Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003406.11ON54054028940.0
Smik_5.296.11ON55555415320.0
Kpol_1032.26.11ON53953815290.0
NCAS0F002006.11ON54955415120.0
Suva_5.106.11ON55355415070.0
YEL058W (PCM1)6.11ON55755915020.0
Skud_5.316.11ON55755814890.0
TDEL0G046006.11ON52853614790.0
TPHA0M002106.11ON54554114770.0
NDAI0K028906.11ON56155314720.0
KLLA0D00858g6.11ON54153414400.0
CAGL0B03597g6.11ON54053514320.0
SAKL0E00902g6.11ON54454614310.0
TBLA0G009806.11ON55855114180.0
KNAG0E009406.11ON53854114140.0
Kwal_56.223556.11ON54154413860.0
KLTH0C11506g6.11ON54454713391e-180
Ecym_30146.11ON55154413271e-178
ZYRO0F00506g6.11ON55055913251e-178
ACR015W6.11ON55252613241e-178
TDEL0B005708.840ON63031920.015
Kpol_1068.88.840ON63231910.017
YMR278W (PGM3)8.840ON62252910.019
KLTH0C03872g8.840ON621131900.022
Skud_13.4508.840ON62252900.023
NDAI0K004108.840ON62628900.024
KLLA0D01573g8.840ON60731900.028
CAGL0M02981g8.840ON61753890.029
TPHA0I002508.840ON62928890.029
Suva_13.4668.840ON62237890.037
Kwal_27.102588.840ON62031880.044
TBLA0B032508.840ON64328870.057
KNAG0J002708.840ON62528870.057
Smik_13.4918.840ON62237870.059
KAFR0B039208.840ON62427860.075
ABL126W8.840ON62427860.076
ZYRO0G14190g8.840ON61028860.077
Ecym_46118.840ON63043850.091
NCAS0C004108.840ON62560850.092
SAKL0D01474g8.840ON62427850.11
KLLA0B10582g7.518ON262956751.7
KNAG0F004501.79ON1240166724.4
KLLA0F18128g4.29ON72284715.0
Kwal_56.238448.303ON149460715.2
KLLA0A09647g5.41ON77770715.3
TPHA0E037201.39ON316112696.1
TBLA0F017903.408ON1097139697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00340
         (540 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...  1119   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   594   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   593   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   587   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   585   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   583   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   578   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   574   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   573   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   571   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   559   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   556   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   555   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   550   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   549   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   538   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   520   e-180
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   515   e-178
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   514   e-178
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   514   e-178
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    40   0.015
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    40   0.017
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    40   0.019
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    39   0.022
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.023
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    39   0.024
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.028
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    39   0.029
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    39   0.029
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    39   0.037
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    39   0.044
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    38   0.057
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    38   0.057
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    38   0.059
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    38   0.075
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    38   0.076
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    38   0.077
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    37   0.091
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.092
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    37   0.11 
KLLA0B10582g Chr2 (924069..931958) [7890 bp, 2629 aa] {ON} simil...    33   1.7  
KNAG0F00450 Chr6 (60233..63955) [3723 bp, 1240 aa] {ON} Anc_1.79...    32   4.4  
KLLA0F18128g Chr6 (1661367..1663535) [2169 bp, 722 aa] {ON} simi...    32   5.0  
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...    32   5.2  
KLLA0A09647g Chr1 complement(844245..846578) [2334 bp, 777 aa] {...    32   5.3  
TPHA0E03720 Chr5 complement(786291..787241) [951 bp, 316 aa] {ON...    31   6.1  
TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {...    31   7.9  

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/540 (100%), Positives = 540/540 (100%)

Query: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60
           MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG
Sbjct: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60

Query: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120
           VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN
Sbjct: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120

Query: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDVVT 180
           IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDVVT
Sbjct: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDVVT 180

Query: 181 EVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIIN 240
           EVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIIN
Sbjct: 181 EVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIIN 240

Query: 241 DKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHL 300
           DKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHL
Sbjct: 241 DKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHL 300

Query: 301 LDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGV 360
           LDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGV
Sbjct: 301 LDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGV 360

Query: 361 KHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSK 420
           KHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSK
Sbjct: 361 KHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSK 420

Query: 421 LINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERK 480
           LINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERK
Sbjct: 421 LINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERK 480

Query: 481 LTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540
           LTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS
Sbjct: 481 LTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/554 (54%), Positives = 385/554 (69%), Gaps = 19/554 (3%)

Query: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62
           D  QL   + K C T+N  Y+YGTAGFR  A  LDTVMFTTGI+AILRSL LQG+Y+GVM
Sbjct: 4   DYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVM 63

Query: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIA--KL 119
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS   NF  F   L+++I   K+
Sbjct: 64  ITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKI 123

Query: 120 NIDETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQN-- 176
            +D +  P ++VG DSRESSPYL+ CL +    VF   V++   +TTPQLHY+T L N  
Sbjct: 124 GLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKR 183

Query: 177 -------DVVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLPY 228
                  +V TE DYY FF  ++N LFS Y  +  L+   L +D ANG+G  Q  K L  
Sbjct: 184 EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 243

Query: 229 LPQLATLTTI--INDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADR 286
              +     I  INDK +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDADR
Sbjct: 244 KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADR 303

Query: 287 IVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346
           +VFYYVD+  +FHLLDGDKIST+  K L   L  + L N + +GVVQTAYANGSST YI 
Sbjct: 304 VVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIE 363

Query: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406
            +L+ PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++V++  +   S + 
Sbjct: 364 NTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL---SRAR 420

Query: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466
               A  +L  FSKLINQTVGD+++D+LAV+ATL+I++++P DWD EY DLPN L KC V
Sbjct: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480

Query: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526
            +R +F+T D ERKL +P GLQ KID  ++KY  GRSFVRASGTEDAVRIYAE +  +++
Sbjct: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540

Query: 527 EALSKEVTQLVENS 540
           +    E+ +LV+ S
Sbjct: 541 DQFCNEIVELVKAS 554

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/538 (54%), Positives = 392/538 (72%), Gaps = 13/538 (2%)

Query: 11  FIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPP 70
           F KYCTT++H Y YGTAGFR NAS L+TVMFTTGIVA LRS+ L GK +GVMITASHNPP
Sbjct: 6   FEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPP 65

Query: 71  QDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTT--PR 128
           +DNGVKIVEP+GAML +SWE +AT+LANIA++  F     ++ + + K + +  +   P 
Sbjct: 66  EDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQPV 125

Query: 129 LIVGHDSRESSPYLMECLQAAAPVF-DTIVINHTLITTPQLHYLT----MLQNDVVTEVD 183
           ++VG DSRES  YL+ECL A+A  + +  +IN+ L+TTPQLH+LT    + ++  V E  
Sbjct: 126 VVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYAVQESS 185

Query: 184 YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKH 243
           YY +F  SWN + +L+   +L  ++L +D ANG+G  +  + L   P  A+  T++N++ 
Sbjct: 186 YYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWP-FASKVTLVNNEW 244

Query: 244 NVPQMLNVDCGADFVKTNQKLPNGIV-NPNPSDLYASFDGDADRIVFYYVDNNKKFHLLD 302
             P +LN +CGADFVKTNQKLPNG+  N   +DLY S+DGDADRIVFY+ D +K+FHLLD
Sbjct: 245 EKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLD 304

Query: 303 GDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKH 362
           GDKIST+  K +  +L ++ L + I+LGVVQTAYANGSST Y+  +L VPV C KTGVKH
Sbjct: 305 GDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVKH 364

Query: 363 LHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLI 422
           LHH A + +DIG+YFEANGHGT++FS+ FY+V +K +   S S  ++    +L   S LI
Sbjct: 365 LHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVN----TLVALSHLI 420

Query: 423 NQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLT 482
           NQTVGD+++D+L V++ LSI++LS   WD EY DLPNLLTK  V +R VF TTD ERKL 
Sbjct: 421 NQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLL 480

Query: 483 SPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540
           SP GLQ KID A+S++ +GRSFVRASGTEDAVR+YAEA ++ E + L+  VT+LV+ S
Sbjct: 481 SPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKES 538

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/554 (55%), Positives = 390/554 (70%), Gaps = 27/554 (4%)

Query: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62
           D + L+  +   CTTR++ YTYGTAGFR  AS LDTVMF TGI+A  RS+VL G  +GVM
Sbjct: 4   DKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVM 63

Query: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTA---FVMHLSQVIAKL 119
           +TASHNPP DNGVK+VEP+GAMLI+ WE + T LANIA++ +F     F++ +S+   K 
Sbjct: 64  VTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSK-DPKF 122

Query: 120 NIDETTTPRLIVGHDSRESSPYLMECL-QAAAPVFDTIVINHTLITTPQLHYLTMLQN-- 176
              E   P LI+GHDSRESSP L + L   A  +++  + N+ L+TTPQLH++T L N  
Sbjct: 123 PFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAK 181

Query: 177 ------DVVTEVDYYKFFSTSWNNLFSLYPDLN--LTFNNLIVDGANGVGSVQFSKFLPY 228
                 DV++  +YY +F+ SW+    LY D N   +F NLI+D ANG+G  + +  +  
Sbjct: 182 YNKNTNDVISVDNYYNYFNASWSKFQELY-DFNSFKSFENLIIDSANGIGGPKVTDLIST 240

Query: 229 LPQ-LATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRI 287
            P  L    +IIN+    P +LN DCGAD+VKTNQKLP GI NP+  +L+ SFDGDADRI
Sbjct: 241 WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGDADRI 300

Query: 288 VFYYVDN-NKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346
           VFYY+   ++KFHLLDGDKI+T+  K L ++L+E+ L + + LGVVQTAYANGSST Y+T
Sbjct: 301 VFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLT 360

Query: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406
             LKVPV CTKTGVKHLHH A +K+DIGIYFEANGHGTVLFS +F +VLQ        +E
Sbjct: 361 NVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQ--------NE 412

Query: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466
               A  +L  F K+INQTVGD+MAD+L VI  LS+ +++PS WD  Y+DLPN L K  V
Sbjct: 413 PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIV 472

Query: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526
            +R VF TT+ ER+LTSP GLQEKID AVSK  +GRSFVRASGTEDAVR+YAEA T+ E 
Sbjct: 473 PDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEET 532

Query: 527 EALSKEVTQLVENS 540
           E LS+EV + V +S
Sbjct: 533 EKLSQEVCKFVLSS 546

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/554 (53%), Positives = 378/554 (68%), Gaps = 21/554 (3%)

Query: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62
           D  QL   + + C T+N  Y+YGTAGFR  A  LDTVMFTTGI+A+LRSL LQG+Y+GVM
Sbjct: 4   DYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVM 63

Query: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIAKLNI 121
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS    F  F   L ++I    I
Sbjct: 64  ITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKI 123

Query: 122 DETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQN---- 176
           D    P ++VG DSRESSP+L+ CL +  A VF   V++   +TTPQLHY+T L N    
Sbjct: 124 DLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQR 183

Query: 177 -----DVVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLP--- 227
                 V TE DYY FF  ++N LF+    +  L+   L VD ANG+G  Q  K L    
Sbjct: 184 EGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKD 243

Query: 228 -YLPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADR 286
             +P  +    I+NDK +VP++LN +CGAD+VKTNQ+LP G+   +P  LY SFDGDADR
Sbjct: 244 WAVP--SDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADR 301

Query: 287 IVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346
           +VFYYVD   KFHLLDGDKIST+  K L   L  + L + + +GVVQTAYANGSST YI 
Sbjct: 302 VVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIK 361

Query: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406
            +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++ ++  +     S 
Sbjct: 362 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS- 420

Query: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466
               A  +L  F+ LINQTVGD+++D+LAV+ATLSIL ++P+DWD EY DLPN L KC V
Sbjct: 421 --LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIV 478

Query: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526
            +R +F+TTD ERKL +P+GLQ KID+ + KY  GRSFVRASGTEDAVR+YAE +   ++
Sbjct: 479 PDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKL 538

Query: 527 EALSKEVTQLVENS 540
           +    EV + V++S
Sbjct: 539 DQFCNEVVEYVKSS 552

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/559 (53%), Positives = 388/559 (69%), Gaps = 27/559 (4%)

Query: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62
           D  QL   +   C T+N  ++YGTAGFR  A  LDTVMF+TGI+A+LRSL LQG+Y+GVM
Sbjct: 4   DYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVM 63

Query: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIA--KL 119
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS   NF  F + L+++I   K+
Sbjct: 64  ITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKI 123

Query: 120 NIDETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQND- 177
           +++ T  P ++VG DSRESSPYL+ CL ++ A VF   V++   +TTPQLHY+T L N  
Sbjct: 124 DLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRR 183

Query: 178 --------VVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLPY 228
                   V TE DYY FF  ++N LF+ Y  +  L+   L +D ANG+G  Q  K L  
Sbjct: 184 KLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLAS 243

Query: 229 ----LPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDA 284
               +P  A    +IND+ +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDA
Sbjct: 244 EDWDVP--AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDA 301

Query: 285 DRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKY 344
           DR+VFYYVD+  KFHLLDGDKIST+  K L   L  + L + + +GVVQTAYANGSST Y
Sbjct: 302 DRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAY 361

Query: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSS 404
           I  +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF+  ++  +    S
Sbjct: 362 IKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSEL----S 417

Query: 405 SEKIHKARLSLF---YFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLL 461
             K++   L+L     FS+LINQTVGD+++D+LAV+ATL+IL++SP DWD EY DLPN L
Sbjct: 418 KSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKL 477

Query: 462 TKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAK 521
            KC V +R +F+TTD ERKL +P GLQ+KID  V+KY  GRSFVRASGTEDAVR+YAE K
Sbjct: 478 VKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECK 537

Query: 522 TKAEVEALSKEVTQLVENS 540
             +++     EV + V+ S
Sbjct: 538 DSSKLGQFCDEVVEHVKAS 556

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/558 (53%), Positives = 380/558 (68%), Gaps = 25/558 (4%)

Query: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62
           D  QL   + + C T+N  Y+YGTAGFR  A  LDTVMFTTGI+A+LRSL LQG+Y+GVM
Sbjct: 4   DYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVM 63

Query: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIAKLNI 121
           ITASHNP QDNGVKIVEP G+ML+ SWE  A  LAN AS   +F  F   L ++I    I
Sbjct: 64  ITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKI 123

Query: 122 D---ETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQND 177
           D       P ++VG DSRESSPYL+ CL +  A VF   V++   +TTPQLHY+T L N 
Sbjct: 124 DLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNR 183

Query: 178 ----------VVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFL 226
                       TE DYY FF  ++N LF+ Y  +  L+   L +D ANG+G  Q  K L
Sbjct: 184 REREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLL 243

Query: 227 PYLPQL--ATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDA 284
                +  +    IINDK +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDA
Sbjct: 244 ASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFDGDA 303

Query: 285 DRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKY 344
           DR+VFYYVD+  KFHLLDGDKIST+  K L   L  + L   + +GVVQTAYANGSST Y
Sbjct: 304 DRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAY 363

Query: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAID--NG 402
           I  +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++ ++  +   NG
Sbjct: 364 IKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKPNG 423

Query: 403 SSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLT 462
            +      A  +L  F+KLINQTVGD+M+D+LAV+ATL+IL+++P +WD EY+DLPN L 
Sbjct: 424 HT-----LALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478

Query: 463 KCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKT 522
           KC V +R +F+TTD ERKL +P GLQ KID+ ++KY  GRSFVRASGTEDAVR+YAE + 
Sbjct: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538

Query: 523 KAEVEALSKEVTQLVENS 540
            ++++    E+   V+ S
Sbjct: 539 MSKLDQFCNEIVGYVKAS 556

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/536 (54%), Positives = 379/536 (70%), Gaps = 19/536 (3%)

Query: 7   LEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITAS 66
           LE    +YCTTR + Y YGTAGFR ++  LDTVMF TGIVA LRS VL GK +GVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 67  HNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTT 126
           HNP  DNGVK+VEP G+MLI+SWE  AT+LAN+ ++         + Q+ +    + +  
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121

Query: 127 PRLIVGHDSRESSPYLMECLQAAA-PVFDTIVINHTLITTPQLHYLT---MLQNDVVTEV 182
           P+LIVG DSR S P+L+ CL A+A  +FD  + ++ L+TTPQLH+LT   M+    V E 
Sbjct: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMITGAHVDEQ 181

Query: 183 DYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDK 242
            Y+  F  +W+ + +L P   +   N++VD ANG+G  + S  L      A   ++INDK
Sbjct: 182 AYFAHFLGAWDQIAALQP---VKLPNVVVDCANGIGGPKMSALLTQW-GFAKQCSVINDK 237

Query: 243 HNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHLLD 302
            + P++LN  CGADFVKT+Q+LPNG V PN +DLY SFDGDADR+VFYY+D N  FHLLD
Sbjct: 238 CDEPELLNHGCGADFVKTSQRLPNG-VKPNANDLYCSFDGDADRVVFYYLDQNLGFHLLD 296

Query: 303 GDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKH 362
           GDKIST+    +  +L++ +L + +++GVVQTAYANGSSTKY+  +L+VPV CTKTGVKH
Sbjct: 297 GDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKH 356

Query: 363 LHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLI 422
           LHH A + +DIGIYFEANGHGTV+FSNKF+E +    D  +   KI K      Y +KLI
Sbjct: 357 LHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ-TPELKILK------YLAKLI 409

Query: 423 NQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLT 482
           NQTVGD+++D++AV+A LSILQ SPS WD E+ DLPN LTK  V +R  F TTD ER+L 
Sbjct: 410 NQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLV 469

Query: 483 SPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVE 538
           SP+GLQ+KID AV++  SGRSFVRASGTEDAVR+YAEA T++E + LS  V  LV 
Sbjct: 470 SPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVR 525

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/541 (53%), Positives = 374/541 (69%), Gaps = 15/541 (2%)

Query: 7   LEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITAS 66
           LE  F   CTTRNH Y YGTAGFR +A+ LDTVM TTG++A LRS+ L GK +GVMITAS
Sbjct: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65

Query: 67  HNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTA-FVMHLSQVIAKLNIDETT 125
           HN P DNGVKIVEP G+ML +SWE  AT+LAN AS  + T  F ++L +  A+  +D   
Sbjct: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125

Query: 126 TPRLIVGHDSRESSPYLMECLQA-AAPVFDTIVINHTLITTPQLHYLTMLQNDV-----V 179
           TP L+VG DSR+S P L++CL + A P+    +I++ L+TTPQLH+LT   N       V
Sbjct: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185

Query: 180 TEVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTII 239
           TE DYY FF  +W ++ +L+    L    L +D ANG+G  + SK     PQ    T ++
Sbjct: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQAGQFT-LV 244

Query: 240 NDKHNVPQMLNVDCGADFVKTNQKLPNGI---VNPNPSDLYASFDGDADRIVFYYVDNNK 296
           N+    P +LN DCGAD+VKTNQ+LP  I    + +P+ LY SFDGDADRIVFYY D   
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304

Query: 297 KFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECT 356
            FHLLDGDKIST+    +   L+++ L   I++GVVQTAYANG+ST Y+   L +PV C 
Sbjct: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364

Query: 357 KTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLF 416
           KTGVKHLHH A + +D+GIYFEANGHGT++FSNKF+E  +  +   + S ++     +L 
Sbjct: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNESLEVK----TLL 420

Query: 417 YFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTD 476
            F+ LINQTVGD+++D+L V+A LSI++L+PS WD EY DLPNLLTK  V +R +F TTD
Sbjct: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480

Query: 477 MERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQL 536
            ERKL +P G Q KIDA V+KY +GRSFVRASGTEDAVR+YAEA T  +  AL++EV++ 
Sbjct: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540

Query: 537 V 537
           V
Sbjct: 541 V 541

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/553 (56%), Positives = 390/553 (70%), Gaps = 30/553 (5%)

Query: 6   QLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGK----YIGV 61
           QL+  F + C T+N+ YTYGTAGFR NA  LDTVMFTTGIVA LRSL LQ       IGV
Sbjct: 11  QLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGV 70

Query: 62  MITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKL-- 119
           M+TASHNPP+DNGVKI+EP+G+ML++ WE  AT  ANIA++ +F  F   L   I  L  
Sbjct: 71  MVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEN 130

Query: 120 NIDETTTPRLIVGHDSRESSPYLM-ECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDV 178
           +++    P LI+GHDSR+SSP LM   +++A  +F+  +IN+  +TTPQLH+LT L N  
Sbjct: 131 DLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTT 190

Query: 179 --VTEVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFL------PYLP 230
               E++YY  F+   + L SLYP  NL F+NLI+D ANG+G+ Q  K L      P L 
Sbjct: 191 GTAEEINYYDHFNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPPL- 249

Query: 231 QLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI---VNPNPSDLYASFDGDADRI 287
            +     IIN+    P +LN++CGAD+VKTNQKLP GI   ++ N S L+ S+DGDADRI
Sbjct: 250 NIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDAN-STLFCSYDGDADRI 308

Query: 288 VFYYVD---NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKY 344
           VFYY+D   NN  F+LLDGDKI+T+  K   ++L  ++L + + LGVVQTAYANGSST Y
Sbjct: 309 VFYYIDPMTNN--FNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNY 366

Query: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSS 404
           I+  LKVPV CTKTGVKHLHH A +K+DIGIYFEANGHGTV+FS+KF+  L K  ++GSS
Sbjct: 367 ISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKESGSS 426

Query: 405 SEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKC 464
            E       +L  FS+LINQTVGD+M+D+LAVIA LSILQLSP+ WD EY+DLPN L K 
Sbjct: 427 RE-----IKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKV 481

Query: 465 TVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKA 524
            V +R  F TTD ERKL  P GLQ  ++ AV+    GRSFVRASGTEDAVR+YAEAKT+ 
Sbjct: 482 IVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQE 541

Query: 525 EVEALSKEVTQLV 537
           E E LSK+V QLV
Sbjct: 542 ETEWLSKKVCQLV 554

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/534 (55%), Positives = 374/534 (70%), Gaps = 12/534 (2%)

Query: 13  KYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQD 72
           +YC  + H+YTYGTAGFRA+ S LDTVMFTTGIVA+LRS+ L+ K++GVMITASHNPP+D
Sbjct: 9   QYCK-QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPED 67

Query: 73  NGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132
           NGVK+VEP G ML+++WE IAT LAN AS  +FT     L  +IA+LNID T    + V 
Sbjct: 68  NGVKVVEPYGEMLVQNWEPIATKLANAAS-SSFTQLESTLQSIIAELNIDTTQLANITVA 126

Query: 133 HDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYL-----TMLQNDVVTEVDYYK 186
            DSRES P L+  L+A   VF  + +I+  L+TTPQLH+L     T  Q   V +  YY 
Sbjct: 127 RDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYYD 186

Query: 187 FFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQ-LATLTTIINDKHNV 245
            F + WN L  LY    L F+ L +D ANG+G+ +  + +      L    T +N +   
Sbjct: 187 HFVSIWNQLTQLYEVTELPFH-LTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245

Query: 246 PQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNK-KFHLLDGD 304
            Q+LN  CGADFVKTNQ  P    NP PS LY SFDGDADR+VFYYVD  + KFHLLDGD
Sbjct: 246 FQLLNESCGADFVKTNQTFPAN-CNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDGD 304

Query: 305 KISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKHLH 364
           KI+T+L K +  +LR+  L + + LGVVQTAYANGSSTKYIT  LK+PV CTKTGVKHLH
Sbjct: 305 KIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHLH 364

Query: 365 HIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLINQ 424
           H A S++DIGIYFEANGHGTV+FS +F E +   +   S +E+ +K+ LSL   S+LINQ
Sbjct: 365 HEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQLINQ 424

Query: 425 TVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLTSP 484
           TVGD+++D+LAVIATLSI  L P DWD  YQDLPN LTK  V +R VF +T+ ER+L SP
Sbjct: 425 TVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLSP 484

Query: 485 SGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVE 538
            GLQ KID  V+++ + RSFVRASGTEDAVR+YAEA+T      L+ +V +LV+
Sbjct: 485 EGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVK 538

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/535 (54%), Positives = 374/535 (69%), Gaps = 24/535 (4%)

Query: 13  KYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQD 72
           K C TR+  YTYGTAGFRA+A  LD+VMFTTG++A LRS+  Q   +GVMITASHNPP+D
Sbjct: 8   KNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRD 67

Query: 73  NGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132
           NGVKIVE  G+ML++ WE +AT LAN  S  ++  F   L+ ++ +LNI     P+++VG
Sbjct: 68  NGVKIVESDGSMLLQDWEPLATRLAN--SVADYHTFESTLNAIMQELNISPGHAPQIVVG 125

Query: 133 HDSRESSPYLM----ECLQAAAPVFDTIVINHTLITTPQLHYLTMLQNDVVTEVDYYKFF 188
           HDSRESSP L+    + ++A +P  D  + NH L+TTPQLH+LT   N    E  YY++F
Sbjct: 126 HDSRESSPRLLANLLDGIKAVSP--DARITNHGLLTTPQLHFLTA--NPAHFEDYYYRYF 181

Query: 189 STSWNNLFSLYPDLNL-TFNNLIVDGANGVGSVQFSKFLPY----LPQLATLT----TII 239
             +WN LF LY      +F+ L++D ANG+G  QF K L Y    LP L  +      I 
Sbjct: 182 LDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDIT 241

Query: 240 NDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFH 299
           N+    P MLN  CGADFVKTNQ+LP GI N +P +LY SFDGDADR+VFYYVD++  FH
Sbjct: 242 NNSWLNPSMLNSGCGADFVKTNQRLPEGI-NADPRNLYCSFDGDADRVVFYYVDDSLTFH 300

Query: 300 LLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTG 359
           LLDGDKIST+L   + ++L+E+ L  ++ LGVVQTAYANGSST Y+TK L+VPV   KTG
Sbjct: 301 LLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVSIAKTG 360

Query: 360 VKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFS 419
           VKHLHH A + +DIG+YFEANGHGTV+FS  FYEV++  +   +      K+ L+L   S
Sbjct: 361 VKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD----KSTLTLRLLS 416

Query: 420 KLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMER 479
           +LINQT+GD+++D+LA+I  L IL  SP+ WD EY DLPN LTK  V +R +F TTD ER
Sbjct: 417 RLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQER 476

Query: 480 KLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVT 534
           +L SP+GLQ+KID  V+    GRSF+RASGTEDAVR+YAEA+T    E LS EVT
Sbjct: 477 RLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVT 531

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/546 (51%), Positives = 376/546 (68%), Gaps = 10/546 (1%)

Query: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60
           M +I  LE  + K+C T   +YTYGTAGFR  A  LDTVMFTTGI+A +RS+ L+G+Y+G
Sbjct: 1   MVNIQLLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVG 59

Query: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120
           VMITASHNPPQDNGVKIV+P G ML ++WE  AT+LAN AS G     +  L ++I KL 
Sbjct: 60  VMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK-QELIKALDKLITKLG 118

Query: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQND-- 177
           ID+T + ++ +  DSRES P L++ +     V   + V++  L+TTPQLH+LT   N   
Sbjct: 119 IDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQGS 178

Query: 178 --VVTEVDYYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATL 235
              V E  YY  FS++W  +  L+ D+N     +I+D ANG+G  + S+ L      ++ 
Sbjct: 179 SSKVEESTYYSAFSSAWTKICGLH-DINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSST 237

Query: 236 TTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSD-LYASFDGDADRIVFYYVDN 294
            ++IN++   P++LN  CGAD+VKTNQ  P G+   + ++ +Y SFDGDADRIVFYY D 
Sbjct: 238 VSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDE 297

Query: 295 NKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVE 354
             KF+LLDGDKIST+  K    +L  +   N++ LGVVQTAYANGSST+Y++  L+VPV 
Sbjct: 298 KSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVS 357

Query: 355 CTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLS 414
           CT TGVKHLHH A   +DIGIYFEANGHGTV+FS++F++ + K +      EK  KA  +
Sbjct: 358 CTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE-PQDEKTAKALKT 416

Query: 415 LFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKT 474
           L+ F+ LINQTVGD+++D+LAV+A L IL+ SP  WD EY DLPN L K  V +R VFKT
Sbjct: 417 LYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKT 476

Query: 475 TDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVT 534
           ++ ER+L SP GLQEKID+ V +++ GRSFVRASGTEDAVR+YAEA TK + + L+  V+
Sbjct: 477 SNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVS 536

Query: 535 QLVENS 540
            LV  S
Sbjct: 537 DLVSRS 542

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/551 (52%), Positives = 381/551 (69%), Gaps = 25/551 (4%)

Query: 2   FDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGV 61
            D+++    F K C T+NH YTYGTAGFR  A+ LDTVMFTTG VA LRSL   GK +GV
Sbjct: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64

Query: 62  MITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNI 121
           M+TASHNPP DNGVKIVEP+G+ML + WE IATDLAN+AS G     V  ++  + +LN 
Sbjct: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVNAKLIELNS 124

Query: 122 DETTTPRLIVGHDSRESSPYLMECLQAAA-PVFDTIVINHTLITTPQLHYLT---MLQND 177
           ++   P LIVG DSRESS  L+ECL+  +  +FD  ++++ L+TTPQLH+LT    L+ D
Sbjct: 125 NK--VPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKD 182

Query: 178 VVTEVDYYKFFSTSWNNLFSLYPDLNLTFNN----LIVDGANGVGSVQFSKFLPYLPQLA 233
           +  E DYY  F+ +W+ L S+  D + + +N    LI+D ANG+G  +    L Y  +  
Sbjct: 183 LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW-KTN 241

Query: 234 TLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNG----IVNPNPSD-LYASFDGDADRIV 288
               +IN+    P+ LN +CGAD+VKTNQKLPNG    I+N +  + ++ SFDGDADR+V
Sbjct: 242 YKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVV 301

Query: 289 FYYVD-NNKKFHLLDGDKISTILTKCLISM---LRESELLNDINLGVVQTAYANGSSTKY 344
           FYY D  +  F+LLDGDKIST+     ISM   L   +  N+I LGVVQTAYANGSST Y
Sbjct: 302 FYYQDPQSNTFNLLDGDKISTLFAN-FISMQLKLAGIDYENEIKLGVVQTAYANGSSTNY 360

Query: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSS 404
           + ++LK+PV C KTGVKHLHH A +++DIG+YFEANGHGT++FS  FY+++ + I+  S 
Sbjct: 361 LQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQ 420

Query: 405 SEKIHKARL--SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLT 462
            E   K R   +L   S LINQTVGD+++D++ V+A L+IL  +P  W+ EY DLPN L 
Sbjct: 421 IENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLA 480

Query: 463 KCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKT 522
           K  V +R VF+TTD ERKLTSP+GLQ KI+  V+KY++GRSFVRASGTEDAVR+YAEA  
Sbjct: 481 KLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEASD 540

Query: 523 KAEVEALSKEV 533
             +V  L +EV
Sbjct: 541 --DVNKLCQEV 549

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/541 (52%), Positives = 366/541 (67%), Gaps = 24/541 (4%)

Query: 11  FIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPP 70
           F   CTT+ ++YTYGTAGFR  A+ LDTVMF TG VA+LRS  L G  +GVM+TASHNPP
Sbjct: 10  FDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPP 69

Query: 71  QDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLI 130
           +DNGVK+V+P G ML E WE +AT LAN+A++G F  +  + + ++ + N   T   RL 
Sbjct: 70  EDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY--TGGARLC 127

Query: 131 VGHDSRESSPYLMECLQAAAPVFD--TIVINHTLITT-PQLHYLTMLQNDVVTEVDYYK- 186
           VGHD+RESSP L++ L  AA      +I I+   IT  PQLHYLT LQ D VT+   Y  
Sbjct: 128 VGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRDGVTDAAAYND 187

Query: 187 FFSTSWNNLFSLYPD--LNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKHN 244
            F   W  LF   PD  +   F+ L +D ANGVG+VQ  +F            ++N  + 
Sbjct: 188 HFQGCWQKLF---PDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYG 244

Query: 245 VPQMLNVDCGADFVKTNQKLPNGIVNPNPS-----DLYASFDGDADRIVFYYVDNNKKFH 299
            P+ LNV CGADFVKTN +LP+ + +   +     DLY SFDGDADRIVFY+V  NK+FH
Sbjct: 245 TPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIVFYFV-KNKQFH 303

Query: 300 LLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTG 359
           LLDGDKIST+  K +  +   +   + + +GVVQTAYANG+ST+YI   L +P  CTKTG
Sbjct: 304 LLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTG 363

Query: 360 VKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFS 419
           VKHLHH+A++++DIGIYFEANGHGTV+FS+KF EV+       +     + A  +L++FS
Sbjct: 364 VKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVV-------AGVASTNDAASTLYHFS 416

Query: 420 KLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMER 479
           KLINQTVGD++AD+L V+A L  LQ +P  W  EY DLPNLLTK  V +R +F+TTD ER
Sbjct: 417 KLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQER 476

Query: 480 KLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVEN 539
           +L SP GLQEKIDA V ++   RSFVRASGTE+AVRIY EA+   EV+ LSK+VT+ V N
Sbjct: 477 RLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLN 536

Query: 540 S 540
           S
Sbjct: 537 S 537

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/544 (51%), Positives = 366/544 (67%), Gaps = 11/544 (2%)

Query: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60
           M D   L+  +  +C+T  H Y YGTAGFR  A  LDTVMFTTG+VA LRS+ L+GK +G
Sbjct: 1   MLDTKALKSLYEAHCSTGFH-YAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVG 59

Query: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120
           VMITASHNPP+DNGVKIV+P G ML +SWE  ATDLAN AS G F+ FV  + +++ KL 
Sbjct: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQG-FSEFVASVERLMTKLE 118

Query: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQNDVV 179
           +       ++V  DSRES P L+    +   V   + V +H L+TTPQLH+LT   N++ 
Sbjct: 119 VGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178

Query: 180 --TEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234
             TE+    YY  F ++W  +  L    +L +  L +D ANG+G+   ++ L        
Sbjct: 179 KGTEIGKSLYYDNFLSAWVEIAELCKIDSLPYK-LEIDAANGIGAPVVTEMLSQHKFFKG 237

Query: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSD-LYASFDGDADRIVFYYVD 293
              ++ND+   P  LN  CGADFVKTNQKLP+GI      + +  SFDGDADRIVFYY  
Sbjct: 238 AFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCG 297

Query: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353
            N  FHLLDGDK++T+  K    +LR++ L +++ LGVVQTAYANGSST YI + L + V
Sbjct: 298 KNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISV 357

Query: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413
            CT TGVKHLHH A  K+DIG+YFEANGHGTV+FS+KF +V+ + +     S+   K+  
Sbjct: 358 TCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLK 416

Query: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473
            L  F+KLINQTVGD+++D+LAV+A LSIL+ SP  WD EY DLPN L K  V +R VFK
Sbjct: 417 VLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFK 476

Query: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533
           T + ER+L SP+G+QEKIDA V+ +  GRSFVRASGTEDAVR+YAEA T  E EALS++V
Sbjct: 477 TKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQV 536

Query: 534 TQLV 537
            +L+
Sbjct: 537 EKLL 540

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  520 bits (1339), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 273/547 (49%), Positives = 370/547 (67%), Gaps = 11/547 (2%)

Query: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60
           M D   LE  +  +C +   +Y YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ +G
Sbjct: 1   MLDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVG 59

Query: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120
           VMITASHNPP+DNGVKIV+P G ML +SWE  ATDLAN A+  +FTAF+ +L  ++++L 
Sbjct: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQ-SFTAFLAYLQNLVSELG 118

Query: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTIVI-NHTLITTPQLHYLTMLQNDVV 179
           +D      L V  DSRES P L+  L   + V   I I ++ L+TTPQLH+LT  +N++ 
Sbjct: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178

Query: 180 --TEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234
             T +D   YYK F ++W+++ +L    +L +  L +D ANG+G+ +  + L        
Sbjct: 179 NDTAIDRFFYYKEFLSAWDDITALCGIQSLPYK-LEIDAANGIGAPRVKEMLSTHKFFDG 237

Query: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVD 293
           +  ++ND    P  LN  CGAD+VKTNQ+LP GI  N +   +  SFDGDADRIVFY+ D
Sbjct: 238 VFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD 297

Query: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353
           +  +F LLDGDK++T+  K    +L  + L   ++LGVVQTAYANGSST YI + L +PV
Sbjct: 298 SEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPV 357

Query: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413
            CT TGVKHLHH A   +DIG+YFEANGHGTV+FS KF EV+   + N   S+   ++  
Sbjct: 358 TCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLE 416

Query: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473
            L  F+ LINQTVGD+++D++ V+A LSIL+ +P  W+ EY DLPN L K  V +R VFK
Sbjct: 417 VLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFK 476

Query: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533
           TT+ ER+L SP GLQ KI+A V++Y   RSFVRASGTEDAVR+YAEA T+ E ++L+  V
Sbjct: 477 TTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRV 536

Query: 534 TQLVENS 540
           +Q+VE++
Sbjct: 537 SQVVEHN 543

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  515 bits (1327), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 268/544 (49%), Positives = 362/544 (66%), Gaps = 13/544 (2%)

Query: 4   ITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMI 63
           + ++   + K+C +R   Y YGTAGFR  A  LDTV+FTTG++A LRS+ L+G+Y+G MI
Sbjct: 4   VEEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMI 62

Query: 64  TASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDE 123
           TASHNPPQDNGVK+V+P G ML + WE  AT+LAN AS G    F+  L +++ +  I  
Sbjct: 63  TASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQ-FLHRLQELMNQFGIKA 121

Query: 124 TTTPRLIVGHDSRESSPYLMECLQAAAPVFDTI-VINHTLITTPQLHYLT-----MLQND 177
            +  R++V  DSRES   L++ L     VF  + ++++ ++TTPQLH+LT      ++++
Sbjct: 122 DSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESE 181

Query: 178 VVTEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234
            V EV+   YY  F ++   L  L+    L +  L++D ANGVG  +  +          
Sbjct: 182 RVIEVNEAFYYSHFLSALKELTELFNIPGLPYP-LVIDAANGVGGAKAEELFMKNTFFKD 240

Query: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVD 293
            TTIIN   +   +LN  CGAD+VKTNQ LP GI    + + L+ SFDGDADR++FYY D
Sbjct: 241 STTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRD 300

Query: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353
            +  FHLLDGDKIST+  K   SML  + + +++ LGVVQTAYANGSST+Y+++ L VPV
Sbjct: 301 VDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPV 360

Query: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413
            CT TGVK+LH  A   +D+GIYFEANGHGTV+FS  F   + K +  GS S +   A  
Sbjct: 361 SCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALK 420

Query: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473
           +L  FSKLINQTVGD+M+D++AV+A L IL+ +P  WD EY DLPN L K  V +R +FK
Sbjct: 421 TLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFK 480

Query: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533
           TT+ ER+L SP GLQ +ID  +  YD+ RSFVRASGTEDAVRIYAEA TK + + LS ++
Sbjct: 481 TTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKI 540

Query: 534 TQLV 537
           +QLV
Sbjct: 541 SQLV 544

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  514 bits (1325), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/559 (48%), Positives = 369/559 (66%), Gaps = 31/559 (5%)

Query: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60
           M  +  L     +YC+  +  Y YGTAGFR  A+TLDTV+F TGI+A LRSL L+G  IG
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANI-----ASHGNFTAFVMHLSQV 115
           VM+TASHNPP DNGVK+VEP G+M+ ESWE +AT+LAN      +SH    A    L + 
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 116 I------AKLNIDETTTPRLIVGHDSRESSPYLMECLQAAAP-VFDTIVINHTLITTPQL 168
           +      A  + +E   P L+VG DSRES P L+ CL A+A  +F   + +  L+TTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 169 HYLTMLQNDVV---TEVDYYKFFSTSWNNLFSLYP--DLNLTFNNLIVDGANGVGSVQFS 223
           H+LT      V   TE  YY+ F  +W+ +  L+   +   T ++L +D ANG+G+ +  
Sbjct: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240

Query: 224 KFLPYLPQLATLTTI--INDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFD 281
           + L    Q A    +  INDK   P++LN +CGADFVK+NQ+ P G    + + L  S+D
Sbjct: 241 ELLS---QWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF--NDSTGLGCSYD 295

Query: 282 GDADRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSS 341
           GDADR+VFYY++   +F LLDGD+IS +       +L+++ L ++++LGVVQTAYANG+S
Sbjct: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355

Query: 342 TKYITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDN 401
           T+Y+ K+L+VPV C KTGVKHLHH A +K+DIGIYFEANGHGT++FS KFY+V+++  + 
Sbjct: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKER 415

Query: 402 GSSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLL 461
             + E       +L  FS+LINQTVGD+++D+L V+A LSI + +P  W  E+ DLPN L
Sbjct: 416 SVAVE-------TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRL 468

Query: 462 TKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAK 521
            K  V +R VF TTD ER+LT P GLQ+KID AV  +  GRSFVRASGTEDAVR+YAEA 
Sbjct: 469 AKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAA 528

Query: 522 TKAEVEALSKEVTQLVENS 540
           +  +VE LS  V +LV  S
Sbjct: 529 SLEDVEKLSNTVKELVVKS 547

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  514 bits (1324), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 266/526 (50%), Positives = 356/526 (67%), Gaps = 9/526 (1%)

Query: 22  YTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPS 81
           Y YGTAGFR+ A  L  V+F TG++A LRSL L G Y+GVM+TASHNPP+DNGVK+V+P 
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 82  GAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVGHDSRESSPY 141
           G ML   WE+ AT LAN AS G     +  L  ++ +L +D     R++V  DSR S P 
Sbjct: 81  GEMLAAEWEKHATALANCASQGQ-QELLDALHMLVDRLGLDLALRARVVVARDSRASGPQ 139

Query: 142 LMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQNDV-----VTEVDYYKFFSTSWNNL 195
           L++ L     + + + V++  ++TTPQLH+LT   N+      V E  YY  F  +   L
Sbjct: 140 LLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVAALEEL 199

Query: 196 FSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKHNVPQMLNVDCGA 255
            +L+    L F  L+VD ANGVG+++  +     P      +IIND  +  ++LN  CGA
Sbjct: 200 AALHGLETLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCGA 258

Query: 256 DFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVDNNKKFHLLDGDKISTILTKCL 314
           D+VKT Q LP GI  +     L+ S+DGDADR++FYY+D  ++FHLLDGDKIST++ K L
Sbjct: 259 DYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAKFL 318

Query: 315 ISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKHLHHIAESKFDIG 374
            S L  + + +D+ LGVVQTAYANGSST+Y+++ L+VPV CT TGVKHLH  A  K+D+G
Sbjct: 319 QSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYDVG 378

Query: 375 IYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLINQTVGDSMADLL 434
           IYFEANGHGTV+FS  F   +++A++N + S K   +  +L  F+ LINQT+GD++AD+L
Sbjct: 379 IYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIADML 438

Query: 435 AVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAA 494
           AVIA LSIL  SP DWD +Y DLPN L K  V +R +FKTT+ E++LTSP+GLQE ID  
Sbjct: 439 AVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDI 498

Query: 495 VSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540
           V  YDSGRSFVRASGTEDAVRIYAEA ++ + + L+ +V+ LV  S
Sbjct: 499 VMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86
           G  +GVMITASHNP  DNG K+   +G  +I
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQII 186

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 490 KIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQL 536
           K++ A   Y+S R  +R SGTE  +++Y EA +K+E  A   E+ QL
Sbjct: 566 KVNGA-KPYESVRFTIRGSGTEPKLKVYIEACSKSEERA--SELAQL 609

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86
           G  +GVMITASHNP  DNG K+   +G  +I
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDL--ANIASHGNFTAF 108
           +GVMITASHNP  DNG K+   +G  +I   +   +D   AN+    N   F
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANVWDF 202

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 21/131 (16%)

Query: 28  GFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAMLI- 86
           GF  +AS  D V+ T  +   +  L   G   G+MITASHNP  DNG K+   +G  +I 
Sbjct: 129 GFTEDASQ-DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIP 184

Query: 87  --------------ESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132
                         E W++ A D A + +    +  ++   +V+    +D T    L++ 
Sbjct: 185 PHDQRISQSILANLEPWDR-AWDCAAVKAEAVQSEMLIDAKKVLVDQYVD-TVRRSLVIT 242

Query: 133 HDSRESSPYLM 143
           + +   +P+ +
Sbjct: 243 NVNHTKAPWFV 253

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQ-----IATDLANIASHGNF 105
           +GVMITASHNP  DNG K+   +G  +I   +Q     I  +L   A+  NF
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANAWNF 202

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86
           IGVMITASHNP  DNG K+   +G  +I
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86
           G  +G+MITASHNP  DNG K+   +G  +I
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESW-----EQIATDLANIASHGNFT 106
           +GVMITASHNP  DNG K+   +G  +I        E I  +L   ++  NFT
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFT 200

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86
           IGVMITASHNP  DNG K+   +G  +I
Sbjct: 157 IGVMITASHNPEMDNGYKVYYNNGCQII 184

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 491 IDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEA 528
           I  ++ +  S R  +R SGTE  +++Y EA  K E EA
Sbjct: 565 IPTSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEA 602

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATD 95
           +GVMITASHNP  DNG K+   +G  +I   +   +D
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISD 187

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86
           G   GVMITASHNP  DNG K+   +G  +I
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86
           +GVM+TASHNP  DNG K+   +G  +I
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86
           +GVMITASHNP  DNG K+   +G  +I
Sbjct: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLIESWEQIATD 95
           +GVM+TASHNP  DNG K+   +G  +I   +   +D
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAISD 187

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86
           GVMITASHNP  DNG K+   +G  +I
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86
           GVMITASHNP  DNG K+   +G  +I
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86
           +GVMITASHNP  DNG K+   +G  +I
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 43  TGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAML 85
           T +V    S +  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 147 TPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 27  AGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86
           AGF+    T D     T +V    S++     +GVMITASHNP  DNG K+   +   +I
Sbjct: 123 AGFKVFYLTPDDQFVHTPLVPF--SVLNLKASVGVMITASHNPKMDNGYKVYYDNACQII 180

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 60  GVMITASHNPPQDNGVKIVEPSGAMLI 86
           G+MITASHNP  DNG K+   +G  +I
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>KLLA0B10582g Chr2 (924069..931958) [7890 bp, 2629 aa] {ON} similar
           to uniprot|Q06179 Saccharomyces cerevisiae YLR454W FMP27
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 2629

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 223 SKFLPYLPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI------VNPN 272
           SK +  + QL   + I  DKH + Q++ ++C  D + +   LPNG+      VNP+
Sbjct: 857 SKHIQTIKQLKKHSLISYDKHALLQLIELECSFDSINSTMLLPNGVRTKLELVNPS 912

>KNAG0F00450 Chr6 (60233..63955) [3723 bp, 1240 aa] {ON} Anc_1.79
           YNL273W
          Length = 1240

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 21/166 (12%)

Query: 291 YVDNNKKFHLLDGDKISTILT---KCLISMLRES------------ELLNDINLGVVQTA 335
           Y++  ++F  LD D+I  I++   +  +    ES            E+L+D   G+ + A
Sbjct: 664 YINFLQRFRELDDDQIKKIISFFHRVFVQAKEESFLFRFDLIVLLQEMLSDD--GLARNA 721

Query: 336 YANGSSTK---YITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFY 392
                  +   Y  + LK  ++   +   HL   A    +IG YF+  G    +  N FY
Sbjct: 722 RVRKHVDQFANYYLQRLKNRLKKFPSWAVHLLFPALHDMEIG-YFQKYGERKAMKKNNFY 780

Query: 393 EVLQKAIDNGSSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIA 438
                 I      E++    L    F  L++  + DS  DLL ++A
Sbjct: 781 GAPPSIIKPFPEQEQLPANVLKDMSFGVLVSTLIDDSKTDLLDLLA 826

>KLLA0F18128g Chr6 (1661367..1663535) [2169 bp, 722 aa] {ON} similar
           to uniprot|Q07825 Saccharomyces cerevisiae YLL029W
           Hypothetical ORF
          Length = 722

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 409 HKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLN 468
           HKA   L    K     +G+S   + +  +  +++   P + ++   D PN +  C    
Sbjct: 465 HKASQKLTEIRKTAKHYMGNSFCTISSTGSNAAVIHYEPPEENSSMID-PNKIYLCDSGA 523

Query: 469 RFVFKTTDMERKLTSPSGLQEKID 492
           +F+  TTD+ R L      QE+ID
Sbjct: 524 QFLEGTTDITRTLHFTEPTQEEID 547

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 339  GSSTKYITKSLKVPVECTKTGVKHLHHI-AESKFDIGI-YFEANGHGTVL--FSNKFYEV 394
            GS+   +T+++ + V CT  G K+LH I A++ F   + +FE    G VL  FSN  Y+V
Sbjct: 981  GSALSTLTQTIILWVYCTIHGSKYLHDIMADAIFKAPMTFFETTPIGRVLNRFSNDIYKV 1040

>KLLA0A09647g Chr1 complement(844245..846578) [2334 bp, 777 aa] {ON}
           highly similar to uniprot|P00958 Saccharomyces
           cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms
           a complex with glutamyl-tRNA synthetase (Gus1p) and
           Arc1p which increases the catalytic efficiency of both
           tRNA synthetases also has a role in nuclear export of
           tRNAs
          Length = 777

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 258 VKTNQKLPNGIVNPNPSDLYASFDGDADRIVFYYVDNNKKFHLLDGDKISTILTKCLISM 317
            K N  +P+  V+  P   YA    D D I+  YVDN +K HL  G +I+  L+      
Sbjct: 621 AKYNGVVPDFNVDNLPG--YAQLKKDIDEILTNYVDNMEKVHLRRGLEIAMTLSARGNQF 678

Query: 318 LRESELLNDI 327
           L++++L N +
Sbjct: 679 LQDNKLDNSL 688

>TPHA0E03720 Chr5 complement(786291..787241) [951 bp, 316 aa] {ON}
           Anc_1.39 YCL034W
          Length = 316

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 19/112 (16%)

Query: 379 ANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLF--YFSK---------------L 421
           AN      F+N F E ++   D  +SS   ++  + L+  + SK                
Sbjct: 110 ANSKKIKFFTNCFLEWIKFINDGKNSSSSTYRGLVELYRQFKSKSSGNRRVFDLQKESPK 169

Query: 422 INQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473
           I   VGDS++  +A+   L  LQL P     + +D  +L  KC  L R V K
Sbjct: 170 IRLLVGDSLSTSIALKNRL--LQLRPGQTSVDDKDSTDLFVKCRELRRAVLK 219

>TBLA0F01790 Chr6 complement(442568..445861) [3294 bp, 1097 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1097

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 65/139 (46%), Gaps = 16/139 (11%)

Query: 395 LQKAIDNGSSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEY 454
            + A+D+ + S  + K R SL YF + I + +  + ++L+      ++L + P ++  E 
Sbjct: 390 FKDALDSENVSLPLEKMRTSLRYFLREIVKDIDIAHSELVFQFFNTNVL-IDPRNFTQEI 448

Query: 455 Q---DLPNLLTKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTE 511
           +   +L NL+    ++N++ F+   +E+ L     LQ+ I          +S++      
Sbjct: 449 KKQINLRNLIDIEHLINQYKFQKMALEKSL----QLQDSIQTFKDNLLKDKSYINV---- 500

Query: 512 DAVRIYAEAKTKAEVEALS 530
               I+ E KTK  V  LS
Sbjct: 501 ----IFNEFKTKDSVSQLS 515

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,855,064
Number of extensions: 2628818
Number of successful extensions: 7750
Number of sequences better than 10.0: 58
Number of HSP's gapped: 7890
Number of HSP's successfully gapped: 60
Length of query: 540
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 426
Effective length of database: 40,409,475
Effective search space: 17214436350
Effective search space used: 17214436350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)