Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003506.12ON71713706e-48
TDEL0G045906.12ON74701242e-10
KLLA0D00880g6.12ON71671216e-10
Skud_5.306.12ON7463982e-06
NCAS0F002106.12ON7978956e-06
KNAG0E009306.12ON10961976e-06
Ecym_30156.12ON7053947e-06
ZYRO0F00528g6.12ON7771948e-06
Smik_5.286.12ON7459878e-05
SAKL0E00924g6.12ON9755871e-04
YEL059C-A (SOM1)6.12ON7463852e-04
TBLA0G009906.12ON7838852e-04
KLTH0C11484g6.12ON8936834e-04
ACR014C6.12ON7053770.003
Suva_5.96.12ON7356760.005
TPHA0M002206.12ON7875760.005
NDAI0A028707.311ON9557730.014
Kpol_1032.36.12ON7833690.046
Kwal_56.223596.12ON9165680.089
CAGL0J08976g7.311ON8644640.33
YLR218C (COA4)7.311ON15044630.72
Suva_10.3127.311ON14944630.81
Skud_12.2817.311ON12544611.1
Smik_12.2757.311ON13944601.6
TPHA0C040502.497ON147356611.6
NCAS0E037607.311ON10444574.2
KNAG0B027807.311ON9544565.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00350
         (71 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...   147   6e-48
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    52   2e-10
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    51   6e-10
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    42   2e-06
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    41   6e-06
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    42   6e-06
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    41   7e-06
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    41   8e-06
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    38   8e-05
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    38   1e-04
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    37   2e-04
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    37   2e-04
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    37   4e-04
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    34   0.003
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    34   0.005
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    34   0.005
NDAI0A02870 Chr1 complement(642758..643045) [288 bp, 95 aa] {ON}...    33   0.014
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    31   0.046
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    31   0.089
CAGL0J08976g Chr10 complement(883894..884154) [261 bp, 86 aa] {O...    29   0.33 
YLR218C Chr12 complement(573466..573918) [453 bp, 150 aa] {ON}  ...    29   0.72 
Suva_10.312 Chr10 complement(545725..546069,546073..546177) [450...    29   0.81 
Skud_12.281 Chr12 complement(520157..520444,520453..520539) [375...    28   1.1  
Smik_12.275 Chr12 complement(520512..520823,520827..520832,52083...    28   1.6  
TPHA0C04050 Chr3 (867505..871926) [4422 bp, 1473 aa] {ON} Anc_2....    28   1.6  
NCAS0E03760 Chr5 (741634..741948) [315 bp, 104 aa] {ON} Anc_7.31...    27   4.2  
KNAG0B02780 Chr2 complement(536493..536780) [288 bp, 95 aa] {ON}...    26   5.6  

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score =  147 bits (370), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60
          MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60

Query: 61 KRVETRSGSCK 71
          KRVETRSGSCK
Sbjct: 61 KRVETRSGSCK 71

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 52.4 bits (124), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGT--LECFPFKRMFLECLDKSG 58
          MAP   V+  +    E+  ++ C L SL Q+ C+ R  G+   EC PFKR+F EC D SG
Sbjct: 1  MAPPTPVLAREELP-EIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59

Query: 59 KLK-RVETRS 67
          + K R+E  S
Sbjct: 60 RFKSRIEVTS 69

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 51.2 bits (121), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60
          MAP  +++  D  +R ++  E C L SLVQ  C +  G    C PFKR+F +C+ K G++
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFN-GNDYVCTPFKRLFEQCMVKDGRV 59

Query: 61 KRVETRS 67
            +E  +
Sbjct: 60 LNIEVTN 66

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 42.4 bits (98), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLECL--D 55
          MAP   +   D A   +   +    CQL  LVQ+ C++R    + CFPFKR+F  C+  D
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYV-CFPFKRLFERCIAPD 59

Query: 56 KSG 58
          KS 
Sbjct: 60 KSA 62

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 41.2 bits (95), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 12/78 (15%)

Query: 1  MAPMIRVMDGD------------AAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKR 48
          MAP + V   D              E + +  +GC+ + L Q+ C+    G   CFPFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 49 MFLECLDKSGKLKRVETR 66
          +F EC     ++  V++ 
Sbjct: 61 VFQECQGVRTEVTNVDSN 78

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 42.0 bits (97), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKL 60
          MAP +RV+  +      +  +GC L  LVQ+ CE   G   +C PF+R+F +C  + G  
Sbjct: 1  MAPNVRVLTRNDVPLP-QPQDGCVLKELVQFRCEND-GTQWQCAPFRRLFEQCPSQEGTN 58

Query: 61 K 61
          K
Sbjct: 59 K 59

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 40.8 bits (94), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53
          MAP   ++  D  E  +   + C L SL+Q  C +  G    C PFKR+F EC
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFD-GHNYVCIPFKRLFEEC 52

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 40.8 bits (94), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 1  MAPMIRVMDGDAAERE------VKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECL 54
          MAP   ++  +   RE      +K    C+L SL Q+ C     G   C PFKR+F +CL
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 55 DKSGKLKRVET 65
            + ++   +T
Sbjct: 61 GHALEVTDADT 71

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 38.1 bits (87), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDK 56
          MAP   +   D A   +   +    CQL  LVQ+ C+++ G    C PFKR+F  C++ 
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFK-GADYVCSPFKRLFEHCVEH 58

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 38.1 bits (87), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1  MAPMIRVMDGDAAEREVKGAEG-CQLYSLVQYNCEYRVGGTLECFPFKRMFLECL 54
          MAP   V   D  E  +K  +  C L SL+Q  C +  G    C PFKR+F ECL
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFN-GEEYICVPFKRLFKECL 54

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 37.4 bits (85), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 1  MAP--MIRVMDGDAAE-REVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECL--D 55
          MAP   IR  D   A    +     C+L  LVQ+ C+++ G    C PFKR+F  C+  D
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFK-GAEYVCSPFKRLFEHCIAPD 59

Query: 56 KSG 58
          KS 
Sbjct: 60 KSA 62

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 37.4 bits (85), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 16 EVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53
          + K +   + YS+ QY C     G +ECFPFKR+F + 
Sbjct: 27 DTKKSAKPKKYSITQYECFDNDKGQIECFPFKRIFQQV 64

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 36.6 bits (83), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 18 KGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53
          K AE C L +LVQ  CE+  G    C PFKR+F EC
Sbjct: 19 KAAEPCFLKALVQNECEFN-GHEYVCTPFKRLFKEC 53

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53
          MAP   V+  +     +  +  C L SL Q  C +   G + C PF+R+F EC
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYV-CVPFQRLFREC 52

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53
          MAP   +   D A   +   +    C L  LVQ+ C+++ G    C PF+R+F  C
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFK-GADYVCSPFRRLFEHC 55

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 1  MAPMIRVMDGDAAEREVKGA-----EGCQLYSLVQYNCEY--RVGGTLECFPFKRMFLEC 53
          MAP   V+D +A    ++ +     + C+L +L QY C++         C PFKR+F  C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 54 LDKSGKLKRVETRSG 68
             S +     T S 
Sbjct: 61 AGTSYETTAQPTNSA 75

>NDAI0A02870 Chr1 complement(642758..643045) [288 bp, 95 aa] {ON}
          Anc_7.311 YLR218C
          Length = 95

 Score = 32.7 bits (73), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 9  DGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
          D D  ++ +  A GC + +L    C        +CF    MF +C  K+G L+RV T
Sbjct: 28 DPDVWDKRI-NATGCYIENLALQLCHADTNDWRQCFKEMEMFKKCWQKNGNLERVPT 83

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 31.2 bits (69), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 23 CQLYSLVQYNCEYRVG--GTLECFPFKRMFLEC 53
          C L S+ Q+ C +     G   C PFKR+F EC
Sbjct: 30 CTLTSITQFQCRFENSYEGEYICLPFKRLFEEC 62

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 30.8 bits (68), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 1  MAPMIRVMDGDAAEREVKGAEG-CQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGK 59
          MAP   V   +  E  ++     C   SL Q  C +  G    C PFKR+F EC    GK
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFD-GHQYVCVPFKRVFKEC-KVDGK 58

Query: 60 LKRVE 64
            R+E
Sbjct: 59 SIRIE 63

>CAGL0J08976g Chr10 complement(883894..884154) [261 bp, 86 aa]
          {ON} similar to uniprot|Q05809 Saccharomyces cerevisiae
          YLR218c
          Length = 86

 Score = 29.3 bits (64), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 20/44 (45%)

Query: 22 GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
          GC + +L    C        +CFP    F EC + +G   RV+T
Sbjct: 38 GCYVENLALQLCHAETNDWRQCFPEMAKFKECWESNGNRDRVKT 81

>YLR218C Chr12 complement(573466..573918) [453 bp, 150 aa] {ON}
           COA4Twin Cx(9)C protein involved in cytochrome c oxidase
           assembly or stability; localizes to the mitochondrial
           intermembrane space via the Mia40p-Erv1p system;
           interacts genetically with CYC1 and with cytochrome c
           oxidase assembly factors
          Length = 150

 Score = 28.9 bits (63), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 22  GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
           GC + +L    C    G   +CF    +F +C +K+G  +RV T
Sbjct: 92  GCYVENLALQLCHAETGDWRQCFNEMALFRKCWEKNGNRERVST 135

>Suva_10.312 Chr10 complement(545725..546069,546073..546177) [450
           bp, 149 aa] {ON} YLR218C (REAL)
          Length = 149

 Score = 28.9 bits (63), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 22  GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
           GC + +L    C    G   +CF    +F +C +++G  +RV T
Sbjct: 91  GCYVENLALQLCHAETGDWRQCFNEMELFRKCWEQNGNRERVST 134

>Skud_12.281 Chr12 complement(520157..520444,520453..520539) [375
           bp, 125 aa] {ON} YLR218C (REAL)
          Length = 125

 Score = 28.1 bits (61), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 22  GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
           GC + +L    C    G   +CF    +F +C +++G  +RV T
Sbjct: 67  GCYVENLALQLCHAETGDWRQCFNEMTLFRKCWEQNGNRERVST 110

>Smik_12.275 Chr12
           complement(520512..520823,520827..520832,520836..520892,
           520896..520937) [417 bp, 139 aa] {ON} YLR218C (REAL)
          Length = 139

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 22  GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
           GC + +L    C    G   +CF    +F +C +++G  +RV T
Sbjct: 81  GCYVENLALQLCHAETGDWRQCFNEMTLFRKCWEQNGNRERVST 124

>TPHA0C04050 Chr3 (867505..871926) [4422 bp, 1473 aa] {ON} Anc_2.497
            YKL010C
          Length = 1473

 Score = 28.1 bits (61), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 8/56 (14%)

Query: 4    MIRVMDG--------DAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFL 51
            ++ ++DG        D  E+ + G     LY+ ++   +  + G  ECFP+K + +
Sbjct: 1283 IVEIIDGGNNILVTSDNVEKYITGVIDQMLYTGIEKQLDAFIKGFSECFPYKNLLI 1338

>NCAS0E03760 Chr5 (741634..741948) [315 bp, 104 aa] {ON} Anc_7.311
          YLR218C
          Length = 104

 Score = 26.6 bits (57), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 18/44 (40%)

Query: 22 GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
          GC + +L    C        +CF     F +C D  G  +RV T
Sbjct: 47 GCYVENLALQLCHAETNDWRQCFKEMEFFRQCWDSKGNNERVNT 90

>KNAG0B02780 Chr2 complement(536493..536780) [288 bp, 95 aa] {ON}
          Anc_7.311 YLR218C
          Length = 95

 Score = 26.2 bits (56), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 22 GCQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDKSGKLKRVET 65
          GC + ++    C    G   +C      F +C +K+G  +RV T
Sbjct: 47 GCYVENMALQLCHAETGDWRQCMDDMARFRDCWEKNGNRERVST 90

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,608,483
Number of extensions: 197147
Number of successful extensions: 346
Number of sequences better than 10.0: 27
Number of HSP's gapped: 335
Number of HSP's successfully gapped: 27
Length of query: 71
Length of database: 53,481,399
Length adjustment: 44
Effective length of query: 27
Effective length of database: 48,436,095
Effective search space: 1307774565
Effective search space used: 1307774565
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)