

Query: 162 DFNTQNNAPWGLARISHRESL-----NLA----NFNKYLYDDDAGKNVDAYVIDTGVDVN 212
           DF  Q NAP  LARIS R +L     N+A    NF+ Y  D   G  V+AYVIDTG+   
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 213 HVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGS 272
           H +F  RA +G  + + +   D NGHGTHVAG IGSQ YGVAK V++I VK L + G G+
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 273 MSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAA 332
           ++ V+  +EF V +H  + K     +G VAN+SLG  ++  L+ AV AA++AG+   VAA
Sbjct: 248 LTSVISAIEFTV-NHCRKSK-----RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVAA 301

Query: 333 GNENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILS-TYIGAND 390
           GN N NAC SSPAS+  A++VGA    +D  A FSNWG CVD+FAPG+ I S + I    
Sbjct: 302 GNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPFK 361

Query: 391 DVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED- 449
            V    SGTSMASP V G++A  L              I    +K++LI  AT  V    
Sbjct: 362 SV--AYSGTSMASPLVTGMVAVLLD-----------SGIHPFDIKEELINTATDSVFHKR 408

Query: 450 ---LPEGTPNVLIYNG 462
                 GTPN + + G
Sbjct: 409 ALLFKPGTPNRVAFTG 424

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  197 bits (500), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 178/313 (56%), Gaps = 33/313 (10%)

Query: 166 QNNAPWGLARISHRESL--------NLANFNKYLYDDD-AGKNVDAYVIDTGVDVNHVEF 216
           Q  AP  L ++S R  L            F  Y YD    G N   Y+IDTGV   H EF
Sbjct: 150 QFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEF 209

Query: 217 HSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDV 276
            +R H+G    + +   D NGHGTHVAG IGS+ +GVAK+V +  VKVL   G G+++ V
Sbjct: 210 GNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSV 268

Query: 277 VKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336
           ++G+EFAV++   ++K +   K  V NMSLG  ++P ++ A+  A  +GI   VAAGN N
Sbjct: 269 LEGIEFAVNNC--KLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNNN 326

Query: 337 QNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNI--LSTYIGANDDVT 393
            +AC +SPAS+  A+TVGA    +D  A FSNWG+CVDIFAPG+ I  LS  +  N    
Sbjct: 327 FSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLEN---G 383

Query: 394 ATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDL--- 450
              SGTSMASP VAGL+A  +            +     ++K+KLI+ ++K +   L   
Sbjct: 384 VIHSGTSMASPIVAGLVAILME-----------KGYKCDEIKQKLIDDSSKSIFSKLTLF 432

Query: 451 -PEGTPNVLIYNG 462
              GTPN +IYNG
Sbjct: 433 FKYGTPNRVIYNG 445

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  194 bits (493), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 194/355 (54%), Gaps = 50/355 (14%)

Query: 138 ELLHFIRLNPLIAFI---------EHDTM--VHTTDFNT---QNNAPWGLARISHRESL- 182
           +++  ++ NPL+A I         E+D +    T ++ +   Q+ AP  LARIS R+ L 
Sbjct: 77  KIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKLP 136

Query: 183 ----NLAN----FNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDID 234
               N+++    FN Y   +  G +V AY++D+GV  N  +F  R  +G      D + D
Sbjct: 137 YDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEGD 195

Query: 235 GNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNE 294
            NGHGTHVAG +GS+ YGVAK V ++ VK L   G G++  V+  +EFAV+   E  +  
Sbjct: 196 SNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE-- 253

Query: 295 KNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVG 354
              K  VAN+SLG  K+  ++ A+ AA + G+   VAAGN N NAC +SPASAE+A+TVG
Sbjct: 254 ---KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVG 310

Query: 355 A-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATL--SGTSMASPHVAGLLA 411
           A     D  A FSNWG CVDI+APG+ + S    AN  +   +  SGTSMASP V G +A
Sbjct: 311 AFDDRIDTIAKFSNWGPCVDIYAPGVAVESL---ANFPMVKNISYSGTSMASPIVCGQVA 367

Query: 412 YYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED----LPEGTPNVLIYNG 462
             L            + I    +K  LI+ AT DV +         TPN +++NG
Sbjct: 368 ILLD-----------KGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  190 bits (483), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 144/395 (36%), Positives = 199/395 (50%), Gaps = 59/395 (14%)

Query: 116 GGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFN----------- 164
           G I   F   S   G    L+ +++  I+ NPL+  +  +  +H  D++           
Sbjct: 54  GKISKTFSFGSF-RGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 165 ---------------TQNNAPWGLARISHRESLNLANFNKYLYDDD---------AGKNV 200
                           QN AP  LAR+S R  L     +K  Y+D           G +V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 201 DAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNII 260
           +AY+ID+G+D+N  EF  RA  G  +   +   D NGHGTHVAG +GS+ YGVAK+V ++
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 261 AVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNA 320
            VK L   GSGS+  V+  +EF V +H  + K++K     VAN+SLG    P L+ A+ A
Sbjct: 232 EVKALDRQGSGSLITVISALEFVV-NHCGKSKSKK----CVANLSLGAFMMPLLNEAIKA 286

Query: 321 AVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGL 379
            V +G+   VAAGN N +AC  SPAS + A+TVGA     D  A FSNWG CVDIFAPG+
Sbjct: 287 TVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAFDDRIDTIAKFSNWGSCVDIFAPGV 346

Query: 380 NILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLI 439
            I S  I  N   +   SGTSMASP VAG+++  L            + +    ++  L 
Sbjct: 347 AISSLSIKDNQK-SVEFSGTSMASPQVAGIVSILLD-----------QGVENEDIRDYLF 394

Query: 440 EYATKDVLED----LPEGTPNVLIYNGGGQDLSDF 470
           E AT DV +         TPN + +NG  +   DF
Sbjct: 395 ELATDDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  184 bits (468), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 124/298 (41%), Positives = 174/298 (58%), Gaps = 25/298 (8%)

Query: 163 FNTQNNAPWGLARISHRESLNLA-------NFNKYLYDDDAGKNVDAYVIDTGVDVNHVE 215
           +  Q +AP  LAR   R  L           FN Y  ++  G+ V+ YV+D+G+  +H E
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 216 FHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSD 275
           F  RAH+G      +   D NGHGTHVAG +GS+ +G+AK  NI  +KV+  +G GS S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 276 VVKGVEFAVSSHLERMKNEKNLKGSVANMSLGG---GKSPALDLAVNAAVKAGIHFAVAA 332
           ++ GVEFAV  H      +++ K  VANMSLGG   G S ALD AV AA++ G+ F VAA
Sbjct: 544 IIAGVEFAV-KHC-----QQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAA 596

Query: 333 GNENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDD 391
           GN  + AC  SPA  + A+TVGA    SD  A FSN+G+CVDIFAPG+ + S    +  +
Sbjct: 597 GNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVAS-LSNSPSN 655

Query: 392 VTATLSGTSMASPHVAGLLAYYL--SLQPEKSSEFSTRAISTSQL--KKKLIEYATKD 445
               L+GTSM++P  AG++A  L   ++P +  +    +IST  L  K++L+   T D
Sbjct: 656 TMRVLNGTSMSAPITAGVVAVLLDQGIEPHEVKDH-LLSISTKGLFHKRRLVSSRTPD 712

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  182 bits (462), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 177/315 (56%), Gaps = 34/315 (10%)

Query: 166 QNNAPWGLARISHRESLNLA-------NFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHS 218
           Q+ AP  LAR   R  L           FN Y   +  G+ V+ Y++D+G+  +H EF  
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 219 RAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVK 278
           RA +G     N+   D NGHGTHVAG +GS+ YG AK   I  VKV+  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 279 GVEFAVSSHLERMKNEKNLKGSVANMSLGG---GKSPALDLAVNAAVKAGIHFAVAAGNE 335
           GVEFAV  H      +++ K  VANMSLGG   G S ALD AV AA++ G+ F VAAGN 
Sbjct: 389 GVEFAV-KHC-----QQSGKKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGNS 441

Query: 336 NQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTA 394
            + AC  SPA  + A+TVGA    SD  A FSN+G+CVDIFAPG+ + S+   +  +   
Sbjct: 442 KERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAV-SSLSNSPYNTVR 500

Query: 395 TLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED---LP 451
            L+GTSM++P  AG++A  L            + +    +K++LI+ +TK V      + 
Sbjct: 501 VLNGTSMSAPITAGVVAVLLD-----------QGVKHEDVKERLIDLSTKGVFHRRRLVS 549

Query: 452 EGTPNVLIYNGGGQD 466
             TP+  ++NG  Q+
Sbjct: 550 SRTPDRTLFNGVPQE 564

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  183 bits (465), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 155/270 (57%), Gaps = 26/270 (9%)

Query: 161 TDFNTQNNAPWGLARISHRESL--NLANFNK------YLYDD-DAGKNVDAYVIDTGVDV 211
           + F  Q  AP  LARIS R+ L  N  N N+      Y YDD D G+ V AYVIDTG+  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 212 NHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSG 271
            H +F  R  +G  +   +   D NGHGTHVAG IGS+ YGV K V II VK +   GS 
Sbjct: 342 EHKDFEDRVEFGTDL-TGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 272 SMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVA 331
            +S +++ +E+ V+    R+    + K  V NMSLG      ++ AV +A+  G+ F VA
Sbjct: 401 QLSHIIEAIEYTVNDCNSRV----DKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 332 AGNENQNACNSSPASAEQAVTVGASTISDER----AYFSNWGECVDIFAPGLNI--LSTY 385
           AGN N +AC SSP S++ A+TVGA    D+R    A FSNWGECVDIFA G+ +  LS+ 
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 386 IGANDDVTATLSGTSMASPHVAGLLAYYLS 415
           +          SGTSMASP V G ++  LS
Sbjct: 514 VPYK---YIKYSGTSMASPIVCGFVSILLS 540

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  175 bits (443), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 126/320 (39%), Positives = 177/320 (55%), Gaps = 29/320 (9%)

Query: 162 DFNTQNNAPWGLARISHRESLNLANFN------KYLYDDD-AGKNVDAYVIDTGVDVNHV 214
           DF +Q+ AP  LARIS R  L +   +      KY Y ++  G+ V  YV+D+GV+ +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 215 EFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMS 274
           +F  RA  G      +   D  GHGTHVAG IGS+ YGVAK VNI+ VKVL S G G+++
Sbjct: 210 DFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVT 268

Query: 275 DVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGG-GKSPALDLAVNAAVKAGIHFAVAAG 333
           ++++G+E+ V+  + + +        V NMSLG  G    LD AV+A ++ G+   VA G
Sbjct: 269 NIIEGLEYVVNQCIGKKRK------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGG 322

Query: 334 NENQNACNSSPASAEQAVTVGA-STISDERAYFSNWGECVDIFAPGLNILSTYIGANDDV 392
           N   NAC  SPA   +A+TV A    +D  A FSNWG C+DI+APG+N+ S  +      
Sbjct: 323 NSGLNACWYSPAKVRKAITVAAMDDRTDLMAPFSNWGACIDIWAPGVNVKS--LSNKGRG 380

Query: 393 TATLSGTSMASPHVAGLLAYYL--SLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDL 450
           T  LSGTSMASP VAG  A YL     P +  +  ++  +    KK+ I    +      
Sbjct: 381 TFVLSGTSMASPIVAGAAAIYLDQGADPAEVRKILSKTATRGVFKKRAIAVRPR------ 434

Query: 451 PEGTPNVLIYNGGGQDLSDF 470
              TPN ++Y G  Q+  +F
Sbjct: 435 ---TPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  159 bits (402), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 167/319 (52%), Gaps = 31/319 (9%)

Query: 163 FNTQNNAPWGLARISHRESLNLAN---FNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219
           ++TQ NAP  L+R S    L  A+   +N Y   D  G NV  YV+D+G+ ++H EF  R
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 220 AHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVK 278
               +     D  + D  GHGT VAG IGS+ YGVAK+VN+I +KVL + G G++  +++
Sbjct: 202 IL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 279 GVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338
           G++F ++ H E   N       + N SLG      L+ A      AGI    AAGN   N
Sbjct: 260 GLQF-ITKHCEENTN----GNCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 339 ACNSSPASAEQAVTVGASTISDER-AYFSNWGECVDIFAPGLNILSTYIGANDDVTATLS 397
           AC  +PA ++   TVG+    D+  A FSNWG CVD+ APG+ +  T +  N   +   S
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYV-RTLLYTNQKGSRESS 373

Query: 398 GTSMASPHVAGLLAYYLSLQPEKSSEFSTRAISTSQLKKKLIEYATKDVLED-----LPE 452
           GTS+++P V GL A  LS           + +    L  ++ +  ++D+L +     LP 
Sbjct: 374 GTSVSTPIVTGLAAILLS-----------KGVPKENLYDEIRKMGSRDLLRNKEFSRLP- 421

Query: 453 GTPNVLIYNGGGQDLSDFW 471
           GTPN LI N G Q   D +
Sbjct: 422 GTPN-LIVNIGPQKEDDVY 439

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  150 bits (380), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 171/309 (55%), Gaps = 26/309 (8%)

Query: 124 ISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRES-- 181
           I S   G+     DE++  +  +P +A I  D M++  ++  QN+AP  LAR+S+  S  
Sbjct: 57  IGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNS 116

Query: 182 -LNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI---DGNG 237
            ++  N N +++   AG  VD Y++D+G+D  H  F +R H  K I L D  I   D +G
Sbjct: 117 RVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHG 175

Query: 238 HGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSG-SMSDVVKGVEFAVSSHLERMKNEKN 296
           HGT +AG + S  +GV K  N+  V+V+ +  +G  +S ++K +EF + +H     +   
Sbjct: 176 HGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENH-----SRAT 229

Query: 297 LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQA---VTV 353
           ++ SVA +     K+  L+ A+  ++   I   V AGN++  ACN SPASA  +   ++V
Sbjct: 230 MRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSV 288

Query: 354 GA----STISDERAYFSNWGECVDIFAPGLNILSTYIGANDD--VTATLSGTSMASPHVA 407
           G+    S+I  E A FSN+GECVD+F  G+ + + +   N D    + +SGTSM+    A
Sbjct: 289 GSLDYRSSI--EIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAA 346

Query: 408 GLLAYYLSL 416
           G + YY+SL
Sbjct: 347 GTVGYYMSL 355

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 156/285 (54%), Gaps = 16/285 (5%)

Query: 138 ELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAG 197
            LL  +  +  I  +  D ++   ++  Q +AP  LAR+S + +L  ++   Y+Y  + G
Sbjct: 65  RLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLRGSD-GTYIYHSNGG 123

Query: 198 KNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQDI---DGNGHGTHVAGTIGSQHYGVA 254
             VD Y++DTG+D  H E   R    K   L    +   D +GHGT VAG IGS  +G A
Sbjct: 124 NGVDVYLLDTGIDDLHPELEGRVQ--KIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSA 181

Query: 255 KSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPAL 314
           K  N+  V+V  S G+ ++  V++ +E A  S L  +      + SV  +     K+  L
Sbjct: 182 KKCNLFDVRVADSTGNATLIGVIRALEHA--SKLASVTQ----RPSVVVIPFTMRKNVIL 235

Query: 315 DLAVNAAVK-AGIHFAVAAGNENQNACNSSPASAEQAVTVGA--STISDERAYFSNWGEC 371
           + A+ A ++   +   VA GN NQNAC+SSPASA  A+T+G+   T  D  A F+N+G+C
Sbjct: 236 NSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDC 295

Query: 372 VDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSL 416
           +D FA G+NI S   G  +  T   SGTS+++   +G++AYY+SL
Sbjct: 296 IDTFAAGVNITSLTTGDYESNT-QYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  144 bits (362), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 165/311 (53%), Gaps = 21/311 (6%)

Query: 116 GGIVSDFDISSLLSGYIAYLSDELLH-FIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLA 174
           GG V    + +           +LL  F R   ++A +  D  +   ++  Q +AP  LA
Sbjct: 43  GGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHAPNHLA 101

Query: 175 RISHRESLNLANFN---KYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQ 231
           R+S + SL   N +    Y+Y  +AG  VD Y++DTG+D  H  F  R    K    +  
Sbjct: 102 RLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQ--KAADFSSD 159

Query: 232 DI---DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHL 288
            +   D +GHGT VAG IGS  +GVAK  N+  V+V  S G  S+  V++ +E A  S L
Sbjct: 160 PVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHA--SKL 217

Query: 289 ERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVK-AGIHFAVAAGNENQNACNSSPASA 347
             +    +L      + L   ++  L+ AV A V+   I   VAAGNEN++AC+ SPA A
Sbjct: 218 AAVTKRPSL----ITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGA 273

Query: 348 EQAVTVGASTIS--DERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPH 405
             A+T+G+  ++  D  A F+N+ ECVD+F  G+++ +  +G +      LSGTS+++  
Sbjct: 274 YGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGV 331

Query: 406 VAGLLAYYLSL 416
            +GL+AYY+S+
Sbjct: 332 ASGLVAYYMSI 342

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  124 bits (311), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 145/269 (53%), Gaps = 29/269 (10%)

Query: 166 QNNAPWGLARISHRESLNLANF----NKYLYDDDAGKNVDAYVIDTGVDVNH-VEFHSRA 220
           Q +AP  L R++ ++S+  + +    N+Y++ D +G  VD Y++DTG+D+ H +   +  
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 221 HWGKTIPLNDQDI---DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGS-GSMSDV 276
           H  K I L    I   D NGHGT +AG I S  +GV KS N++ V+V+ +N    +MS V
Sbjct: 156 H--KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRV 213

Query: 277 VKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 336
           +  +   +  H      +K ++ S+  +     K+  L+ A+    K  I   + AGN++
Sbjct: 214 LSALSL-IEKH-----EQKTMRPSIIVLPFQTEKNTILESAIENISKK-IPVIIPAGNKH 266

Query: 337 QNACNSSPASAEQ---AVTVGASTISDERAY-----FSNWGECVDIFAPGLNI--LSTYI 386
           QNAC  SP   ++    + VG+   S+E+ Y     FSN+G CVDI+  G++I  L T  
Sbjct: 267 QNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSS 326

Query: 387 GANDDVTATLSGTSMASPHVAGLLAYYLS 415
               ++   ++GTS +   VAG++ YY+S
Sbjct: 327 NGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/347 (28%), Positives = 166/347 (47%), Gaps = 33/347 (9%)

Query: 85  LHLQQSSAFSNDFTEY-LQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFI 143
           + LQ  +A +     Y L +D   PE        I   F++ S    +    S  +L  +
Sbjct: 19  VQLQDKTALNAVLNSYALSSDQQGPE--------ITDIFELGSF-RAFTGDFSGPILQKL 69

Query: 144 RLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAY 203
             +P +  I  D  +   +   QNNAP  L  +S   S++  +   ++Y  + G  VD Y
Sbjct: 70  YNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS---SISPLSHQPFIYRSNGGNGVDVY 126

Query: 204 VIDTGVDVNHVEFHSRAHWGKTIPLND----QDIDGNGHGTHVAGTIGSQHYGVAKSVNI 259
           ++DTG+D+ H    S+ +  +   L      Q  D  GHGT +AG I S+ +GV K  N+
Sbjct: 127 LLDTGIDIKHPNL-SKLNILRMADLTQSPVPQGTDPQGHGTAMAGIIASETFGVLKKCNL 185

Query: 260 IAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVN 319
           + V+V  SNG   +S +++ +      H+E  K    +   V  + +  G +P L  A+ 
Sbjct: 186 VDVRVADSNGDVKLSTILQALTLT-QRHIEGTKRPSVV---VIPLEVEDGNNPILTEAI- 240

Query: 320 AAVKAGIHFAVAAGNENQNACNSSPASA----EQAVTVGASTISDERAYFSNWGECVDIF 375
           A+    +   + AGN  Q+A N SPA+     +  + VG+  +++    F+N+G  VD+F
Sbjct: 241 ASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVF 300

Query: 376 APGLNIL---STYI---GANDDVTATLSGTSMASPHVAGLLAYYLSL 416
             G  I    ST +   G ++ +T  +SGTS +S   AG++ YY+SL
Sbjct: 301 TVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 139/282 (49%), Gaps = 28/282 (9%)

Query: 149 IAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTG 208
           IA I  D  +   +   Q +AP  L ++   E    A  N+++YD  AG  VD Y+ DTG
Sbjct: 80  IAAISIDRQLEPQEMIVQKDAPRHLTKLLETE----AGDNEFVYDSTAGNGVDIYIFDTG 135

Query: 209 VDVNHVEFH-SRAHWGKTIP---LNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKV 264
           +  N      SR H    +P   + DQ+I    HGT ++G IGS  +GV K  N+I V V
Sbjct: 136 IARNSPGLSASRIHDMPGMPGPPIRDQEILE--HGTAMSGLIGSPAFGVLKKCNLIDVNV 193

Query: 265 LRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKA 324
              NG   MS V+KG+   V  H++        + SV N S    K+  L+ A +   + 
Sbjct: 194 GDENGKVFMSKVLKGLNL-VQQHVKHTN-----RPSVINFSYCTLKNAILNSAFDNFPR- 246

Query: 325 GIHFAVAAGNENQNACNSSPASAEQ---AVTVGASTISDE---RAYFSNWGECVDIFAPG 378
            +  AVAAGN  Q  C+ SP   ++    +  G+  ++D+    + FSN+G CV  +APG
Sbjct: 247 DVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPG 306

Query: 379 LNILS-----TYIGANDDVTATLSGTSMASPHVAGLLAYYLS 415
             +L+     T    + D    +SGTS +S   AG++ YY++
Sbjct: 307 EGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  104 bits (260), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 88/319 (27%), Positives = 160/319 (50%), Gaps = 30/319 (9%)

Query: 135 LSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDD 194
            S E L ++  +  +  I  D  +   ++  Q  +P  L+++S   S        + +D 
Sbjct: 60  FSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSGGS--------FTFDP 111

Query: 195 DAGKNVDAYVIDTGVDVNH-----VEFHSRAHWGKT-IPLNDQDIDGNGHGTHVAGTIGS 248
            +G  VD YV DTG+D  H     V  H  A +  + +P   +  D +GHGT +AG I S
Sbjct: 112 VSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIAS 168

Query: 249 QHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGG 308
           + +GV KS +++ V+V   +G   +S ++KG+  +V+ H    K        V  M++G 
Sbjct: 169 ETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASVA-HARFTKRPSVF---VLPMTIGK 224

Query: 309 GKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNW 368
            K+  LD  + A  K  I   + AGN+  +AC+ SP +    + +G+    +  A FSN+
Sbjct: 225 -KNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNY 282

Query: 369 GECVDIFAPGLNILS--TYIGANDDVTATLSGTSMASPHVAGLLAYYL-----SLQPEKS 421
           G CVD++  G +IL+  +    N+ +  + +GTS +    AG++ Y++     S+Q  ++
Sbjct: 283 GNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSMGLTSMQAIQT 342

Query: 422 SEFSTRAISTSQLKKKLIE 440
              S++ I + + + KL++
Sbjct: 343 IRSSSKDIYSHKHRLKLLQ 361

>TDEL0G02400 Chr7 (460300..460533) [234 bp, 77 aa] {ON} Anc_2.310
           YNL015W
          Length = 77

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 8/51 (15%)

Query: 116 GGIVSDFDISSLLSGYIAYLSDELLHFIRL----NPLIAFIEHDTMVHTTD 162
           G I  +F   SL+ GY   L +EL H  +L    NP+IA +E D  VHT +
Sbjct: 31  GAITHEF---SLIKGYTVKLPEEL-HINKLKEGFNPIIANVEEDKEVHTQN 77

>TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa]
           {ON} Anc_5.85 YGR240C
          Length = 991

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 281 EFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           EF   S + + KN  ++K  +A M+  GG SP ++ AV A V+ GIH+  
Sbjct: 194 EFLQKSLINKSKN-GSIKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHYGC 241

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 267 SNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGI 326
           +N S S SDV +    +  + L++  + +  K  +A M+  GG SP ++ AV A V+ GI
Sbjct: 174 ANVSESSSDVSRDASLSAINMLKQTLSGQK-KKKIAVMT-SGGDSPGMNAAVRAVVRTGI 231

Query: 327 HFAV 330
           HF  
Sbjct: 232 HFGC 235

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 96/251 (38%), Gaps = 39/251 (15%)

Query: 196 AGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLNDQ------DIDGNGHGTHVAGTIGSQ 249
            GKNV   ++D GVD  + +   +  +  +   ND        +  + HGT  AG I + 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 250 H-----YGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKGSVANM 304
                  GVA   +I  +++L    SG ++     VE   ++ +  +K       S    
Sbjct: 226 RNDYCGVGVAFDAHISGLRIL----SGELT-----VEDEAAALIYGLKYNDIFSCSWGPP 276

Query: 305 SLGGGKSPALDLAVNAAVKA--------GIHFAVAAGNE--NQNACN-SSPASAEQAVTV 353
             G       DL   A +K         G  +  A+GN   + + CN     ++  ++T+
Sbjct: 277 DDGQHLQGPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITI 336

Query: 354 GASTISDERAYFSNWGE-CVDIFAPGLNILSTYIGANDDVTATLS----GTSMASPHVAG 408
           GA    D R     + E C  + A   +  S       D+    S    GTS A+P  AG
Sbjct: 337 GAI---DHRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCSTHHGGTSAAAPLAAG 393

Query: 409 LLAYYLSLQPE 419
           + A  L   PE
Sbjct: 394 VYALLLEANPE 404

>SAKL0F13178g Chr6 (1041547..1042797) [1251 bp, 416 aa] {ON} highly
           similar to uniprot|P38174 Saccharomyces cerevisiae
           YBL091C MAP2 Methionine aminopeptidase catalyzes the
           cotranslational removal of N-terminal methionine from
           nascent polypeptides function is partially redundant
           with that of Map1p
          Length = 416

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 92/235 (39%), Gaps = 28/235 (11%)

Query: 120 SDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHR 179
            DF++         YL+ +  H  R N +    E    V     N QN    G+A     
Sbjct: 72  QDFNLERTTDEEKRYLARDKDHEQRWNDMRKGAEIHRRVRK---NVQNKIQPGMALTDIV 128

Query: 180 ESLNLANFNKYLYDDDAGKNVDAYV-----IDTGVDVNHVEFHSRAHWGKTIPLNDQDID 234
            ++  A   K+   D+ G +V+          TGV +NH   H   + G T  L   D+ 
Sbjct: 129 NTIENAT-RKFTGTDENGDHVNTPKSQGIGFPTGVSLNHCAAHYTPNAGDTTVLKYDDVM 187

Query: 235 GNGHGTHVAGTIGSQHYGVA---KSVNII-AVKVLRSNG-------------SGSMSDVV 277
               G  V G I    + VA   K  N++ AV+   + G               ++ +V+
Sbjct: 188 KVDFGVQVNGYIIDSAWTVAFNHKYDNLLEAVREATNTGIKEAGIDVRLTDIGEAIQEVM 247

Query: 278 KGVEFAVSSHLERMKNEKNLKG-SVANMSLGGGKS-PALDLAVNAAVKAGIHFAV 330
           +  E  +     ++K  +NL G ++A   + GGKS P +       ++ G HFA+
Sbjct: 248 ESYEVEIDGTTYQVKPCRNLCGHNIAPYQIHGGKSVPIIKNGDQTKMEEGEHFAI 302

>NDAI0K02490 Chr11 complement(554669..555802) [1134 bp, 377 aa] {ON}
           
          Length = 377

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 402 ASPHVAGLLAYYLSL-QPEKSSEFSTRAISTSQLKKKLIEYATKDVLEDLPEG--TPNVL 458
           +SPH   L+ Y+    QP K  +   +A  T  L+KK+  + TK++  +  E   T   L
Sbjct: 10  SSPHGLPLIEYHEKFKQPSKEKK---KAYGTDSLRKKIFNFFTKNIPSEEREKTVTKKAL 66

Query: 459 IYNGGGQDL 467
           + N GG+D 
Sbjct: 67  LENPGGKDF 75

>CAGL0F08041g Chr6 complement(792575..795550) [2976 bp, 991 aa] {ON}
           highly similar to uniprot|P16861 Saccharomyces
           cerevisiae YGR240c PFK1 6-phosphofructokinase
          Length = 991

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 283 AVSSHLERMKNEKNL--KGSVANMSLGGGKSPALDLAVNAAVKAGIH-----FAVAAGNE 335
           AV+   E +++  NL  K  +A M+  GG SP ++ AV A V+ GIH     FAV  G E
Sbjct: 192 AVNQLKESLQSGSNLQKKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHYGCDVFAVYEGYE 250

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 297 LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           +K  +A M+  GG SP ++ AV A V+AGIH+  
Sbjct: 205 IKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHYGC 237

>KNAG0C03360 Chr3 complement(662617..663879) [1263 bp, 420 aa] {ON}
           Anc_7.422 YBL091C
          Length = 420

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 64/143 (44%), Gaps = 19/143 (13%)

Query: 207 TGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVA---KSVNIIA-- 261
           TG+ +NHV  H   + G    L  +D+     G  V G I    + VA   +  N++A  
Sbjct: 164 TGLSLNHVAAHFTPNSGDKTVLKYEDVMKVDFGVQVNGNIIDSAWTVAFDPQYDNLLAAV 223

Query: 262 ------------VKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKG-SVANMSLGG 308
                       + V  ++   ++ +V++  E  ++    ++K  +NL G ++A   + G
Sbjct: 224 KDATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGETFQVKPCRNLCGHNIAPYRIHG 283

Query: 309 GKS-PALDLAVNAAVKAGIHFAV 330
           GKS P +    N  ++ G HFA+
Sbjct: 284 GKSVPIVKNGDNTKMEEGEHFAI 306

>Skud_7.574 Chr7 complement(945547..948510) [2964 bp, 987 aa] {ON}
           YGR240C (REAL)
          Length = 987

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 205 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 236

>YGR240C Chr7 complement(970771..973734) [2964 bp, 987 aa] {ON}
           PFK1Alpha subunit of heterooctameric phosphofructokinase
           involved in glycolysis, indispensable for anaerobic
           growth, activated by fructose-2,6-bisphosphate and AMP,
           mutation inhibits glucose induction of cell
           cycle-related genes
          Length = 987

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 205 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 236

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 204 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 235

>Suva_7.532 Chr7 complement(925240..928203) [2964 bp, 987 aa] {ON}
           YGR240C (REAL)
          Length = 987

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 205 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 236

>Smik_16.66 Chr16 (123019..125982) [2964 bp, 987 aa] {ON} YGR240C
           (REAL)
          Length = 987

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 205 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 236

>ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly
           similar to uniprot|P16861 Saccharomyces cerevisiae
           YGR240C PFK1 Alpha subunit of heterooctameric
           phosphofructokinase involved in glycolysis indispensable
           for anaerobic growth activated by fructose-2 6-
           bisphosphate and AMP mutation inhibits glucose induction
           of cell cycle-related genes
          Length = 984

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAV 330
           K  +A M+  GG SP ++ AV A V+ GIHF  
Sbjct: 204 KKKIAVMT-SGGDSPGMNAAVRAVVRTGIHFGC 235

>YCR034W Chr3 (190592..191635) [1044 bp, 347 aa] {ON}  FEN1Fatty
           acid elongase, involved in sphingolipid biosynthesis;
           acts on fatty acids of up to 24 carbons in length;
           mutations have regulatory effects on 1,3-beta-glucan
           synthase, vacuolar ATPase, and the secretory pathway
          Length = 347

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 364 YFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSE 423
           YF+ + + V ++ P L      +G+    TAT +G ++ S ++   +++Y+++   K ++
Sbjct: 249 YFAVYQKAVHLYFPILPHCGDCVGST---TATFAGCAIISSYLVLFISFYINVYKRKGTK 305

Query: 424 FSTRAISTSQ--LKKKLIEYATKDVLEDLPEGTPN 456
            ++R +  +   +  K+ EY   D L+++P  +P+
Sbjct: 306 -TSRVVKRAHGGVAAKVNEYVNVD-LKNVPTPSPS 338

>Suva_3.68 Chr3 (103937..104980) [1044 bp, 347 aa] {ON} YCR034W
           (REAL)
          Length = 347

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 364 YFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSE 423
           YF+ + + V ++ P L      +G+    TAT +G ++ S ++   +++Y+++   K ++
Sbjct: 249 YFAVYQKAVHLYFPVLPHCGDCVGST---TATFAGCAIISSYLILFISFYINVYKRKGTK 305

Query: 424 FSTRAISTSQ--LKKKLIEYATKDVLEDLPEGTPN 456
            ++R +  +   +  K+ EY   D L+++P  +P+
Sbjct: 306 -TSRVVKRAHGGVAAKVNEYVNVD-LKNVPTPSPS 338

>YBL091C Chr2 complement(47363..48628) [1266 bp, 421 aa] {ON}
           MAP2Methionine aminopeptidase, catalyzes the
           cotranslational removal of N-terminal methionine from
           nascent polypeptides; function is partially redundant
           with that of Map1p
          Length = 421

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 63/143 (44%), Gaps = 19/143 (13%)

Query: 207 TGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVA---KSVNIIA-- 261
           TG+ +NH   H   + G    L  +D+    +G  V G I    + V+   +  N++A  
Sbjct: 164 TGLSLNHCAAHFTPNAGDKTVLKYEDVMKVDYGVQVNGNIIDSAFTVSFDPQYDNLLAAV 223

Query: 262 ------------VKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKG-SVANMSLGG 308
                       + V  ++   ++ +V++  E  ++    ++K  +NL G S+A   + G
Sbjct: 224 KDATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGETYQVKPCRNLCGHSIAPYRIHG 283

Query: 309 GKS-PALDLAVNAAVKAGIHFAV 330
           GKS P +       ++ G HFA+
Sbjct: 284 GKSVPIVKNGDTTKMEEGEHFAI 306

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 193 DDDAGKNVDAYVIDTGVDVNHV-EFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQH 250
           D+++  + ++ ++ +GV+V+H  EFH    + K +PL   D + N H T+  G + S +
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTKEFH--RFFNKDLPLGSDDDEFNEHDTNADGDLRSDY 746

>Smik_2.29 Chr2 complement(40990..42255) [1266 bp, 421 aa] {ON}
           YBL091C (REAL)
          Length = 421

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 63/143 (44%), Gaps = 19/143 (13%)

Query: 207 TGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVA---KSVNIIA-- 261
           TG+ +NH   H   + G    L  +D+    +G  + G I    + V+   +  N++A  
Sbjct: 164 TGLSLNHCAAHFTPNAGDKTVLKYEDVMKVDYGVQINGNIIDSAFTVSFDPQYDNLLAAV 223

Query: 262 ------------VKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKG-SVANMSLGG 308
                       + V  ++   ++ +V++  E  ++    ++K  +NL G S+A   + G
Sbjct: 224 KDATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEINGETYQVKPCRNLCGHSIAPYRIHG 283

Query: 309 GKS-PALDLAVNAAVKAGIHFAV 330
           GKS P +       ++ G HFA+
Sbjct: 284 GKSVPIVKNGDTTKMEEGEHFAI 306

>NCAS0A14590 Chr1 (2871918..2873171) [1254 bp, 417 aa] {ON}
           Anc_7.422 YBL091C
          Length = 417

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 61/143 (42%), Gaps = 19/143 (13%)

Query: 207 TGVDVNHVEFHSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVA---KSVNII--- 260
           TG+ +NH+  H   + G    L  +D+     G  + G I    + VA   K  N++   
Sbjct: 161 TGLSINHIAAHFTPNAGDKTVLKYEDVMKVDFGVQINGNIIDSAWTVAFDHKYDNLLTAV 220

Query: 261 -----------AVKVLRSNGSGSMSDVVKGVEFAVSSHLERMKNEKNLKG-SVANMSLGG 308
                       + V  ++   ++ +V++  E  +     ++K  +NL G ++    + G
Sbjct: 221 REATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEIDGETFQVKPCRNLCGHNIGPYRIHG 280

Query: 309 GKS-PALDLAVNAAVKAGIHFAV 330
           GKS P +    N  ++ G HFA+
Sbjct: 281 GKSVPIVKNGDNTKMEEGEHFAI 303

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,327,074
Number of extensions: 2566049
Number of successful extensions: 8103
Number of sequences better than 10.0: 102
Number of HSP's gapped: 8112
Number of HSP's successfully gapped: 103
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)