Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0L003206.9ON39139120800.0
TDEL0G046206.9ON39238511891e-162
KNAG0E009806.9ON41438511791e-160
NCAS0F001906.9ON41138511611e-158
ZYRO0F00462g6.9ON39339011431e-155
Skud_5.336.9ON40140211411e-155
SAKL0E00814g6.9ON39838711351e-154
Suva_5.126.9ON40140411211e-152
Smik_5.316.9ON42740411201e-151
Ecym_30126.9ON39738711101e-150
NDAI0K029006.9ON43840211081e-149
Kpol_1045.786.9ON39238211021e-149
YEL056W (HAT2)6.9ON40140410991e-148
TPHA0M001906.9ON39138210751e-145
KLLA0D00814g6.9ON40839310661e-143
KLTH0C11550g6.9ON39839410321e-138
ACR017W6.9ON42338510181e-136
Kwal_56.223456.9ON39638510061e-134
CAGL0B03575g6.9ON4193829981e-133
TBLA0A071206.9ON4074029791e-130
Skud_2.3218.548ON4224123317e-34
YBR195C (MSI1)8.548ON4224183301e-33
Smik_2.3358.548ON4224163272e-33
TBLA0H036508.548ON4194183177e-32
KAFR0I008408.548ON4134133132e-31
TDEL0B029808.548ON4124173105e-31
Suva_4.4498.548ON4244193071e-30
KLLA0E23541g8.548ON4174043053e-30
NDAI0C055108.548ON4194123036e-30
AEL250C8.548ON4174072912e-28
Kpol_1024.398.548ON4174112894e-28
ZYRO0A13068g8.548ON3974042877e-28
KNAG0A036708.548ON4264212887e-28
TPHA0L017208.548ON4194092878e-28
NCAS0B021708.548ON4144182861e-27
SAKL0H09900g8.548ON4254102833e-27
CAGL0M05291g8.548ON4194112772e-26
Ecym_70428.548ON4144102729e-26
KLTH0E12694g8.548ON4184152613e-24
Kwal_27.120708.548ON4184072552e-23
KAFR0A003802.401ON5164161881e-14
Suva_13.3112.401ON5104081853e-14
TPHA0G026502.401ON5164061764e-13
TDEL0G033402.401ON5144061748e-13
NDAI0H027502.401ON5124151721e-12
Skud_13.2912.401ON5092901721e-12
CAGL0K03861g2.401ON5134041702e-12
KNAG0E021802.401ON5174121675e-12
YMR131C (RRB1)2.401ON5112581667e-12
Sklu_YGOB_Anc_2.4012.401ON5202891667e-12
Smik_13.3292.401ON5092891659e-12
KLLA0F17237g2.401ON5234041651e-11
Kwal_47.178272.401ON5232881651e-11
KLTH0E09394g2.401ON5224051641e-11
Kpol_1041.202.401ON5152881632e-11
NCAS0F019702.401ON5112901622e-11
ADR242C2.401ON5214091604e-11
Skud_4.637.310ON12732141615e-11
TBLA0B092502.401ON5262871579e-11
ZYRO0A08690g2.401ON5162901561e-10
NCAS0E037507.310ON12762201571e-10
Ecym_60672.401ON5224071552e-10
KAFR0H033402.283ON3672071514e-10
Smik_4.457.310ON12702141535e-10
YDL195W (SEC31)7.310ON12732141517e-10
Suva_4.537.310ON12712141509e-10
KLLA0E08449g2.283ON4222041425e-09
ZYRO0F05808g7.310ON12822161446e-09
Kpol_1019.307.310ON12522221429e-09
KLTH0G10296g2.283ON4261961382e-08
Ecym_33212.283ON4092061382e-08
CAGL0G01628g2.283ON3761681363e-08
YNL035C2.283ON3891851345e-08
Kwal_27.115502.283ON4071831329e-08
Ecym_71055.201ON4842041321e-07
TPHA0C008608.316ON3782591302e-07
CAGL0D05588g5.201ON4771471302e-07
Suva_14.3112.283ON3891861292e-07
TBLA0B059202.283ON4031891283e-07
KLTH0B03410g5.201ON4771871283e-07
KNAG0B028007.310ON13072181284e-07
Skud_14.2982.283ON3891871264e-07
KLLA0E07965g2.663ON3901271257e-07
Kwal_33.151365.201ON4731231231e-06
Suva_10.3168.435ON8181751241e-06
TDEL0C023607.310ON12642151241e-06
KLLA0F15598g5.201ON4781471222e-06
AAL157C5.201ON4791471222e-06
AGR180W8.435ON8061031232e-06
KNAG0I009208.316ON3813311212e-06
SAKL0E07766g2.283ON3982171203e-06
NCAS0G011206.276ON4941691194e-06
Ecym_41348.435ON810971204e-06
NDAI0F012406.276ON5241711195e-06
CAGL0I03718g7.322ON12011221196e-06
Smik_14.2962.283ON3891861176e-06
Ecym_80617.310ON12282191187e-06
KNAG0B027207.322ON12041221188e-06
Smik_12.2798.435ON8172291188e-06
Kpol_1028.546.325ON9051851188e-06
KLLA0E04093g8.316ON3722911168e-06
ZYRO0A09636g8.435ON8081501179e-06
TPHA0E030805.201ON4881471161e-05
NCAS0B035508.316ON3752401151e-05
TBLA0C009902.663ON3931151151e-05
TPHA0P003308.67ON6431221161e-05
CAGL0F06853g2.663ON3881261141e-05
Skud_12.2858.435ON8171111152e-05
SAKL0H15708g8.316ON3683011142e-05
Ecym_20936.325ON9231811152e-05
Kpol_2002.995.201ON4871331142e-05
KAFR0L013207.310ON12402081152e-05
NDAI0J010408.316ON3982011142e-05
KLTH0G12430g8.316ON3672951132e-05
SAKL0H16390g8.288ON11401161142e-05
KAFR0L013907.322ON12061231142e-05
NCAS0D027305.201ON4751741132e-05
TPHA0G031002.469ON5092981132e-05
TBLA0F021407.310ON13002081143e-05
NDAI0C001702.663ON401711123e-05
TDEL0C022407.322ON12011321133e-05
NCAS0C039908.67ON7301111133e-05
Suva_10.645.201ON4902041123e-05
KNAG0I025406.325ON9181761133e-05
ZYRO0B10450g5.201ON4821231123e-05
TBLA0A039508.324ON9361211133e-05
KAFR0C031908.67ON6721171123e-05
SAKL0F10648g7.322ON12031681133e-05
KAFR0C038302.663ON3811211114e-05
Smik_12.525.201ON4891431114e-05
Kwal_26.77362.469ON5072241114e-05
TBLA0A023106.276ON531911115e-05
KLLA0F13244g8.435ON8142181115e-05
KAFR0J009805.201ON4801131105e-05
Suva_10.2228.324ON9431601115e-05
NCAS0G038702.283ON3891941095e-05
Kpol_1048.598.544ON8501301106e-05
KNAG0H020402.283ON3991871096e-05
AFL157C6.276ON4383121096e-05
TDEL0G021402.283ON3921231096e-05
TPHA0C033702.283ON4131841096e-05
NDAI0I004606.325ON9171791106e-05
TBLA0A038908.316ON3622411087e-05
KAFR0H022608.324ON9381611107e-05
YLL011W (SOF1)5.201ON4891431097e-05
ADR090W7.310ON12332021107e-05
Skud_4.1097.322ON12011101107e-05
TBLA0H020005.201ON4731961098e-05
YLR222C (UTP13)8.435ON8171051098e-05
SAKL0H07150g8.651ON4413601088e-05
ADL218C2.283ON4031741088e-05
Suva_4.997.322ON12011101099e-05
AER255C5.429ON4671191089e-05
SAKL0G19668g2.663ON3941331089e-05
NCAS0G036001.399ON327631079e-05
KNAG0M017505.201ON4851511089e-05
Smik_3.1576.325ON9241791099e-05
TDEL0A068906.276ON4472221081e-04
Skud_3.1336.325ON9161791091e-04
Smik_4.907.322ON12011101091e-04
KLLA0C08976g6.325ON9111781081e-04
Suva_2.5375.429ON455691081e-04
Suva_16.606.276ON526881081e-04
YDL145C (COP1)7.322ON12011101091e-04
Suva_3.936.325ON9201791081e-04
NCAS0D044806.325ON9151791081e-04
KLTH0H01892g7.322ON12091681081e-04
KNAG0J016808.672ON3981001071e-04
Kpol_1036.658.316ON3712891061e-04
Smik_5.200na 1ON3911641061e-04
NDAI0A020907.322ON12001221081e-04
TBLA0H002303.22ON13332471071e-04
KNAG0F038707.534ON4651931061e-04
CAGL0K09284g6.325ON9111801071e-04
NDAI0I021805.201ON4791981061e-04
KNAG0H001802.663ON3891201061e-04
CAGL0L03201g1.247ON5791511071e-04
Kwal_56.245267.322ON12101681071e-04
ZYRO0F11110g7.322ON12011321072e-04
TPHA0D045007.322ON12081721072e-04
Kpol_1003.342.283ON3881891062e-04
TPHA0C008108.324ON9371171072e-04
KAFR0B055808.288ON11202341072e-04
Ecym_80727.322ON12011221062e-04
TDEL0F045008.324ON9381601062e-04
KNAG0G024508.324ON9421171062e-04
Kwal_0.2121.399ON303851042e-04
NCAS0H035302.663ON384711042e-04
YCR057C (PWP2)6.325ON9231791052e-04
KAFR0H031401.399ON3032551032e-04
TDEL0E042805.201ON4811131043e-04
SAKL0G12892g5.201ON4761021043e-04
NCAS0C032608.324ON9831251053e-04
Kpol_1060.246.276ON4861761043e-04
NDAI0G006302.283ON3971931043e-04
ADR077C7.322ON12041221053e-04
NCAS0F033405.429ON448701043e-04
Smik_14.3221.399ON3032671033e-04
YNL006W (LST8)1.399ON3032671033e-04
ZYRO0A01804g2.283ON3761871033e-04
TDEL0D013101.247ON7091771043e-04
TBLA0F022307.322ON12161701053e-04
KAFR0J025506.325ON9061791043e-04
Skud_12.565.201ON4891431033e-04
KNAG0H016901.399ON3032591023e-04
TBLA0I022806.325ON9271791044e-04
TBLA0E007607.534ON3841071034e-04
KLLA0F05159g7.310ON12312131044e-04
TBLA0F024007.338ON298921024e-04
YLR129W (DIP2)8.324ON9431601044e-04
Kwal_56.238958.316ON3672971024e-04
TDEL0B075802.663ON3901321024e-04
KLLA0D16390g8.324ON9361361034e-04
TDEL0A074006.325ON9011781034e-04
Kpol_2001.657.322ON12061221035e-04
SAKL0A00660g6.363ON6602291035e-04
SAKL0H12760g8.435ON8411071035e-04
Smik_6.708.67ON7831181035e-04
NDAI0E034408.435ON8571911035e-04
CAGL0L02629g8.67ON7951301026e-04
Kpol_487.71.399ON3032101006e-04
TBLA0A018706.177ON1004611026e-04
Kpol_1011.68.67ON7621101026e-04
Kwal_27.115858.435ON8231511026e-04
AAR057W6.325ON9221841026e-04
Kpol_1058.318.67ON6751111017e-04
NCAS0A139407.322ON12051101027e-04
SAKL0B02244g8.67ON7731161018e-04
KLTH0H12122g1.399ON30364998e-04
ZYRO0F11484g7.338ON29492998e-04
Suva_16.1598.672ON451621008e-04
NDAI0G025808.324ON9581171018e-04
YJL112W (MDV1)1.247ON7141791018e-04
CAGL0B01529g8.316ON3692351008e-04
Kwal_56.243326.276ON4181861009e-04
KAFR0B057008.316ON3723011009e-04
CAGL0H00781g6.276ON5131781009e-04
KAFR0H024508.672ON4171171009e-04
Smik_12.1928.324ON9431171010.001
SAKL0F15972g7.534ON4701971000.001
TDEL0B020108.435ON8051011000.001
Ecym_42498.316ON374224990.001
Smik_4.3748.288ON11522401000.001
KLTH0G12276g8.324ON9371171000.001
KLLA0F04884g7.322ON12121221000.001
Kpol_1062.325.429ON466204990.001
KLLA0E21187g5.429ON429197990.001
Skud_16.4827.534ON465210990.001
Ecym_74032.469ON517223990.001
Skud_16.326.276ON522114990.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0L00320
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   805   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   462   e-162
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   458   e-160
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   451   e-158
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   444   e-155
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   444   e-155
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   441   e-154
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   436   e-152
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   436   e-151
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   432   e-150
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     431   e-149
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   429   e-149
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   427   e-148
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   418   e-145
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   415   e-143
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   402   e-138
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   396   e-136
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   392   e-134
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   389   e-133
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   381   e-130
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   132   7e-34
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   131   1e-33
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   130   2e-33
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   126   7e-32
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   125   2e-31
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   124   5e-31
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   122   1e-30
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   122   3e-30
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   121   6e-30
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   116   2e-28
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   115   4e-28
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   115   7e-28
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   115   7e-28
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   115   8e-28
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   114   1e-27
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   113   3e-27
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   111   2e-26
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   109   9e-26
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   105   3e-24
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   102   2e-23
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    77   1e-14
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    76   3e-14
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    72   4e-13
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    72   8e-13
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    71   1e-12
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    71   1e-12
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    70   2e-12
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    69   5e-12
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    69   7e-12
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    69   7e-12
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    68   9e-12
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    68   1e-11
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    68   1e-11
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    68   1e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    67   2e-11
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    67   2e-11
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    66   4e-11
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    67   5e-11
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    65   9e-11
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    65   1e-10
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    65   1e-10
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    64   2e-10
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    63   4e-10
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    64   5e-10
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    63   7e-10
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    62   9e-10
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    59   5e-09
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    60   6e-09
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    59   9e-09
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    58   2e-08
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    58   2e-08
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    57   3e-08
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    56   5e-08
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    55   9e-08
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    55   1e-07
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    55   2e-07
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    55   2e-07
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    54   2e-07
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    54   3e-07
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    54   3e-07
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    54   4e-07
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    53   4e-07
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    53   7e-07
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    52   1e-06
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    52   1e-06
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    52   1e-06
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    52   2e-06
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    52   2e-06
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    52   2e-06
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    51   2e-06
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    51   3e-06
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    50   4e-06
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    51   4e-06
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    50   5e-06
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    50   6e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    50   6e-06
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    50   7e-06
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    50   8e-06
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    50   8e-06
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    50   8e-06
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    49   8e-06
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    50   9e-06
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    49   1e-05
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    49   1e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    49   1e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    49   1e-05
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    49   1e-05
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    49   2e-05
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    49   2e-05
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    49   2e-05
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    49   2e-05
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    49   2e-05
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    49   2e-05
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    48   2e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    49   2e-05
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    49   2e-05
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     48   2e-05
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    48   2e-05
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    49   3e-05
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    48   3e-05
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    48   3e-05
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    48   3e-05
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    48   3e-05
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    48   3e-05
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    48   3e-05
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    48   3e-05
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    48   3e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    48   3e-05
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    47   4e-05
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    47   4e-05
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    47   4e-05
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    47   5e-05
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    47   5e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    47   5e-05
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    47   5e-05
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     47   5e-05
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    47   6e-05
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    47   6e-05
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    47   6e-05
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    47   6e-05
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    47   6e-05
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       47   6e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    46   7e-05
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    47   7e-05
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    47   7e-05
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    47   7e-05
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    47   7e-05
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    47   8e-05
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    47   8e-05
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    46   8e-05
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    46   8e-05
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    47   9e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    46   9e-05
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    46   9e-05
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    46   9e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    46   9e-05
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    47   9e-05
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    46   1e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    47   1e-04
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    47   1e-04
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    46   1e-04
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    46   1e-04
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    46   1e-04
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    47   1e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    46   1e-04
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    46   1e-04
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    46   1e-04
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    46   1e-04
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    45   1e-04
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    45   1e-04
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    46   1e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    46   1e-04
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    45   1e-04
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    46   1e-04
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    45   1e-04
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    45   1e-04
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    46   1e-04
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    46   1e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    46   2e-04
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    46   2e-04
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    45   2e-04
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    46   2e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    46   2e-04
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    45   2e-04
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    45   2e-04
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    45   2e-04
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    45   2e-04
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     45   2e-04
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    45   2e-04
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    44   2e-04
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    45   3e-04
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    45   3e-04
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    45   3e-04
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    45   3e-04
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    45   3e-04
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    45   3e-04
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    45   3e-04
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    44   3e-04
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    44   3e-04
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    44   3e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    45   3e-04
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    45   3e-04
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    45   3e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    44   3e-04
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    44   3e-04
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    45   4e-04
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               44   4e-04
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    45   4e-04
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    44   4e-04
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    45   4e-04
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    44   4e-04
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    44   4e-04
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    44   4e-04
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    44   4e-04
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    44   5e-04
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    44   5e-04
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    44   5e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   5e-04
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    44   5e-04
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    44   6e-04
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    43   6e-04
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    44   6e-04
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    44   6e-04
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    44   6e-04
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    44   6e-04
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    44   7e-04
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    44   7e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    44   8e-04
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    43   8e-04
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    43   8e-04
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    43   8e-04
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    44   8e-04
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    44   8e-04
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    43   8e-04
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    43   9e-04
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    43   9e-04
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    43   9e-04
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    43   9e-04
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    44   0.001
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    43   0.001
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    43   0.001
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    43   0.001
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    43   0.001
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    43   0.001
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    43   0.001
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    43   0.001
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    43   0.001
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    43   0.001
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    43   0.001
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    43   0.001
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    42   0.001
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    42   0.001
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    42   0.001
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    43   0.001
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     43   0.001
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    43   0.001
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    43   0.001
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    42   0.001
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    42   0.001
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    43   0.001
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    42   0.001
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    42   0.001
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    42   0.002
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    42   0.002
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    42   0.002
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    42   0.002
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    42   0.002
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    42   0.002
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      42   0.002
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      42   0.002
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    42   0.002
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    42   0.002
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    42   0.002
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    42   0.002
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    42   0.002
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    42   0.002
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    42   0.002
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    42   0.002
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    42   0.002
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.002
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    42   0.002
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    42   0.002
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    42   0.002
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    42   0.002
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    42   0.002
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      42   0.002
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    42   0.002
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    42   0.002
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    41   0.003
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    42   0.003
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    42   0.003
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.003
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    42   0.003
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    41   0.003
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    42   0.003
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.003
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    41   0.003
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    42   0.003
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    41   0.003
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    41   0.003
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    42   0.003
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    41   0.003
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    41   0.003
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    41   0.003
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    41   0.003
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    42   0.004
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    41   0.004
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    41   0.004
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    41   0.004
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    41   0.004
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    41   0.004
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    41   0.004
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    41   0.004
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    41   0.004
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    41   0.004
SAKL0H20922g Chr8 (1826071..1828179) [2109 bp, 702 aa] {ON} high...    41   0.004
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    41   0.004
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    41   0.004
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    41   0.004
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    41   0.004
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    41   0.004
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    41   0.004
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    41   0.004
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    40   0.005
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    41   0.005
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    41   0.005
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    41   0.005
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    41   0.005
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    40   0.005
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    41   0.006
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    40   0.006
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    40   0.006
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    40   0.006
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    41   0.006
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    40   0.006
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    40   0.007
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    40   0.007
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    40   0.007
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    40   0.007
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    40   0.007
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    40   0.007
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    40   0.007
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    40   0.008
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    40   0.008
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    40   0.008
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    40   0.008
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    40   0.008
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    40   0.008
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    40   0.008
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    40   0.008
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    40   0.008
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    40   0.008
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    40   0.008
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    40   0.009
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    40   0.009
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.009
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    40   0.010
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    40   0.010
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    40   0.010
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    40   0.010
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    40   0.010
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    40   0.010
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    39   0.010
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    40   0.011
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    40   0.011
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    40   0.011
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    39   0.011
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    39   0.012
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    40   0.012
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    40   0.012
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    40   0.013
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    40   0.013
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    40   0.013
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    40   0.013
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    40   0.013
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    39   0.013
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    40   0.013
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    40   0.013
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    40   0.014
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    39   0.014
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    40   0.014
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    39   0.014
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    39   0.015
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    39   0.015
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    39   0.015
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    39   0.015
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    39   0.015
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    39   0.016
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    39   0.017
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    39   0.017
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.017
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    39   0.018
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    39   0.018
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    39   0.018
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    39   0.018
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    39   0.018
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    39   0.019
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    39   0.019
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    39   0.019
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    39   0.020
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    39   0.020
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.020
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    39   0.021
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    39   0.021
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    39   0.021
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    39   0.022
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    39   0.023
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    39   0.023
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    39   0.024
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    39   0.024
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    38   0.024
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    39   0.025
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    39   0.025
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    39   0.026
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    38   0.027
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    39   0.027
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    38   0.028
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    39   0.029
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    38   0.029
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    39   0.029
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    38   0.029
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    39   0.030
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    38   0.031
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    38   0.031
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    38   0.033
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    39   0.033
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    38   0.034
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    38   0.035
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    38   0.036
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    38   0.036
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    38   0.036
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    38   0.037
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    38   0.037
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    38   0.038
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    38   0.039
SAKL0C09592g Chr3 (871039..872907) [1869 bp, 622 aa] {ON} weakly...    38   0.043
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    38   0.043
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    38   0.046
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    38   0.048
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    38   0.049
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    37   0.049
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    37   0.051
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    38   0.051
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    38   0.051
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    38   0.053
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    37   0.053
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    37   0.054
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    38   0.054
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    38   0.055
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    38   0.057
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    37   0.058
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     37   0.058
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    37   0.066
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    37   0.067
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    37   0.069
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    37   0.069
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    37   0.070
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    37   0.073
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    37   0.073
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    37   0.073
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    37   0.074
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    37   0.074
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    37   0.080
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    37   0.084
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    37   0.087
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    37   0.089
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    37   0.091
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    37   0.097
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    37   0.098
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    37   0.100
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    37   0.10 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    37   0.10 
ZYRO0G09372g Chr7 (747001..749052) [2052 bp, 683 aa] {ON} simila...    37   0.10 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    37   0.11 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    37   0.11 
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    37   0.11 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    37   0.11 
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    36   0.11 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    36   0.11 
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    37   0.11 
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    37   0.12 
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    37   0.12 
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    37   0.12 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    36   0.13 
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    36   0.13 
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    36   0.13 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    37   0.13 
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    36   0.13 
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    36   0.13 
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    36   0.13 
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    36   0.14 
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    36   0.14 
Ecym_1412 Chr1 (856549..858708) [2160 bp, 719 aa] {ON} similar t...    36   0.14 
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    36   0.14 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    36   0.14 
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    36   0.14 
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    36   0.14 
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    36   0.14 
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    36   0.15 
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    36   0.15 
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    36   0.15 
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    36   0.15 
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    36   0.15 
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    36   0.15 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    36   0.16 
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    36   0.16 
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    36   0.16 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    36   0.16 
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    36   0.16 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    36   0.16 
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    36   0.16 
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    36   0.16 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    36   0.16 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    36   0.16 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    36   0.16 
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    36   0.17 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    36   0.18 
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    36   0.18 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    36   0.19 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    36   0.19 
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    35   0.20 
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    36   0.20 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    36   0.20 
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    35   0.21 
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               36   0.21 
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    36   0.22 
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    35   0.22 
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    35   0.23 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.23 
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    35   0.24 
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    35   0.24 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    35   0.25 
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    35   0.25 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    35   0.25 
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    35   0.25 
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    35   0.26 
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    35   0.26 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    35   0.27 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    35   0.27 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    35   0.27 
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       35   0.27 
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    35   0.28 
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    35   0.28 
ZYRO0C14762g Chr3 complement(1148438..1149568) [1131 bp, 376 aa]...    35   0.29 
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    35   0.31 
KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {O...    35   0.31 
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    35   0.33 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   0.33 
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    35   0.33 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    35   0.34 
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    35   0.34 
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    35   0.34 
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    35   0.35 
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    35   0.35 
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    35   0.35 
CAGL0F03553g Chr6 complement(347237..347695) [459 bp, 152 aa] {O...    33   0.35 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    35   0.36 
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    35   0.36 
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    35   0.38 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    35   0.38 
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    35   0.39 
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    35   0.39 
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    35   0.40 
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    35   0.40 
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    35   0.41 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    35   0.42 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    35   0.43 
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    35   0.45 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     35   0.45 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    35   0.47 
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    34   0.48 
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    35   0.48 
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    35   0.48 
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    34   0.50 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    34   0.51 
Smik_7.332 Chr7 (556142..557641) [1500 bp, 499 aa] {ON} YFR021W ...    34   0.52 
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    34   0.54 
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    34   0.54 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     34   0.54 
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    34   0.54 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    34   0.54 
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    34   0.55 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    34   0.56 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    34   0.57 
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    34   0.58 
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    34   0.58 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    34   0.60 
NDAI0E02310 Chr5 (477468..478811) [1344 bp, 447 aa] {ON}               34   0.61 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    34   0.62 
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    34   0.63 
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    34   0.63 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    34   0.65 
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    34   0.70 
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    34   0.71 
Skud_2.366 Chr2 complement(654186..655340) [1155 bp, 384 aa] {ON...    34   0.73 
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    34   0.73 
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    34   0.73 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    34   0.74 
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      34   0.75 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    34   0.75 
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    33   0.76 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    34   0.79 
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    34   0.80 
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    34   0.81 
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    34   0.82 
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    34   0.82 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    34   0.83 
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    34   0.84 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    33   0.87 
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    33   0.89 
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    33   0.92 
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    33   0.94 
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    33   0.94 
Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W...    33   0.95 
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    33   0.95 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    33   0.96 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    33   0.96 
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    33   0.97 
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    33   0.98 
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    33   1.0  
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       33   1.0  
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    33   1.0  
TBLA0A01480 Chr1 (344851..346026) [1176 bp, 391 aa] {ON} Anc_6.1...    33   1.0  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    33   1.0  
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    33   1.1  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   1.1  
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    33   1.1  
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    33   1.1  
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    33   1.1  
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    33   1.1  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    33   1.1  
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    32   1.2  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    33   1.2  
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    33   1.2  
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     33   1.3  
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    33   1.3  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    33   1.3  
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    33   1.3  
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    33   1.4  
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    33   1.4  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    33   1.5  
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    33   1.5  
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    33   1.5  
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    33   1.5  
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    33   1.5  
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    33   1.5  
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    33   1.6  
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    33   1.6  
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    33   1.6  
KAFR0E02400 Chr5 (484885..488994) [4110 bp, 1369 aa] {ON} Anc_7....    33   1.6  
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    33   1.6  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    33   1.6  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    32   1.6  
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    33   1.7  
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    32   1.7  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    33   1.7  
Smik_2.377 Chr2 complement(671569..672723) [1155 bp, 384 aa] {ON...    33   1.7  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    33   1.7  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    33   1.7  
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    33   1.7  
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    33   1.7  
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     33   1.7  
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    33   1.7  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.7  
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    33   1.8  
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    33   1.9  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    32   1.9  
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    32   1.9  
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    33   1.9  
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    33   2.0  
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    32   2.0  
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    33   2.0  
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    33   2.0  
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    33   2.0  
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    32   2.0  
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    33   2.0  
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    32   2.1  
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    33   2.1  
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    32   2.2  
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    32   2.2  
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    32   2.2  
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    32   2.2  
KAFR0G01280 Chr7 (286915..288597) [1683 bp, 560 aa] {ON} Anc_3.9...    32   2.2  
NDAI0F02550 Chr6 complement(624662..628924) [4263 bp, 1420 aa] {...    32   2.3  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    32   2.4  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   2.4  
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    32   2.4  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    32   2.5  
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    32   2.5  
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    32   2.5  
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    32   2.5  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    32   2.6  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    32   2.6  
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    32   2.6  
Kwal_14.1675 s14 (419094..420215) [1122 bp, 373 aa] {ON} YBR234C...    32   2.7  
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    32   2.7  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    32   2.8  
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    32   2.8  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    32   2.8  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    32   2.8  
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    32   2.8  
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    32   2.8  
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    32   2.9  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    32   3.0  
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    32   3.1  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    32   3.1  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    32   3.2  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    32   3.2  
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    32   3.2  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    32   3.2  
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    32   3.3  
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    32   3.4  
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    32   3.4  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    32   3.4  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    32   3.4  
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    32   3.4  
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    32   3.4  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    32   3.5  
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    32   3.5  
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    32   3.5  
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    32   3.6  
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    32   3.8  
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    32   3.8  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   3.8  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    32   3.9  
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    32   3.9  
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    31   4.0  
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    32   4.0  
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    32   4.1  
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    31   4.2  
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    32   4.2  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    31   4.4  
NCAS0D03400 Chr4 complement(635698..636840) [1143 bp, 380 aa] {O...    31   4.5  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   4.5  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    31   4.6  
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    31   4.6  
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    31   4.7  
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    32   4.7  
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    31   4.8  
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    31   4.8  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    32   4.9  
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    31   5.0  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    31   5.0  
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    31   5.1  
AFR331C Chr6 complement(1036526..1038421) [1896 bp, 631 aa] {ON}...    31   5.2  
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    31   5.3  
YBR234C Chr2 complement(685438..686592) [1155 bp, 384 aa] {ON}  ...    31   5.3  
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    31   5.3  
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    31   5.3  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    31   5.3  
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    31   5.3  
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    31   5.3  
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    31   5.4  
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    31   5.4  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   5.7  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    31   5.7  
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    31   5.8  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    31   5.8  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    31   5.9  
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    31   6.2  
TPHA0J01960 Chr10 complement(442993..444126) [1134 bp, 377 aa] {...    31   6.4  
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    31   6.4  
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    31   6.4  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    31   6.5  
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    31   6.5  
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    31   6.6  
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    31   6.8  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    31   7.0  
AFL022W Chr6 (397359..398474) [1116 bp, 371 aa] {ON} Syntenic ho...    31   7.0  
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    31   7.1  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    31   7.1  
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    31   7.1  
Kwal_27.12634 s27 complement(1312252..1314114) [1863 bp, 620 aa]...    31   7.2  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    30   7.2  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    31   7.4  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    31   7.7  
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    31   7.9  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    30   8.0  
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    30   8.0  
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             31   8.1  
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    30   8.1  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    30   8.2  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    30   8.2  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    31   8.2  
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    30   8.7  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    30   9.1  
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    30   9.2  
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    30   9.4  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    30   9.6  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    30   9.6  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    30   9.7  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    30   9.7  
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    30   9.8  
Skud_7.450 Chr7 (746503..749331) [2829 bp, 942 aa] {ON} YGR140W ...    30   9.8  

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/391 (100%), Positives = 391/391 (100%)

Query: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60
           MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII
Sbjct: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60

Query: 61  GTHTSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDP 120
           GTHTSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDP
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDP 120

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD
Sbjct: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180

Query: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME 240
           INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME
Sbjct: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME 240

Query: 241 QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL 300
           QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL
Sbjct: 241 QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL 300

Query: 301 VSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAST 360
           VSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAST
Sbjct: 301 VSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAST 360

Query: 361 EEENIIQVWKSSSRLPRISNSKPFINYDLIN 391
           EEENIIQVWKSSSRLPRISNSKPFINYDLIN
Sbjct: 361 EEENIIQVWKSSSRLPRISNSKPFINYDLIN 391

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  462 bits (1189), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 294/385 (76%), Gaps = 8/385 (2%)

Query: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60
           M  ++ ++ LSIDEEY+LW+SNVPLMYDFVSET LTWP+LT+EWLP +  +   +QE+I+
Sbjct: 1   MAEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHS--NRQELIL 58

Query: 61  GTHTSDQEPNYVKIASIELPNEVI--DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQ 118
           GTHTS++EPNY+KIA+I+LP+E++        D   KSN++I KKFK E+E+TR+RYM Q
Sbjct: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQ 118

Query: 119 DPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176
           D N+I+TI+G+GTV ++DR  +  +  + +  +H+DNGYGLSFNP+ KG+LLS +DD  I
Sbjct: 119 DSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKI 178

Query: 177 AMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT- 235
           A++DI   S  PV TW+S     +ND KWH  +   FG+VSE+  TL ++D R KD VT 
Sbjct: 179 ALWDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSED-CTLQLHDQRVKDSVTD 237

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            I+    FN++AFSKHS NLF+AAGTD  +YLYD R T   LH+MSGHE  VTNLEF+ +
Sbjct: 238 KIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAA 297

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPW 355
            DGI++SS EDRR+I+WDLMEIG+EQV +DA D +PE++MIHAGHRS VNDFS+N +IPW
Sbjct: 298 KDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPW 357

Query: 356 LIASTEEENIIQVWKSSSRLPRISN 380
           L+AS EEENI+QVWK SS+LPR+  
Sbjct: 358 LMASAEEENIVQVWKCSSKLPRVGG 382

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/385 (55%), Positives = 290/385 (75%), Gaps = 5/385 (1%)

Query: 3   PQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGT 62
           P +E R L   EEY LWKSNVP+MYDFVSET+L WPSLTV+WLPH    P+T+QE+I+GT
Sbjct: 24  PSDENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGT 83

Query: 63  HTSDQEPNYVKIASIELPNEVIDPHNVSDA---PVKSNVRITKKFKLEKEITRSRYMVQD 119
           HTSD+E NY+KIA ++LP EV D  N++++    V+SN+R+T+KFK + E+TR+RYM QD
Sbjct: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143

Query: 120 PNIISTIDGNGTVSIFDR-NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           PNI++TI G GTV I+DR N  D+   T  YH DNGYGL+FNP+ KG LLS +DD  +A+
Sbjct: 144 PNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVAL 203

Query: 179 YDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIE 238
           +D+ ++  +PV+ W++  + I+ND +WH+F  +LFGTVSE+ ++L I+D R    V +I 
Sbjct: 204 WDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSED-SSLQIHDTRESKPVATIN 262

Query: 239 MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG 298
             +PFN+L+FS HS+NL +  G +  VYLYD R   + LH MSGH   VT+L+F    DG
Sbjct: 263 GTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDG 322

Query: 299 ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIA 358
           I++S+  D+R+IIWD+ +IG+EQV EDA+DAT E+MMIHAGHRS +NDF++N SIPWL+A
Sbjct: 323 IILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVA 382

Query: 359 STEEENIIQVWKSSSRLPRISNSKP 383
           S EEENI+Q+WK S +LPRIS + P
Sbjct: 383 SAEEENIVQLWKCSHKLPRISGTPP 407

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  451 bits (1161), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 296/385 (76%), Gaps = 13/385 (3%)

Query: 8   RELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHD--PQAPLTQQEMIIGTHTS 65
           +ELSIDEEY+LW+SNVPLMYDFVSET+LTWPSL++EWLP +   QAP  +QE+IIGTHTS
Sbjct: 20  KELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAP-NRQELIIGTHTS 78

Query: 66  DQEPNYVKIASIELPNEVI------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119
            +E NY+KIA+I+LPN++I      +     +   KSN++I KKFK E+EITR+RYM Q+
Sbjct: 79  GEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQN 138

Query: 120 PNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
            N+++TI+G+G V ++DR  +     V T+ YHK+NGYGLSFN    G+LLS +DDG IA
Sbjct: 139 SNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIA 198

Query: 178 MYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTS- 236
           ++++N  +  P+  W S  + I+ND KW +FD  +FG+VSE+ +TL ++D R KD  TS 
Sbjct: 199 LWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED-STLQLHDQREKDTFTSQ 257

Query: 237 IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSV 296
            +++ PFN+LAFSKHS+ LF+AAGTD +VYL+D R+  + LHSM+GH+G VTN+EF    
Sbjct: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317

Query: 297 DGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL 356
           DGIL++S EDRR IIWD+ +IG EQ+ +DA+D  PE++MIHAGHRS++NDFS+N +IPWL
Sbjct: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377

Query: 357 IASTEEENIIQVWKSSSRLPRISNS 381
           +AS+EEENIIQVWK S +LPR+  +
Sbjct: 378 MASSEEENIIQVWKCSHKLPRVGGT 402

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  444 bits (1143), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 294/390 (75%), Gaps = 11/390 (2%)

Query: 7   ERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSD 66
           E+ LSIDEEY LWKSNVPLMYDFVSET LTWPSLT+EWLP    +   +QEMI+GTHTSD
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS--NRQEMILGTHTSD 65

Query: 67  QEPNYVKIASIELPNEVI---DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII 123
           +E NY+KIA+I LP+EV+   +P    +  +KSNV+I KKF+ E E+TR+RYM QD N+I
Sbjct: 66  EEQNYLKIAAIYLPDEVVPDAEPKEEEEV-LKSNVKIIKKFEHENEVTRARYMPQDDNLI 124

Query: 124 STIDGNGTVSIFDR-NSSDSPV-KTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI 181
           +TI G GT+ +++R N  +S +  T+ +H +NGYGLSFNP  KG+LLS +DD  I ++D+
Sbjct: 125 ATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV 184

Query: 182 NAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-VTSIEME 240
             +S++P+ T+    + I+ND KWH+FD  +FG+VSE+ +TL ++D R +D  V  ++ +
Sbjct: 185 TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED-STLQLHDQRIRDAAVEKVQAK 243

Query: 241 QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL 300
           +P+N+LAFS HS NLF+AAGTD  VYLYD R   K LH M GHE  VT+LEFH   DG+L
Sbjct: 244 KPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVL 303

Query: 301 VSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAST 360
           +S+  DRR I+WDL EIG+EQV +DA D +PE+MMIHAGHRSS+NDFS+N +IPWL A+ 
Sbjct: 304 ISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATA 363

Query: 361 EEENIIQVWKSSSRLPRISNSKPFINYDLI 390
           EEENI+QVWK SS+LPRI  + P ++  L+
Sbjct: 364 EEENIVQVWKPSSKLPRIGGT-PSVDTQLL 392

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  444 bits (1141), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/402 (54%), Positives = 290/402 (72%), Gaps = 20/402 (4%)

Query: 6   EERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMIIGT 62
           +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP     P+    +QE+IIGT
Sbjct: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGT 63

Query: 63  HTSDQEPNYVKIASIELPNEVIDPHN----------VSDAPVKSNVRITKKFKLEKEITR 112
           HTS +E NY+K A I LP EV++  N           S  P +SN+RIT K++ E+EITR
Sbjct: 64  HTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITR 123

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAAD 172
           +RYM QDPN+++TI+G GTV ++ R  SD    T  +HKDNGY LSF+P+ KG LLS +D
Sbjct: 124 ARYMPQDPNMVATINGQGTVFLYSR--SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181

Query: 173 DGYIAMYDINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           D  +A++D++  S+   P+ TW    + I+ND KWH+F+  LFGTVSE+ + L I D+R 
Sbjct: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDIRA 240

Query: 231 KDK-VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           ++  + + +  QPFN+LAFS HS N+ +AAG D +VYLYDLRN ++ LH MSGHE  VTN
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSL 349
           LEF   VDG++VSS  D R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGHRS+VNDF L
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 350 NSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN 391
           N+ +PWLIASTEEENI+QVWK S  LP I    P IN D++ 
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLP-IVGGLPKINKDIVG 401

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 285/387 (73%), Gaps = 16/387 (4%)

Query: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60
           M  +EE + LSI+EEY+LWK+NVPLMYDFVSETKLTWPSLT++WLP +  +  T+QEMI+
Sbjct: 1   MSIEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSS--TKQEMIL 58

Query: 61  GTHTSDQEPNYVKIASIELPNEVIDPH----------NVSDAPVKSNVRITKKFKLEKEI 110
           GTHTS ++ NY+KIASIELP +++                   V+S ++ITKK K E+EI
Sbjct: 59  GTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEI 118

Query: 111 TRSRYMVQDPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLL 168
           TR+R+M QDPN I+TI+G G V +FDR  + +++ V  +++HKDNGYGLSFNP +KG+LL
Sbjct: 119 TRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELL 178

Query: 169 SAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDL 228
           S +DDG IA++++   +  P +   +T   I+ND  WH F+  LFG+VSE+K TL I+D 
Sbjct: 179 SCSDDGTIALWNVMGTNTSPSKA-VTTHEDIVNDCTWHEFNENLFGSVSEDK-TLQIHDK 236

Query: 229 RTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVT 288
           RT   V  + +  PFN+L FSKHS+NLF+AAGTD  VYLYDLRNT   LH+MSGHE  VT
Sbjct: 237 RTNSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVT 296

Query: 289 NLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFS 348
           +LEF    DGIL SS  DRR+++WDLM+IGSEQ  EDA D  PELMM+HAGH+S+VNDFS
Sbjct: 297 SLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFS 356

Query: 349 LNSSIPWLIASTEEENIIQVWKSSSRL 375
            N +IPWL+AS EE+NI+ VWK S +L
Sbjct: 357 FNWNIPWLMASVEEDNIVHVWKVSKKL 383

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  436 bits (1121), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/404 (53%), Positives = 292/404 (72%), Gaps = 20/404 (4%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMII 60
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP    +P+    +QE+II
Sbjct: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61

Query: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHN-------VSDAPVKSNVRITKKFKLEKEI 110
           GTHTS +E NY+K A I LP E++   DP         VS    +SN++IT K+K E+EI
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121

Query: 111 TRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSA 170
           TR+RYM Q+P  ++TI+G GTV I+ R  S+    T  +H++NGY LSF+P+ +G LLS 
Sbjct: 122 TRARYMPQNPGTVATINGQGTVFIYSR--SEGLQSTLKFHEENGYALSFSPLVEGLLLSG 179

Query: 171 ADDGYIAMYDINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDL 228
           +DD  +A++D+N  S+   P+ TW    + I+ND KWH+F+  LFGTVSE+ + L I DL
Sbjct: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDL 238

Query: 229 RTKDKVT-SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPV 287
           R ++  T + +  +PFN+LAFS HS NL +AAGTD +VYLYDLRN ++ LH MSGHE  V
Sbjct: 239 RVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAV 298

Query: 288 TNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDF 347
           TNLEF   VDG++VSS  D R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGH+S+VNDF
Sbjct: 299 TNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDF 358

Query: 348 SLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN 391
            LN+ IPWL+ASTEEENI+QVWK S  LP +    P ++ D+I+
Sbjct: 359 DLNAQIPWLVASTEEENILQVWKCSHSLP-VVGGPPKVSMDMIS 401

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  436 bits (1120), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 218/404 (53%), Positives = 291/404 (72%), Gaps = 22/404 (5%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMII 60
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSL+V+WLP    + +    +QE+II
Sbjct: 28  ETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII 87

Query: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHNVSD--------APVKSNVRITKKFKLEKE 109
           GTHTS +E NY+K A I +P E++   DP   ++        AP KSN+RIT K+  E+E
Sbjct: 88  GTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAP-KSNIRITAKYVHEEE 146

Query: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLS 169
           ITR+RYM Q+P+ ++T++G GTV ++ R  S     T  +HKDNGY LSFN + +GQLLS
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYSR--SGGLQSTLKFHKDNGYALSFNALVEGQLLS 204

Query: 170 AADDGYIAMYDI--NAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYD 227
            +DD  +A++++  N+ S  PV TW    + I+NDIKWH+F+  LFGTVSE+ + L I D
Sbjct: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED-SLLKIND 263

Query: 228 LRTKD-KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGP 286
           +R  +  + +++  QPFN+LAFS HS NL +AAG D +VYLYDLRN R+ LH MSGHE  
Sbjct: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323

Query: 287 VTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND 346
           VTN+EF   VDG++VSS  D R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGHRSSVND
Sbjct: 324 VTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383

Query: 347 FSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390
           F LN+ IPWL+AS+EEENI+QVWK S  LP I    P +N D+I
Sbjct: 384 FDLNAQIPWLVASSEEENILQVWKCSHNLP-IVGGPPKVNKDII 426

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 284/387 (73%), Gaps = 13/387 (3%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPH-DPQAPLTQQEMIIGT 62
           + +E  L++D+EY+LWKSNV LMYDFVSETKLTWPSL+++WLP  D   PL QQEMI+GT
Sbjct: 8   EHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGT 67

Query: 63  HTSDQEPNYVKIASIELPNEVI---DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119
           HTS  E NY+KIA+I+LP EV+   D  N S+ PVKS +++TKKF+ E E+ R+RYM ++
Sbjct: 68  HTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE-PVKSMIKVTKKFEHEDEVIRARYMPKN 126

Query: 120 PNIISTIDGNGTVSIFDRNSSDSP--VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
             II+TI+G G + I+DR+ S S    KT SYHKDNGYGL+FNP  +G+LLSA+DD  +A
Sbjct: 127 DKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVA 186

Query: 178 MYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT-KDKVTS 236
           ++DIN+           TD  I+ND KWH FD  +FGTVSE+K TL ++D R+  +    
Sbjct: 187 LWDINSTDRPVSIVMNHTD--IVNDSKWHEFDENIFGTVSEDK-TLQVHDKRSLSNSAQV 243

Query: 237 IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSV 296
           + +E+P N+LAFSKHSKNL +AAGTD  VYLYDLR   + LH+M+GH+  VT++EF    
Sbjct: 244 LPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHK 303

Query: 297 DGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL 356
           DGIL SS  DRR+ IWDL +IG+EQ  EDA D  PELMM+HAGHRS++NDFS N  +PWL
Sbjct: 304 DGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWL 363

Query: 357 IASTEEENIIQVWKSSSRLPRISNSKP 383
           IAS EE+N++QVWK S +L  +SN  P
Sbjct: 364 IASAEEDNVVQVWKISKKL--VSNIIP 388

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  431 bits (1108), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 293/402 (72%), Gaps = 23/402 (5%)

Query: 2   GPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP--HDPQAPLTQQEMI 59
           G  +E +EL+IDEEY LWKSNVPLMYDFVSETKLTWP+LTVEWLP  H       +QE+I
Sbjct: 29  GNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELI 88

Query: 60  IGTHTSDQEPNYVKIASIELPNEVIDPHNVS--------------DAPVKSNVRITKKFK 105
           +GTHTS +E NY+KIA+I+LP+EV+ P   S                  +SN++I KKFK
Sbjct: 89  LGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFK 148

Query: 106 LEKEITRSRYMVQDPNIISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPIS 163
            E+EITR+R+M Q+ +II+TI+G+GTV I+++  +   + + T  +HK+NGYGLSFNP  
Sbjct: 149 HEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPND 208

Query: 164 KGQLLSAADDGYIAMYDINAES---EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEK 220
           KG+LLS +DDG IA++DI   S   + P++ W S  N I+ND KW+ F++ +F +VSE+ 
Sbjct: 209 KGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED- 267

Query: 221 NTLSIYDLRTKDKV-TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
           +TL ++D R ++ +  SI+   PFN+LAFSKHS+ L +AAGTD  VYLYD RN    L+S
Sbjct: 268 STLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYS 327

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAG 339
           M+GHE  +TNLEF    DG+L+SS  DRR+I+WD+ +IG+EQ+ +DA+D  PE++MIHAG
Sbjct: 328 MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAG 387

Query: 340 HRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNS 381
           HRS+VNDFS+N +IPWL+AS EEENIIQVWK S +LP +  +
Sbjct: 388 HRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGT 429

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  429 bits (1102), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/382 (53%), Positives = 283/382 (74%), Gaps = 7/382 (1%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTH 63
           +E+E  L++D+EY+LWK+NVPLMYDFVSET+LTWPSLT +WLP   +   T+Q MI+GTH
Sbjct: 5   REQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED--TRQYMILGTH 62

Query: 64  TSDQEPNYVKIASIELPNEVIDPH-NVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNI 122
           TS +E +Y+K+A+++LP+EV+    N  +   KSN++I KKF+ + EI R+RYM +D NI
Sbjct: 63  TSGEEVDYLKVAALDLPDEVVTGEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNI 122

Query: 123 ISTIDGNGTVSIFDRNSS--DSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           I+TI+G G VSI+DR+ S  D    T  YHK+NGYGLSFNP    +L+S +DD  IA++D
Sbjct: 123 IATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWD 182

Query: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV-TSIEM 239
           I++ S+ P   W +  + I+ND  WHHFD  LFG+VSE+ +TL ++D R+  KV  +I+ 
Sbjct: 183 IDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED-STLKLHDKRSTSKVINTIQA 241

Query: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI 299
           +  FN+LAFSKHS NLF+AAG D N+YLYD R T K LH M+GHE  +T L+FH   DGI
Sbjct: 242 KAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGI 301

Query: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
           LVS   DRR+I+WDL EIG+EQ  ++A D +PE++MIHAGHRS++NDF+L+ +IPWL AS
Sbjct: 302 LVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSAS 361

Query: 360 TEEENIIQVWKSSSRLPRISNS 381
            EE+N++QVWK S  L R+  +
Sbjct: 362 VEEDNVVQVWKCSKNLSRVGGT 383

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 286/404 (70%), Gaps = 22/404 (5%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQ---APLTQQEMII 60
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP   Q       +QE+II
Sbjct: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61

Query: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHNVSD--------APVKSNVRITKKFKLEKE 109
           GTHTS +E NY+K A I LP E++   DP   +         AP +SN+RIT K++ E+E
Sbjct: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAP-RSNIRITAKYEHEEE 120

Query: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLS 169
           ITR+RYM QDPNI++TI+G GTV ++ R  S+    T  +HKDNGY LSF+ + KG+LLS
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSR--SEGLQSTLKFHKDNGYALSFSTLVKGRLLS 178

Query: 170 AADDGYIAMYDINAESE--DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYD 227
            +DD  +A++++ +  +   PV TW    + IIND KWH+F+  LFGTVSE+ + L I D
Sbjct: 179 GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSED-SLLKIND 237

Query: 228 LRTKDK-VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGP 286
           +R  +  + +++  QPFN+LAFS HS NL +AAG D  VYLYDLRN ++ LH MSGHE  
Sbjct: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297

Query: 287 VTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND 346
           V NLEF   VDG++VSS  D R+++WDL +IG+EQ  +DA+D  PEL+M+HAGHRSSVND
Sbjct: 298 VNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357

Query: 347 FSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390
           F LN  IPWL+AS EEENI+QVWK S  LP I    P +N D+I
Sbjct: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLP-IVGGPPKVNKDII 400

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  418 bits (1075), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 203/382 (53%), Positives = 285/382 (74%), Gaps = 8/382 (2%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTH 63
           +++E  L++D+EY LWKSNVPL+YDFVSET+LTWPSLT++WLP D  +  T+Q +I+GT 
Sbjct: 5   EQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTS--TRQHLILGTL 62

Query: 64  TSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII 123
           TS  E +Y+KIA+++LP+E+I     SD  VKSN+++ KKF  + EI R+RYM Q+ NII
Sbjct: 63  TSGAETDYLKIAALDLPDEIIIGKK-SDKVVKSNLKVVKKFAHDGEINRARYMPQNTNII 121

Query: 124 STIDGNGTVSIFD--RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD- 180
           +T++G GT+ I+D  R+   + + T  YHKDN YGL+FNP ++G+L+S +DD  IA++D 
Sbjct: 122 ATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDA 181

Query: 181 INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV-TSIEM 239
            N + + P++ W ++ + I+ND +WH F+  +FG+VSE+ +TL ++D R   K    I  
Sbjct: 182 TNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED-STLQLFDKRNGGKSDVKISS 240

Query: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI 299
           +  +NS+AFS  S+NLF+AAGT  N+YLYD+RNT K LHSM+GHE PVT+LEF +  DGI
Sbjct: 241 KGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGI 300

Query: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
           L+S S DRR+I+WDL EIG+EQ  ++A D  PE+MMIHAG RS++ND S + SIPWL AS
Sbjct: 301 LISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNAS 360

Query: 360 TEEENIIQVWKSSSRLPRISNS 381
            EE NI+QVWK SS+LPRIS +
Sbjct: 361 VEENNIVQVWKCSSKLPRISGT 382

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  415 bits (1066), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 209/393 (53%), Positives = 283/393 (72%), Gaps = 22/393 (5%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQ------APLTQQE 57
           +E E+  +I+EEY LW SNVP+MYDFVSET+LTWPSLTV+WLP + Q        L +QE
Sbjct: 5   EEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQE 64

Query: 58  MIIGTHTSDQEPNYVKIASIELPNEVIDPH-NVSD-------APVKSNVRITKKFKLEKE 109
           ++IGT T+D EPNY+KIA+I+LP  V     +VSD       +  +S ++I +KFK E+E
Sbjct: 65  LLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQE 124

Query: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSD---SPVKTYSYHKDNGYGLSFNPISKGQ 166
           +TR+RYM Q PNII+T++G G V IFDRN  +     + ++SYHK+NGYGL+FNP   GQ
Sbjct: 125 VTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQ 184

Query: 167 LLSAADDGYIAMYDINAES-EDPVETWQ-STDNCIINDIKWHHFDATLFGTVSEEKNTLS 224
           LLSA+DDG +A++D+ + + + P +T+   TD  I+ND KWH F ++LFGTVSE+ NTL 
Sbjct: 185 LLSASDDGTVALWDVTSTANKSPSQTFDVHTD--IVNDCKWHEFQSSLFGTVSED-NTLI 241

Query: 225 IYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHE 284
           I+D  +   +  + +   FN+LAFSK S+NL +AAGTD NVYLYDLR  +K LHSM+GHE
Sbjct: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301

Query: 285 GPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSV 344
             VT+LEF    DG+L SS  DRRII+WDL  IG+EQ  +DA D  PEL M+H GHRS V
Sbjct: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361

Query: 345 NDFSLNSSIPWLIASTEEENIIQVWKSSSRLPR 377
           N+FS NS++PWL+ S EEEN++Q+WK ++++ R
Sbjct: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVR 394

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  402 bits (1032), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 204/394 (51%), Positives = 277/394 (70%), Gaps = 21/394 (5%)

Query: 7   ERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSD 66
           E E+S+DEEY LWKSNVPLMYDFVSETKL WPSLT++WLP + ++   +QE+I+GTHTS 
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS--NEQELILGTHTSG 64

Query: 67  QEPNYVKIASIELPNEVI----------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYM 116
            E NY+KIAS+ LP+EV+          D    S    +S ++I +KF+   E+TR+RY 
Sbjct: 65  TEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYA 124

Query: 117 VQDPNIISTIDGNGTVSIFDRNS-SDSPVKT-YSYHKDNGYGLSFNPISKGQLLSAADDG 174
             +PN+I+TI G+G V ++DR+  SDS +   +S+HK+NGYGL+F+ IS G+LLS +DDG
Sbjct: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184

Query: 175 YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV 234
            IA++D+ +    PV+   ++ N I+N+ KWH     LFG+VS++ +TL I+D R    V
Sbjct: 185 SIAIWDVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDD-STLIIHDKRIDKPV 242

Query: 235 TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHD 294
             I   +P+N+LAFSKHS NLF+AAGTD  V LYDLR     +HSMSGH   VT+LEF  
Sbjct: 243 VKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAP 302

Query: 295 SVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIP 354
             DGIL S S DRR++IWDL +IG+EQ  EDA D  PEL+M+HAGH+S VNDFS + +IP
Sbjct: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIP 362

Query: 355 WLIASTEEENIIQVWKSSSRLPRISNSKPFINYD 388
           WL+AS EEEN++Q+WK+S +L     + P+I  D
Sbjct: 363 WLMASVEEENVVQIWKASKKL-----TSPYIPRD 391

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  396 bits (1018), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 274/385 (71%), Gaps = 13/385 (3%)

Query: 8   RELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQ 67
           + L+++EEY+LW SNVP+MY+FVSETKLTWPSLT++WLP D Q+P  +Q +I GTHT+ +
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP--EQSLIFGTHTAGE 97

Query: 68  EPNYVKIASIELPNEV--IDPHNVSD-APVKSNVRITKKFKLEKEITRSRYMVQDPNIIS 124
           E NY+K+A+I LP  +  +D  +  D A   S+  I  KF   +E+ R+RYM  + NII+
Sbjct: 98  EVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIA 157

Query: 125 TIDGNGTVSIFDRN--SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN 182
           TI+G GT+SIFDR    S + V T ++HK+NGYGL+FNP   G+LLS +DD  +A++DI 
Sbjct: 158 TINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIE 217

Query: 183 AESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTK-DKVTSIEMEQ 241
           A ++ P     S D+ I+ND+KWH F++ +FGTVSE+K TL ++D R + + V  +    
Sbjct: 218 A-AKKPKSILTSHDD-IVNDVKWHEFESNVFGTVSEDK-TLQVHDKRVRLEPVKKLPTAS 274

Query: 242 PFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILV 301
           PFN+L+FSKHS+NL +AAG D  +YLYD+R+    LH MSGH+  VT +EF    DGI+ 
Sbjct: 275 PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC 334

Query: 302 SSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
           SS  DRR IIWDL +IG+EQ  +DA D  PELMM+HAGHRS VN+FS N  IPWL+ASTE
Sbjct: 335 SSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTE 394

Query: 362 EENIIQVWKSSSRLPRISNSKPFIN 386
           E+N+IQ WK S +L  ++ S P I+
Sbjct: 395 EDNVIQAWKVSMKL--VNASPPAIS 417

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  392 bits (1006), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 272/385 (70%), Gaps = 14/385 (3%)

Query: 1   MGPQEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMII 60
           M   E ERELSID+EY LWKSNVPLMYDFVSET+L WPSLT++WLP    +  T+QE+++
Sbjct: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS--TEQELLV 58

Query: 61  GTHTSDQEPNYVKIASIELPNEVI--------DPHNVSDAPVKSNVRITKKFKLEKEITR 112
           GTHTSD E NY+KIA I LP E++        + +N SD  V S ++I KKFK E E+TR
Sbjct: 59  GTHTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTR 118

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPV--KTYSYHKDNGYGLSFNPISKGQLLSA 170
           +RY   D N+I+TI G GTV ++DR   D       Y+YHK+NGYGL+F+  S G+L+S 
Sbjct: 119 ARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISC 178

Query: 171 ADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           +DDG IA++DI +    P     S  + I+N+ KWH  D  ++G+VSE+ + L I+D R+
Sbjct: 179 SDDGSIAIWDIKSGKTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSED-SFLMIHDKRS 236

Query: 231 KDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNL 290
           +  +  +  ++PFN++AFSKHS NLF+AAGTD  VYL+D R   + LHSMSGH+  VT+L
Sbjct: 237 EKPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSL 296

Query: 291 EFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLN 350
           EF    DGIL S   DRR+++WDL +IG+EQ  EDA D  PEL+M+HAGH+S++NDFS +
Sbjct: 297 EFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFS 356

Query: 351 SSIPWLIASTEEENIIQVWKSSSRL 375
            ++PWL+AS EEENI+Q+WK S +L
Sbjct: 357 PNVPWLMASVEEENIVQIWKPSRKL 381

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  389 bits (998), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 274/382 (71%), Gaps = 13/382 (3%)

Query: 10  LSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPH-DPQAPLTQQEMIIGTHTSDQE 68
           +++DEEY+LWKSNVP++YDFVSET+LTWP+LTVEWLP  +  A  T+Q++I+GTHTS +E
Sbjct: 28  MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGEE 87

Query: 69  PNYVKIASIELPNEVID-------PHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPN 121
            NY+KI +++LP EV +            +  V SNV+I KKF  + EITR+RYM QD N
Sbjct: 88  QNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQDDN 147

Query: 122 IISTIDGNGTVSIFDR--NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMY 179
           II+TI+G G + I+DR  N  ++ + T  YH +NGYGL+FN   K  LLS +DD  IA++
Sbjct: 148 IIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALW 207

Query: 180 DINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI 237
           DI+   ++  P  T++     IIND+KWH  +A +FG+VSE+ +T+ ++D R+   + +I
Sbjct: 208 DISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED-STMKLFDKRSSQIIHNI 266

Query: 238 EMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVD 297
             ++P+N+LAFS  S NLF+AAGTD  VYLYD+R+    L++M+GHE  VT +EF  + D
Sbjct: 267 NTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNND 326

Query: 298 GILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLI 357
           GIL SS  DRR I+WDL EIG+EQ  ++ +D  PE++MIHAGH++S+ND ++N +I WL+
Sbjct: 327 GILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLV 386

Query: 358 ASTEEENIIQVWKSSSRLPRIS 379
           AS EE+NI+Q+WK SS +PRI 
Sbjct: 387 ASAEEDNIVQIWKCSSNIPRIG 408

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  381 bits (979), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 281/402 (69%), Gaps = 24/402 (5%)

Query: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQA--PLTQQEMIIG 61
           +EEE  L+ D+EY+LWKSNVPL+YDFVSETKL WPSLTVEWLP +     P  +Q +++G
Sbjct: 14  KEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLG 73

Query: 62  THTSDQEPNYVKIASIELPNEVID--PHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119
           THTS +E NY+KIA I LP+++I+    + SD  VKSN+RI KKFK E E+TR+ YM QD
Sbjct: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQD 133

Query: 120 PNIISTIDGNGTVSIFD----RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGY 175
             II+TI+G+GTV I+D     N S+  +   S+HK+NGYGL+FNP+ KG+LLS++DDG 
Sbjct: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKD--- 232
           +A ++I  +   P+ T Q T   IIND++W+ F+  LFG V+E  + L++ D+R  +   
Sbjct: 194 VAYWNI--QKSIPLLTLQET--SIINDVRWNQFNQNLFGYVTE-SSCLNLKDVRNNNNDL 248

Query: 233 KVTS---IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           K+ S   I+    FN++AFS HS+ L +A+G D  +YLYD RN  + LH M GHE  VT+
Sbjct: 249 KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTS 308

Query: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDA-TPELMMIHAGHRSSVNDFS 348
           L+FH   DGI++S   D+R+ +WDL +IG EQ +++ +D   PEL+MIHAGHRS +NDFS
Sbjct: 309 LDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFS 368

Query: 349 LNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390
           +++++ WL AS EE+NI+QVWK ++ L       P +N ++I
Sbjct: 369 MSNNLNWLCASIEEDNIVQVWKMNNSL----REDPLVNMNVI 406

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  132 bits (331), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 105/412 (25%), Positives = 178/412 (43%), Gaps = 70/412 (16%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + E Y  WK N  L+YD+++     WPSLT ++ P D    L +  +++ + TS Q+P  
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTLNEHRILLSSFTSSQKPED 77

Query: 70  -----------NYVKIASI---ELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRY 115
                       ++K AS+   ++      P N +  P K  V   + F    E  R+RY
Sbjct: 78  ETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARY 137

Query: 116 MVQDPNIISTIDGNGTVSIFDRNSSDSP------------VKTYSYHK------------ 151
           + Q+P+II+    +G + IFDR    S             +K    H             
Sbjct: 138 LPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSL 197

Query: 152 ---DNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED------PVETWQSTDNCIIND 202
              +    L++N   +  LLS+  +G I ++DI   S D      P+ +  S D   +ND
Sbjct: 198 VDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDS-DGSSVND 256

Query: 203 IKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME---QPFNSLAFSKHSKNLFSAA 259
           + W     +LF   +E +N +S+ DLRTK +      +      NS  F+  +  + ++A
Sbjct: 257 VTWMPTHDSLFAACTE-RNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILASA 315

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEIG 318
            ++  + L+D+RN  +   +   H   V+ LE+  + D +L ++  ED  + +WD     
Sbjct: 316 DSNGRLNLWDIRNMNENPIATMEHGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR-- 373

Query: 319 SEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWK 370
                        E +  H GH   VND S +   PWL+ S   +N + +WK
Sbjct: 374 ------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  131 bits (330), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/418 (24%), Positives = 183/418 (43%), Gaps = 68/418 (16%)

Query: 10  LSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP 69
           + + E Y  WK N  L+YD+++     WPSLT ++ P D      +  +++ + TS Q+P
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTSDEHRILLSSFTSSQKP 75

Query: 70  -------------NYVKIASI---ELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRS 113
                         ++K +S+   ++      P N +  P K  V     F    E  R+
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRA 135

Query: 114 RYMVQDPNIISTIDGNGTVSIFDRNSSDSP------------VKTYSYHK---------- 151
           RY+ Q+P+II+    +G + IFDR    S              K +  H           
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDT 195

Query: 152 -----DNGYGLSFNPISKGQLLSAADDGYIAMYDINAES-EDPVETWQ----STDNCIIN 201
                +    L++N   +  LLS+  +G + ++DI   S E+P+        ++D   +N
Sbjct: 196 SSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVN 255

Query: 202 DIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ---PFNSLAFSKHSKNLFSA 258
           D+ W     +LF   +E  N +S+ DLRTK +      E+     NS  F+  +  + ++
Sbjct: 256 DVTWMPTHDSLFAACTE-GNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILAS 314

Query: 259 AGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEI 317
           A ++  + L+D+RN  K+  +   H   V+ LE+  + D +L ++  ED  + +WD    
Sbjct: 315 ADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT--- 371

Query: 318 GSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                      +  E +  H GH   VND S ++  PWL+ S   +N + +WK +  L
Sbjct: 372 -----------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNL 418

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/416 (25%), Positives = 181/416 (43%), Gaps = 68/416 (16%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + E Y  WK N  L+Y++++     WPSLT ++ P D    L +  +++ + TS Q+P  
Sbjct: 19  LQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP-DLDTTLDEHRILLSSFTSSQKPED 77

Query: 70  -----------NYVKIASI---ELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRY 115
                       ++K +S+   ++      P N +  P K  V     F    E  R+RY
Sbjct: 78  ESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECNRARY 137

Query: 116 MVQDPNIISTIDGNGTVSIFDRNSSDSP------------VKTYSYHK------------ 151
           + Q+P+II+    +G + IFDR    S              K +  H             
Sbjct: 138 LPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDASS 197

Query: 152 ---DNGYGLSFNPISKGQLLSAADDGYIAMYDINAES-EDPVETWQ----STDNCIINDI 203
              +    +++N   +  LLS+  +G + ++DI   S E+P+        ++D   +ND+
Sbjct: 198 ADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVNDV 257

Query: 204 KWHHFDATLFGTVSEEKNTLSIYDLRTKD---KVTSIEMEQPFNSLAFSKHSKNLFSAAG 260
            W     +LF   +E  NT+S+ DLRTK    K          NS  F+  +  + ++A 
Sbjct: 258 TWMPTHDSLFAACTE-GNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASAD 316

Query: 261 TDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEIGS 319
           ++  + L+D+RN      +   H G V+ LE+  + D +L ++  ED  + +WD      
Sbjct: 317 SNGKLNLWDIRNMNDCPLTTMEHGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDT----- 371

Query: 320 EQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                    +  E +  H GH   VND S ++  PWL+ S   +N + +WK +  L
Sbjct: 372 ---------SREENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNL 418

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  126 bits (317), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 104/418 (24%), Positives = 185/418 (44%), Gaps = 70/418 (16%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           + + Y  WK N  L+YD+++     WPSLT ++ P   ++  T + +++ T TS Q P+ 
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHR-LLLSTFTSSQIPDD 71

Query: 71  -YVKIASIELPNEV--------------IDPHNVSDAPVKSNVRITKKFKLEKEITRSRY 115
             + I+ I   N +                P N    P K+ +        E +  ++RY
Sbjct: 72  ESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKARY 131

Query: 116 MVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHK--------------------DNG- 154
           M Q+P+II     NG + IFDR    S + T +  +                    ++G 
Sbjct: 132 MPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDGT 191

Query: 155 -------YGLSFNPISKGQLLSAADDGYIAMYDINAE-----SEDPVETWQST-DNCIIN 201
                    +++NP  +GQLLS   +G I ++D   E      E     W +  D+   N
Sbjct: 192 KNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCN 251

Query: 202 DIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEM---EQPFNSLAFSKHSKNLFSA 258
           ++ W +   ++F T   E N ++++D R +  V SIE        NS  F+  +  L ++
Sbjct: 252 EVTWMNGHNSIFATCG-ENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLAS 310

Query: 259 AGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEI 317
             ++  + L+D+R   K + ++  H   ++ +E+   ++ ++ S   ED  + +WD+   
Sbjct: 311 GDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDI--- 366

Query: 318 GSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                NE+      E + IH GH   +ND S +   PWL+ S   +N IQ+WK +  L
Sbjct: 367 ----SNEE------EPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHL 414

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 183/413 (44%), Gaps = 63/413 (15%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + E Y  WK N  L+Y +++     WPSLT ++ P D         +++ T TS Q P  
Sbjct: 16  LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFP-DLDTTTDTHRILLSTFTSSQLPED 74

Query: 70  --------------NYVKIASIELPNEVIDPHNVSDAPVKS-NVRITKKFKLEKEITRSR 114
                         N+  + + ++      P N +  P K+ NV I+  F    +  R+R
Sbjct: 75  ESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFP-NGDCNRAR 133

Query: 115 YMVQDPNIISTIDGNGTVSIFDR----------NSSDSPVKTYSYHK--------DNGYG 156
           Y+ Q+P++++    NG++ IF+R          N      + YS  K        +    
Sbjct: 134 YLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEAVS 193

Query: 157 LSFNPISKGQLLSAADDGYIAMYDINAES-EDPV----ETWQSTDNCIINDIKWHHFDAT 211
           +++N    G L S+   G I ++DI   S  DP     E     D    N++ W     +
Sbjct: 194 IAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDS 253

Query: 212 LFGTVSEEKNTLSIYDLRTKDKVTSIE-----MEQPFNSLAFSKHSKNLFSAAGTDQNVY 266
           +F   SE  N LS++D+RTK+++  +           NS  F+ ++  L ++A +   + 
Sbjct: 254 IFAACSES-NKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKIN 312

Query: 267 LYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVNED 325
           ++D+R   K       H   ++ LE++ +++ ILV++ +D  ++ IWD            
Sbjct: 313 MWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDT----------- 361

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRI 378
              A  + + +H GH   VND S +   PWL++S   +N I VWK ++ L  I
Sbjct: 362 ---ANGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNLVDI 411

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  124 bits (310), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 180/417 (43%), Gaps = 70/417 (16%)

Query: 14  EEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP---- 69
           + Y  WK N  L+YD+++     WPSLT E+ P D         +++ + TS Q P    
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP-DLDTTTDSHRLLLSSFTSSQLPEDES 75

Query: 70  ------------NYVKIASIELPNEVIDPHNVSDAPVKS-----NVRITKKFKLEKEITR 112
                       ++  + + ++      P N +  P ++     ++RI        +  R
Sbjct: 76  IYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSG-----DSNR 130

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHK------------------DNG 154
           +RY+ Q+P++IS    +G++ IFDR   +S +   +  +                  +  
Sbjct: 131 ARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEV 190

Query: 155 YGLSFNPISKGQLLSAADDGYIAMYDI------NAESEDPVETWQSTDNCIINDIKWHHF 208
             L +N   +G L S    G + ++DI      N   + P+ +    D    NDI W   
Sbjct: 191 VSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPS 250

Query: 209 DATLFGTVSEEKNTLSIYDLRTKDKVTSIE---MEQPFNSLAFSKHSKNLFSAAGTDQNV 265
             +L     E  NT++IYD R+K +V+ I+        NS  F+ H+  L ++A +   V
Sbjct: 251 HDSLLAACGES-NTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTV 309

Query: 266 YLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL-VSSSEDRRIIIWDLMEIGSEQVNE 324
           +++D+R   +       H   ++ ++++ +V  I+ V+  ED  + +WD           
Sbjct: 310 HMWDIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWDA---------- 359

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNS 381
               +  +L+  H GH   VND + N+  PWL+ S   +N I +W+ SS L    NS
Sbjct: 360 ----SNGQLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLVEPQNS 412

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/419 (24%), Positives = 183/419 (43%), Gaps = 70/419 (16%)

Query: 10  LSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP 69
           + + E Y  WK N  L+YD+++     WPSLT ++ P D    L +  +++ + TS Q+P
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTLDEHRILLSSFTSSQKP 75

Query: 70  -------------NYVKIASI---ELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRS 113
                         ++K +S+   ++      P N +  P    V     F    +  R+
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDCNRA 135

Query: 114 RYMVQDPNIISTIDGNGTVSIFDR------------NSSDSPVKTYSYHK---------- 151
           RY+ Q+P+II+    +G + IFDR            NS     K +  H           
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMDT 195

Query: 152 -----DNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED------PVETWQSTDNCII 200
                +    L++N   +  LLS+  +G + ++DI   S +      P+ + +S D   +
Sbjct: 196 SSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIES-DASGV 254

Query: 201 NDIKWHHFDATLFGTVSEEKNTLSIYDLRT-KDKVTSIEMEQP--FNSLAFSKHSKNLFS 257
           ND+ W     +LF   + E N +S+ DLRT K+K+ S         NS  F+  +  + +
Sbjct: 255 NDVTWMPTHDSLFAACT-EGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLA 313

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLME 316
           +A ++  + L+D+R   ++  +   H   ++ LE++ +   +L ++  +D  + +WD   
Sbjct: 314 SADSNGRLNLWDIRKMNESPITTMEHGASISTLEWNPNFSTVLATAGQQDGLVKLWDT-- 371

Query: 317 IGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                       A  E +  H GH   VND S +   PWL+ S   +N + +WK +  L
Sbjct: 372 ------------AREETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENL 418

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/404 (23%), Positives = 187/404 (46%), Gaps = 50/404 (12%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + + Y  WK N  L+YD+++     WPSL+ ++ P D      +Q +++ + TS Q P  
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFP-DRTLTNDKQRILLSSFTSQQLPQD 78

Query: 70  -----------NYVKIASI------ELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITR 112
                      N++K +SI      E+  ++ +   ++D  ++  VRIT     + +  R
Sbjct: 79  ESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGDCNR 135

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSY-----------HKDNGYGLSFNP 161
            RYM Q+P+II T   NG+V IFDR    + + T               +D    L++N 
Sbjct: 136 CRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNY 195

Query: 162 ISKGQLLSAADDGYIAMYDINA--ESEDPVETWQS---TDNCIINDIKWHHFDATLFGTV 216
             +G L +   +G + ++D+    +S+  +E  +     D   +ND+ W     ++  + 
Sbjct: 196 QLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASC 255

Query: 217 SEEKNTLSIYDLRTKDKVTSIEME---QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNT 273
            E  N + + D+R   K+ ++         N++ F+  +  +     +   + ++D+R+ 
Sbjct: 256 GE-SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDF 314

Query: 274 RKTLHSMS-GHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVNEDAQDATP 331
           ++ +     G + P++ ++++  +  IL ++ +   ++ IWD      EQ  ED+     
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQ--EDSNAENN 369

Query: 332 ELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
            L+ +H GH   VND S +   PW + S   +N I +WK ++ L
Sbjct: 370 MLLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  121 bits (303), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 100/412 (24%), Positives = 179/412 (43%), Gaps = 64/412 (15%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + + Y  WK N  L+YD+++     WPSLT ++ P D         ++I + TS Q P  
Sbjct: 17  LQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFP-DLDTTSDTHRILISSFTSSQLPED 75

Query: 70  --------------NYVKIASIELPNEVIDPHNVSDAPVKSNVR-ITKKFKLEKEITRSR 114
                         N+  + + ++      P      P K  V  +T KF    +  R+R
Sbjct: 76  EAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFP-NGDCNRAR 134

Query: 115 YMVQDPNIISTIDGNGTVSIFDRNSSDSP---------------------VKTYSYHKDN 153
           Y+ Q+P++I+    NG+V IFDR    S                      V+    + + 
Sbjct: 135 YLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHENTNE 194

Query: 154 GYGLSFNPISKGQLLSAADDGYIAMYDI------NAESEDPVETWQSTDNCIINDIKWHH 207
              L++N   +G L S    G + ++DI      N   + PV   Q  D   +ND+ W  
Sbjct: 195 AISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQ-FDALGVNDVSWMP 253

Query: 208 FDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ---PFNSLAFSKHSKNLFSAAGTDQN 264
              +LF     E +TL+++D R   +V+ I   +     NS  F+  +  L ++A ++  
Sbjct: 254 SHDSLF-VACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLASADSEGL 312

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVN 323
           V ++D+RN  +       H   ++ +E++ ++D I+ ++ ++  ++ +WD+         
Sbjct: 313 VNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDV--------- 363

Query: 324 EDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
               +   EL+ +H GH   VND S +    WL+ S   +N IQ+WK +  L
Sbjct: 364 ---SNTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  116 bits (291), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 97/407 (23%), Positives = 171/407 (42%), Gaps = 57/407 (14%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           + + Y  WK N  L+YD+++     WPSLT +++P D + P  +  +++ + TS Q P  
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP-DLEVPTDKHRLLLSSFTSSQLPED 79

Query: 71  ---------------YVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRY 115
                          +  + + ++        N +  P K+ V   +      +  R+ Y
Sbjct: 80  EAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACY 139

Query: 116 MVQDPNIISTIDGNGTVSIFDRNSSDS------------------PVKTYSYHKDNGYGL 157
           M Q+P+II  I   G V+IFDR    +                  P             L
Sbjct: 140 MPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSL 199

Query: 158 SFNPISKGQLLSAADDGYIAMYDINA-ESEDPV----ETWQSTDNCIINDIKWHHFDATL 212
           ++N    G + S+  +G I ++DI   +   P     E     D    ND+ W    +++
Sbjct: 200 AWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSI 259

Query: 213 FGTVSEEKNTLSIYDLRTKDKVTSIEME---QPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
                E  NT+ + D R  D     +        N+L F+  +  L  AA ++  + L+D
Sbjct: 260 LAACGES-NTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWD 318

Query: 270 LRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE-DRRIIIWDLMEIGSEQVNEDAQD 328
            R   K L S+  H   V+ L+++ ++  I+ ++ + D  I IWD         + + +D
Sbjct: 319 CRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD--------TSREPED 369

Query: 329 ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
           +   L+ +H GH   VND + N   PWL+ S   +N + VWK ++ L
Sbjct: 370 S---LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 188/411 (45%), Gaps = 69/411 (16%)

Query: 14  EEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN--- 70
           + Y  WK N  L+Y++++     WPSLT ++ P D         +++ + TS   P    
Sbjct: 23  DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFP-DVNTKNDSHRILLSSFTSSLVPEDES 81

Query: 71  -YV-KIASIE------LPNEVIDPHNVSDAPVKSNVRITKKFKLEKEIT---------RS 113
            Y+ +I++++      L N   D   +   P  SN+++  K  L  E+          R+
Sbjct: 82  LYITRISTLKHLSWASLNN--FDLDEMEFKPDNSNIKLPPK-NLTTELVIRFPNGDCNRA 138

Query: 114 RYMVQDPNIISTIDGNGTVSIFDRNSSDSPVK------TYSYH--------------KDN 153
           RY+ Q+P++I+    +G+V IFDR    + +       T SY               ++ 
Sbjct: 139 RYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGENE 198

Query: 154 GYGLSFNPISKGQLLSAADDGYIAMYDINA-ESEDPV----ETWQSTDNCIINDIKWHHF 208
              + +N   +G L+ A  DG++  +DI   +  DPV    E     D    ND  W   
Sbjct: 199 ALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVWMPE 258

Query: 209 DATLFGTVSEEKNTLSIYDLRTKDKVTSIEM---EQPFNSLAFSKHSKNLFSAAGTDQNV 265
             +LF   SE+ N LS++D R +  +  I     +   N+  F+  +  L ++  +  N+
Sbjct: 259 HNSLFAACSED-NRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIGNI 317

Query: 266 YLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVNE 324
            L+D+R  ++T  ++  H   ++ +E++ ++  +L S+ +D  ++ +WD    GS++   
Sbjct: 318 CLWDIR-KKETPINILDHGSSISTIEWNPNLSTVLASAGQDDGLVKLWD---AGSDKP-- 371

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                    + IH GH   VND S N   PWL+ S  ++N IQ+WK +  L
Sbjct: 372 ---------VFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  115 bits (287), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 100/404 (24%), Positives = 172/404 (42%), Gaps = 60/404 (14%)

Query: 14  EEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN--Y 71
           + Y LWK N  L+YD+++     WPSL+ ++ P D         ++  + TS Q P    
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFP-DLDTSSDTHRLLFTSFTSSQLPQDEN 68

Query: 72  VKIASIELPNEV--------------IDPHNVSDAPVKS-NVRITKKFKLEKEITRSRYM 116
           V IASI     V                P   +  P K+  +++T  F    +  R+ Y+
Sbjct: 69  VTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFP-HGDCNRATYL 127

Query: 117 VQDPNIISTIDGNGTVSIFDRNSSD--------SPVKTYSYHKDNG------YGLSFNPI 162
            Q+P++IST   +G+V IFDR             P +      +NG        L +N  
Sbjct: 128 PQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQ 187

Query: 163 SKGQLLSAADDGYIAMYDINA-ESEDPVETWQSTD-----NCIINDIKWHHFDATLFGTV 216
            +G L S   +G + ++DI   E  +P+ +  S D     +   ND+ W      L  ++
Sbjct: 188 IEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL-SI 246

Query: 217 SEEKNTLSIYDLRTKDKVT----SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRN 272
           + E N ++++D RT   +     S       N   F+     L + A  D  V L+D+R 
Sbjct: 247 AREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRK 306

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEIGSEQVNEDAQDATP 331
               + +++  E P++ LE++  +  +L +   ED  + +W+               +  
Sbjct: 307 LHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWNA--------------SNG 351

Query: 332 ELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
           +L+  H GH   VND + +    WL+ S   +N   +WK +SRL
Sbjct: 352 QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  115 bits (288), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 188/421 (44%), Gaps = 73/421 (17%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           +   Y  WK N  L+YD+++     WPSLT ++ P D  A      +++ ++TS Q P  
Sbjct: 15  LQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP-DVDANTDTHRILLSSYTSCQLPED 73

Query: 71  -YVKIASIE---------LPNEVID-----PHNVSDAPVK---SNVRITKKFKLEKEITR 112
             V +ASI          L N  +D     P   +  P K   +NV IT       +  R
Sbjct: 74  ENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNR 130

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRN-----------SSDS-----PVKTYSYHKDN--- 153
           +RYM Q+P++I+    NG V +F+R            +SD+     P +   Y+++    
Sbjct: 131 ARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEA 190

Query: 154 --------GYGLSFNPISKGQLLSAADDGYIAMYDI---NAESEDPVET-WQST--DNCI 199
                      L++N   +G L  A   G + ++D+   N ++    ET W+ +  D+  
Sbjct: 191 RRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRG 250

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME---QPFNSLAFSKHSKNLF 256
           +ND+ W     ++     E  ++L+++D R ++ V  I  +   +  N+  F+  +  L 
Sbjct: 251 VNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLL 310

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE-DRRIIIWDL- 314
           ++  +     L+D+R           H G V+ LE++     +L ++ + D  I IWD  
Sbjct: 311 ASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTS 370

Query: 315 MEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
           +EI         +D T   + +H+GH   VND + +   PWL+ S   +N + VWK ++ 
Sbjct: 371 LEI---------EDKT---IFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAAN 418

Query: 375 L 375
           L
Sbjct: 419 L 419

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  115 bits (287), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 96/409 (23%), Positives = 187/409 (45%), Gaps = 62/409 (15%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           + E Y  WK N  L+YD+++     WPSL+ ++   D         +++ + TS   P  
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF-QDVNTKNDSHRILLSSFTSGLMPEQ 81

Query: 70  ---NYVKIASIE-LPNEVIDPHNVSDAPVK--SNVRIT-KKFKLEKEIT-------RSRY 115
              N + I++++ +P   ++  ++ +   K  +N+++  K    E+ IT       R+RY
Sbjct: 82  ESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARY 141

Query: 116 MVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHK--------------------DNGY 155
           + Q+ +II+    +GTV IF+R    S ++  S  +                    +   
Sbjct: 142 LPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEAL 201

Query: 156 GLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCII-----NDIKWHHFDA 210
            + +N   +G L ++  DG I  +D+   S         T + ++     ND+ W     
Sbjct: 202 SIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLHD 261

Query: 211 TLFGTVSEEKNTLSIYDLRTKDKVTSIE---MEQPFNSLAFSKHSKNLFSAAGTDQNVYL 267
           +L     E  N L IYD+R   + T+I     E   N+  F+  +  + ++A T  NV++
Sbjct: 262 SLLAACGE-SNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHI 320

Query: 268 YDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVNEDA 326
           +D+R + + + ++  H   ++ +E++ ++D IL ++ +D  ++ +WD+ +          
Sbjct: 321 WDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD---------- 369

Query: 327 QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                EL+  H GH   VND S N   PWL+ S   +N +Q+W+ +  L
Sbjct: 370 ----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 102/418 (24%), Positives = 177/418 (42%), Gaps = 79/418 (18%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           + + Y  WK N  L+YD+++     WPSLT ++  HD         +++   TS Q P  
Sbjct: 18  LQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF-HDLDTTSDTHRILLSAFTSSQLPED 76

Query: 71  ---------------YVKIASIELPNEVIDPHNVSDAPVKSNVR-ITKKFKLEKEITRSR 114
                          +  I + ++      P N    P K+    I+ +F  + +   +R
Sbjct: 77  EAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFP-DGDCNIAR 135

Query: 115 YMVQDPNIISTIDGNGTVSIFDRNSSDS----------PVKTYSYHKDNGY--------- 155
           Y+ Q+P++I+    +G++ IFDR    S          P +   Y    G          
Sbjct: 136 YLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENVENTNEA 195

Query: 156 -GLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQST-----DNCIINDIKWHHFD 209
             +S+N   +G L S    G I ++D+   S   +E          D   +ND+ WH   
Sbjct: 196 TSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWHPSH 255

Query: 210 ATLFGTVSEEKNTLSIYD-------LRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTD 262
            ++    S E N + ++D       LR+ +K+ +       NS  F+ H  +L  +  ++
Sbjct: 256 DSILA-ASGESNIIGLFDNRLGTEILRSNEKMHN----GGINSCKFNSHCDSLLISGDSE 310

Query: 263 QNVYLYDLRNTR----KTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEI 317
             + L+DLR       KTLH    H   ++ LE++ +++ I+ S+ +D  ++ +WD+   
Sbjct: 311 GRINLWDLRKLDGEPIKTLH----HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV--- 363

Query: 318 GSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                      +T EL+  H GH   VND S N    WL+ S   +N +QVWK +  L
Sbjct: 364 -----------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  113 bits (283), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 97/410 (23%), Positives = 181/410 (44%), Gaps = 64/410 (15%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           +   Y  WK N  L+YD+++     WPSLT ++ P D      Q  +++ + TS Q P  
Sbjct: 30  VQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTTNDQHRLLLSSFTSSQLPED 88

Query: 71  ---YV-KIASIE-LPNEVIDPH----------NVSDAPVKSNVR-ITKKFKLEKEITRSR 114
              YV ++++++ LP   ++            N S  P K+ ++ +   F +  +   +R
Sbjct: 89  ESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPM-GDCNGAR 147

Query: 115 YMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNG------------------YG 156
           Y+ Q+P++I+    NG++ +FDR        T     D G                    
Sbjct: 148 YLPQNPDVIAAASSNGSIYVFDRTKHG---LTRQKLHDGGSMFELEFQSSSLEEHQEVVS 204

Query: 157 LSFNPISKGQLLSAADDGYIAMYDINAESE-----DPVETWQSTDNCIINDIKWHHFDAT 211
           L++N   +G L +    G + ++D+   S      D  +   + D    ND+ W    A+
Sbjct: 205 LAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHAS 264

Query: 212 LFGTVSEEKNTLSIYDLRTKDKVTSIEME-----QPFNSLAFSKHSKNLFSAAGTDQNVY 266
           +     E  N++++ D R +  V S   +     +  NS  F+ H+  L  +  +   V 
Sbjct: 265 ILACCGE-SNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVN 323

Query: 267 LYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE-DRRIIIWDLMEIGSEQVNED 325
           L+D+R+    L S+  H   ++  +++ ++  IL ++ + D  + +WD+           
Sbjct: 324 LWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDI----------- 371

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
           AQ+   EL+ +H GH   VND S N   PWL+ S   +N +Q+W+ +  L
Sbjct: 372 AQEPGEELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 176/411 (42%), Gaps = 64/411 (15%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEP-- 69
           +   Y  WK N  L+YD+++     WPSLT ++ P D      Q  +++ + TS Q P  
Sbjct: 21  VQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP-DLDTSSDQHRLLLSSFTSSQLPED 79

Query: 70  --------------NYVKIASIELPNEVIDPH-NVSDAPVKSNVRITKKFKLEKEITRSR 114
                         N+  + + ++      P  +V   P      ++ +F    +  RSR
Sbjct: 80  ESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFP-NGDCNRSR 138

Query: 115 YMVQDPNIISTIDGNGTVSIFDR-----------NSSDSPVKTYSYHKD--------NGY 155
           Y+ Q+P++I+    +G+V IF++           +S D   + +S   D           
Sbjct: 139 YLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAV 198

Query: 156 GLSFNPISKGQLLSAADDGYIAMYDINAESEDPV-----ETWQSTDNCIINDIKWHHFDA 210
            LS+N   +G L  +   G   ++D+   S   +     E   + D+   ND+ W     
Sbjct: 199 SLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHD 258

Query: 211 TLFGTVSEEKNTLSIYDLRTK-----DKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNV 265
           ++F     E N L ++D+R       + +++ + E   N+  F+  +  L ++A T   +
Sbjct: 259 SMF-IACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRI 317

Query: 266 YLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS-EDRRIIIWDLMEIGSEQVNE 324
            L+D+R   +   S   H   ++ +E++ ++  +  S+  ED  + +WD   +G E    
Sbjct: 318 NLWDIRKLDQEPISTMQHGSSISTIEWNPNIGVVFASAGQEDGLVKLWD-ASVGKE---- 372

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                    + +H GH   VND S +   PWL+AS   +N IQ+W+ +  +
Sbjct: 373 ---------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNI 414

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  109 bits (272), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 102/410 (24%), Positives = 187/410 (45%), Gaps = 56/410 (13%)

Query: 12  IDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN- 70
           + + Y  WK N  L+Y++++     WPSLT +++P D      +  +++ + TS Q P  
Sbjct: 21  LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP-DMDIASDKHRILLSSFTSAQLPED 79

Query: 71  ---YVK-------IASIELPNEVIDPHNVS-DAPVKSNVRITKKFKL---EKEITRSRYM 116
              Y+        IA   L N  ++      D  VK +  +T+  K+   E +  R+RYM
Sbjct: 80  EAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRARYM 139

Query: 117 VQDPNIISTIDGNGTVSIFDR--NSSDSPV---KTYSYHKD----------NGYGLSFNP 161
            Q+P++I++    G+V IFDR  + S+ P     T+ Y  +              L++N 
Sbjct: 140 PQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAWNY 199

Query: 162 ISKGQLLSAADDGYIAMYDINAESED------PVETWQSTDNCIINDIKWHHFDATLFGT 215
              G L ++  DG + ++DI   ++       P   WQ  D    N++ W    +++   
Sbjct: 200 QRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQ-VDKEGANEVSWMVHHSSILA- 257

Query: 216 VSEEKNTLSIYDLRTKDKVTSIEME---QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRN 272
           V  E N L+I D RT    ++          N++ F+  +  L  +A ++  + + D+R 
Sbjct: 258 VCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQ 317

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE-DRRIIIWDLMEIGSEQVNEDAQDATP 331
               + + S H   V+ ++++     ++ S+ + D  + IWDL           AQ+  P
Sbjct: 318 LEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDL-----------AQEDDP 365

Query: 332 ELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNS 381
            L+ IH GH   VND + N   PW++ S   +N + +WK ++ +   +NS
Sbjct: 366 -LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVNGNNS 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/415 (23%), Positives = 188/415 (45%), Gaps = 64/415 (15%)

Query: 6   EERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTS 65
           EER+    + Y  WK N  L YD+++     WPSLT +  P D      +  +++ + TS
Sbjct: 19  EERQ----KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP-DLDLATDEHRILLSSFTS 73

Query: 66  DQEPN----YV-KIASIE-LPNEVIDPHNVSDAPVK--SNVRITKKFKLE--------KE 109
            Q P     YV +++S++ +P   ++  ++ +   K  +++++  K  +E         +
Sbjct: 74  SQVPEDESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGD 133

Query: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDR-----------NSSDSPVKTYSY-------HK 151
             ++RY   +P++I +   NG++ +FDR           ++ D+  + +         HK
Sbjct: 134 CNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHK 193

Query: 152 DNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED------PVETWQSTDNCIINDIKW 205
           +    L++N   +G L ++   G + ++D+    ++      P+    + D    N++ W
Sbjct: 194 NEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAM-STVDPRGSNEVSW 252

Query: 206 HHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI----EMEQPFNSLAFSKHSKNLFSAAGT 261
                +L    SE+ N + I D+R  +K  S           N+  F+ H   L  +A +
Sbjct: 253 MVRHDSLLAYCSED-NLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADS 311

Query: 262 DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSE 320
              + L+D+RN  + L ++  H   ++ L+++     +L +  +D  ++ IWDL      
Sbjct: 312 AGRINLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDL------ 364

Query: 321 QVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                +Q    EL+  H GH   VND S +    W++ S   +N IQVW+ S+ L
Sbjct: 365 -----SQPEGQELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  102 bits (255), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/407 (23%), Positives = 179/407 (43%), Gaps = 60/407 (14%)

Query: 14  EEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPN--- 70
           + Y  WK N  L+Y++++     WPSLT +  P D      +  +++ + TS Q P    
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP-DLDLAGDEHRILLSSFTSSQLPEDEA 81

Query: 71  -YV-KIASIE-LPNEVIDPHNVSDAPVK--SNVRITKKFKLE--------KEITRSRYMV 117
            YV +++S++ +P   ++  +  +   K  +++++  K  +E         +  ++RY  
Sbjct: 82  IYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARYCP 141

Query: 118 QDPNIISTIDGNGTVSIFDRNSSDSPVK------------------TYSYHKDNGYGLSF 159
            +P++IS+   NG+V +FDR    S  +                  +    ++    L++
Sbjct: 142 SNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLAW 201

Query: 160 NPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCII------NDIKWHHFDATLF 213
           N   +G L +    G + ++D+ A+ +    T     + ++      NDI W     +L 
Sbjct: 202 NWQQQGLLATCYSGGEVCVWDL-AKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSLL 260

Query: 214 GTVSEEKNTLSIYDLR-TKDKVTSI---EMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
               E  N L + D R TK    S          N+  F+ +   L  +A +   + L+D
Sbjct: 261 AYCGE-GNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWD 319

Query: 270 LRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII-IWDLMEIGSEQVNEDAQD 328
           +R+    + S+  H G V+ L+++     IL ++ +D  ++ IWDL           +Q 
Sbjct: 320 IRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDL-----------SQP 367

Query: 329 ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
              EL   H GH   VND S + + PW++ S   +N IQ+WK S  L
Sbjct: 368 VDQELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/416 (21%), Positives = 175/416 (42%), Gaps = 85/416 (20%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +YD +    + WP LT++ +P +        PQ+ L    M   T  S ++ N + + 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLL----MTTATQASRKKENELMVL 174

Query: 76  SIE-----------------------LPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITR 112
           S+                          + +I+  N+S     + +R++   +  KE+  
Sbjct: 175 SLSQLAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEV-- 232

Query: 113 SRYMVQDPNIISTIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYG 156
                    + +T+  NG V IFD                 SS  PV T   H +  GY 
Sbjct: 233 ---------LTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYA 283

Query: 157 LSFNPISK-GQLLSAADDGYIAMYDINAES-EDPVETWQSTDNCIINDIKWHHFDATLFG 214
           L ++P+ K G LL+    G I +   N        + +   +N  + DI+W   +AT+F 
Sbjct: 284 LDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFA 343

Query: 215 TVSEEKNTLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLR 271
           +   +   + I+D R+K    ++ ++      N +++++    L ++   + +  ++DLR
Sbjct: 344 SCGCD-GYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLR 402

Query: 272 -------NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVN 323
                  N  + +     H+G +T++ F+   + I+  +SED  + +WDL +E   E++ 
Sbjct: 403 QFTPDNINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIK 462

Query: 324 EDAQDAT------PELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           + A +        P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 463 QQAAETKELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 515

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/408 (23%), Positives = 178/408 (43%), Gaps = 70/408 (17%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    + WP LT++ +P          PQ+ L    +   T +S ++ N + + 
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSIL----LTTATQSSRKKENELMVL 169

Query: 76  SIELPNEVI-----------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII- 123
           ++    + +                   PV  N  I  +    + +  S + V +  ++ 
Sbjct: 170 ALSNLTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNR-LKVSPFAVSNQEVLT 228

Query: 124 STIDGNGTVSIFDR---------------NSSDSPVKTYSYHKD-NGYGLSFNPISK-GQ 166
           +T+  NG V I+D                 S+  P+ T   H +  GYGL ++P+ K G 
Sbjct: 229 ATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGA 288

Query: 167 LLSAADDGYIAMYDINAESEDPVETWQS---TDNCIINDIKWHHFDATLFGTVSEEKNTL 223
           LLS    G I  Y     +   V   QS   ++N  I DI+W   ++T+F T + +   +
Sbjct: 289 LLSGDCSGQI--YLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACD-GYI 345

Query: 224 SIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR-------N 272
            I+D R+K    +I ++      N +++S     L  A+G D   + ++DLR       +
Sbjct: 346 RIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLL-ASGDDNGTWGVWDLRQFTPSNAD 404

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA----- 326
           T + +     H+G +T++ F+   + I+   SED  + +WDL +E   E++ + A     
Sbjct: 405 TVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE 464

Query: 327 -QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            QD  P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 465 LQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 509

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 91/406 (22%), Positives = 174/406 (42%), Gaps = 65/406 (16%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPN----- 70
           P +Y+ +    L WP LT++ +P +        PQ+ L    M   T  S ++ N     
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSIL----MTTATQASKKKDNELMVL 174

Query: 71  --------YVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNI 122
                    VK        +  +  + +  P+  N  +  +    +        VQ   +
Sbjct: 175 KLSHLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEIL 234

Query: 123 ISTIDGNGTVSIFDR---------------NSSDSPVKTYSYHKD-NGYGLSFNPISK-G 165
            ST+  NG V I+D                 ++  P+ T   H +  GYGL ++P+ K G
Sbjct: 235 TSTMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTG 294

Query: 166 QLLSAADDGYIAMYDINAESEDPVET-WQSTDNCIINDIKWHHFDATLFGTVSEEKNTLS 224
            LL+    G + +   +       +T +   +N  I DI+W   ++T+F T   +   + 
Sbjct: 295 ALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCD-GYIR 353

Query: 225 IYDLRTKDK---VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVY-LYDLR----NTRKT 276
           I+D R+K     ++++      N +++++    L  A+G D+  + ++DLR    N+ K 
Sbjct: 354 IWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLL-ASGDDKGTWGIWDLRQFSPNSEKA 412

Query: 277 L--HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE------DAQ 327
           L       H+G +T++ F+   + I+  +SED  + +WDL +E   E++ +      + +
Sbjct: 413 LPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELE 472

Query: 328 DATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 473 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 515

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 91/406 (22%), Positives = 173/406 (42%), Gaps = 66/406 (16%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    + WP LT++ +P          PQ+ L    M   T  S ++ N + + 
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSIL----MATATQASKKKENELMVL 173

Query: 76  SIELPNEVI------------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII 123
            +   N+ +            D  +    P+  N  I+ +    + +  S +      + 
Sbjct: 174 KLSQLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNR-LKISPFASSQEVLT 232

Query: 124 STIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPISK-GQ 166
           +T+  NG V I D                 S+  P+ T   H +  GYGL ++P+ K G 
Sbjct: 233 ATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGA 292

Query: 167 LLSAADDG--YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLS 224
           LL+    G  Y+     +    D  + +  ++N  I DI+W   ++T+F T S     + 
Sbjct: 293 LLTGDCSGQVYLTQRHTSKWVTDK-QPFTFSNNKSIEDIQWSRTESTVFAT-SGCDGYIR 350

Query: 225 IYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLR----NTRKTL 277
           I+D R+K    +I         N +++++    L ++   D    ++DLR    N  + +
Sbjct: 351 IWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENV 410

Query: 278 HSMSG---HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA------Q 327
             ++    H+G +T++ F+   + I+  +SED  + +WDL +E   E++ + A      Q
Sbjct: 411 QPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 470

Query: 328 DATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 471 QIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKTIS 513

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 95/415 (22%), Positives = 175/415 (42%), Gaps = 81/415 (19%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    + WP LT++ +P          PQ+ L    M   T  S ++ N + + 
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLL----MTTATQASKKKENELMVL 168

Query: 76  SIELPNEVI--------------DPHNVSDAPVKSNVRI-----TKKFKLEKEITRSRYM 116
           S+    + +              D  +    PV  N  I     T + K+      S+ +
Sbjct: 169 SLSNLTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEV 228

Query: 117 VQDPNIISTIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFN 160
                + +T+  NG V IFD                 ++  P+ T   H +  GY L ++
Sbjct: 229 -----LTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWS 283

Query: 161 P-ISKGQLLSAADDGYIAMYDINAESEDPV---ETWQSTDNCIINDIKWHHFDATLFGTV 216
           P I  G LL+    G I  Y     +   V   + +  ++N  I DI+W   + T+F + 
Sbjct: 284 PSIQTGALLTGDCSGQI--YFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASA 341

Query: 217 SEEKNTLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR- 271
             +   + I+D R+K    +I ++      N +++S     L  A+G D  V+ ++DLR 
Sbjct: 342 GCD-GYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLL-ASGDDNGVWGVWDLRQ 399

Query: 272 ------NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE 324
                 N+ + +     H+G +T++ F+   + I+  +SED  + +WDL +E   E++ +
Sbjct: 400 FSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQ 459

Query: 325 DA------QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            A      Q   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 460 QAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWKTIS 511

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 134/290 (46%), Gaps = 45/290 (15%)

Query: 122 IISTIDGNGTVSIFD---------------RNSSDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +T+  NG V I+D                 S+  P+ T   H +  GYGL ++P+ K 
Sbjct: 226 LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKT 285

Query: 165 GQLLSAADDGYIAMYDINAESEDPV---ETWQSTDNCIINDIKWHHFDATLFGTVSEEKN 221
           G LLS    G I  Y     +   V   + +  ++N  I DI+W   ++T+F T   +  
Sbjct: 286 GALLSGDCSGQI--YFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCD-G 342

Query: 222 TLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR------ 271
            + I+D R+K    +I ++      N +++S     L  A+G D   + ++DLR      
Sbjct: 343 YIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLL-ASGDDNGTWGVWDLRQFTPSN 401

Query: 272 -NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE----- 324
            +T + +     H+G +T++ F+   + I+   SED  + +WDL +E   E++ +     
Sbjct: 402 ADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 325 -DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            + Q+  P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 462 KELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 508

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 174/404 (43%), Gaps = 64/404 (15%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    + WP L+++ +P          PQ+ L    M   T  S ++ N + + 
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSIL----MTTATQASKKKENELMVL 174

Query: 76  SIE-LPNEVIDPHNVSDA--------PVKSNVRITKKFKLEKEITRSRYMVQDPNII-ST 125
           S+  L   ++      +         P+  N  I  +    + I  S +  Q   ++ +T
Sbjct: 175 SLSNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNR-IKVSPFASQSQEVLTAT 233

Query: 126 IDGNGTVSIFDRNS---------------SDSPVKTYSYHKD-NGYGLSFNPISK-GQLL 168
           +  NG V IFD  +               S  PV T   H +  GYGL ++P+ K G LL
Sbjct: 234 MSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALL 293

Query: 169 SAADDG--YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIY 226
           S    G  Y+     +    D  + +   +N  I DI+W   ++T+F T   +   + ++
Sbjct: 294 SGDCSGQIYLTQRHTSKWVTDK-QAYSVGNNKSIEDIQWSKTESTVFATAGCD-GYIRVW 351

Query: 227 DLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTR-------KT 276
           D R+K    +I ++      N +++++    L ++   + +  ++DLR          + 
Sbjct: 352 DTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQP 411

Query: 277 LHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDAQDAT----- 330
           +   + H+G +T++ F+   + I+   SED  + +WDL +E   E++ +  ++       
Sbjct: 412 VAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEI 471

Query: 331 -PELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            P+L+ +H   +  + D   +  IP  + ST  +  + +WK+ S
Sbjct: 472 PPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 512

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 91/412 (22%), Positives = 176/412 (42%), Gaps = 77/412 (18%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    L WP +T++ +P          PQ+ L    M   T  S ++ N + + 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSIL----MTTATQASKKKENELMVL 175

Query: 76  SIELPNEVI------------DPHNVSDAPVKSNVRITKKFKLEKEITR---SRYMVQDP 120
           S+   N+ +                    P+  N  I    KL     R   S +   D 
Sbjct: 176 SLSQLNKTLVKSEEDEDEDEDSDEEDDSDPIIENENI----KLNDTTNRLKVSPFASTDK 231

Query: 121 NII-STIDGNGTVSIFDR---------------NSSDSPVKTYSYHKD-NGYGLSFNPIS 163
            ++ +T+  NG V IFD                 ++  P+ T   H +  GY L ++P+ 
Sbjct: 232 EVLTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMI 291

Query: 164 K-GQLLSAADDGYIAMYDINAESEDPV---ETWQSTDNCIINDIKWHHFDATLFGTVSEE 219
           K G LL+    G I  Y     +   +   + + + +N  + DI+W   ++T+F +   +
Sbjct: 292 KNGALLTGDCSGQI--YFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCD 349

Query: 220 KNTLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR---- 271
              + I+D R+K    ++ ++      N +++S+    L  A+G D  ++ ++DLR    
Sbjct: 350 -GYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLL-ASGDDNGLWGVWDLRQFSP 407

Query: 272 ---NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE--- 324
              N  + +     H+G +T++ F+   D I+  +SED  + +WDL +E   E++ +   
Sbjct: 408 DNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIA 467

Query: 325 ---DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              + +   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 468 ETKELEKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 516

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 123/258 (47%), Gaps = 30/258 (11%)

Query: 139 SSDSPVKTYSYHKD-NGYGLSFNPISK-GQLLSAADDGYIAMYDINAESEDPV---ETWQ 193
           S+  P+ T   H +  GYGL ++P+ K G LLS    G I  Y     +   V   + + 
Sbjct: 260 SAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGDCSGQI--YFTQRHTSRWVTDKQPFT 317

Query: 194 STDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQP---FNSLAFSK 250
            ++N  I DI+W   ++T+F T   +   + I+D R+K    +I ++      N +++S 
Sbjct: 318 VSNNKSIEDIQWSRTESTVFATAGCD-GYIRIWDTRSKKHKPAISVKASNTDVNVISWSD 376

Query: 251 HSKNLFSAAGTDQNVY-LYDLR-------NTRKTLHSMSGHEGPVTNLEFHDSVDGILVS 302
               L  A+G D   + ++DLR       +  + +     H+G +T++ F+   + I+  
Sbjct: 377 KIGYLL-ASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAV 435

Query: 303 SSEDRRIIIWDL-MEIGSEQVNEDA------QDATPELMMIHAGHRSSVNDFSLNSSIPW 355
            SED  + +WDL +E   E++ + A      Q+  P+L+ +H   +  V D   +  IP 
Sbjct: 436 GSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPG 493

Query: 356 LIASTEEENIIQVWKSSS 373
            + ST  +  + VWK+ S
Sbjct: 494 CLVSTGTDG-LNVWKTIS 510

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 43/73 (58%), Gaps = 7/73 (9%)

Query: 122 IISTIDGNGTVSIFDR-----NSSDS--PVKTYSYHKDNGYGLSFNPISKGQLLSAADDG 174
           ++++ D NGT  ++D      +++D+  PV  Y +HK     ++FNP+ +  +   ++D 
Sbjct: 381 LLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDN 440

Query: 175 YIAMYDINAESED 187
            + ++D++ E++D
Sbjct: 441 TVTLWDLSVEADD 453

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 131/289 (45%), Gaps = 43/289 (14%)

Query: 122 IISTIDGNGTVSIFDRNS---------------SDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +T+  NG V IFD  S               +  P+ T   H +  GY L ++P+ K 
Sbjct: 237 LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKT 296

Query: 165 GQLLSAADDG--YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNT 222
           G LL+    G  Y+     +    D  E +   +N  + DI+W   ++T+F +   +   
Sbjct: 297 GALLTGDCSGQVYLTQRHTSKWISDK-EPFTVANNQSVEDIQWSRTESTVFASCGCD-GY 354

Query: 223 LSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR------- 271
           + ++D R+K    +I ++      N +++S+    L  A+G D   + ++DLR       
Sbjct: 355 IRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLL-ASGDDNGTWGVWDLRQFSPSNS 413

Query: 272 NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA---- 326
           N    +     H+G +T++ F+   + I+  +SED  + +WDL +E   E++ + A    
Sbjct: 414 NNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETK 473

Query: 327 --QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
             Q   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 474 ELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWKTIS 519

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 133/289 (46%), Gaps = 43/289 (14%)

Query: 122 IISTIDGNGTVSIFDR---------------NSSDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +T+  NG V I+D                 S+  P+ T   H +  GYGL ++P+ K 
Sbjct: 226 LTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKT 285

Query: 165 GQLLSAADDG--YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNT 222
           G LLS    G  Y      +    D  + +  ++N  I DI+W   ++T+F T   +   
Sbjct: 286 GSLLSGDCSGQVYFTQRHTSRWVTDK-QPFTVSNNKSIEDIQWSRSESTVFATAGCD-GY 343

Query: 223 LSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR------- 271
           + I+D R+K    +I ++      N +++S     L  A+G D   + ++DLR       
Sbjct: 344 IRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLL-ASGDDNGTWGVWDLRQFTPSNA 402

Query: 272 NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE------ 324
           ++ + +     H+G +T++ F+   + I+   SED  + +WDL +E   E++ +      
Sbjct: 403 DSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETK 462

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           + Q+  P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 463 ELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 508

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 165/404 (40%), Gaps = 62/404 (15%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    + WP +T++ +P          PQ+ L    M   T  S +  N + + 
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLL----MATATQASKKNQNELMVL 182

Query: 76  SI-ELPNEVIDPHNVSDA----------PVKSNVRITKKFKLEKEITRSRYMVQDPNIIS 124
            + +L   ++      +           PV  N  I+ K    +             + S
Sbjct: 183 KMSQLAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQEVLCS 242

Query: 125 TIDGNGTVSIFDRNS---------------SDSPVKTYSYHKD-NGYGLSFNPISK-GQL 167
           T+  NG V IFD  S               +  P+ T   H    GY   ++PI K G +
Sbjct: 243 TMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAM 302

Query: 168 LSAADDGYIAMYDINAESE-DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIY 226
           LS    G + +   +        + +   +N  I D++W   ++T+F +   +   + I+
Sbjct: 303 LSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGID-GYIRIW 361

Query: 227 DLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLR-------NTRKT 276
           D R+K    +I ++      N +++S+    L ++   D    ++DLR       +T   
Sbjct: 362 DTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASP 421

Query: 277 LHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA------QDA 329
           +     H+G +T++ F+   + I+  +SED  + +WDL +E   E++ + A      Q  
Sbjct: 422 VAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 481

Query: 330 TPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 482 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 522

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 134/288 (46%), Gaps = 41/288 (14%)

Query: 122 IISTIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +++  NG V IFD                 ++  P+ T   H +  GY L ++P++K 
Sbjct: 240 LTASMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKS 299

Query: 165 GQLLSAADDGYIAMYDINAESEDPVET-WQSTDNCIINDIKWHHFDATLFGTVSEEKNTL 223
           G LL+    G + +   +       +T + + +N  I DI++   +AT+F T   +   +
Sbjct: 300 GSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCD-GYI 358

Query: 224 SIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLRN------- 272
            I+D R+K    +I ++      N +++++    L  A+G D   + ++DLR        
Sbjct: 359 RIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLL-ASGDDNGTWGVWDLRQFSPNNAA 417

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA----- 326
           +   +   S H+G +T++ F+   D I+  +SED  + +WDL +E   E++ + A     
Sbjct: 418 SVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKE 477

Query: 327 -QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            Q   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 478 LQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 522

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 88/405 (21%), Positives = 180/405 (44%), Gaps = 64/405 (15%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    L WP L+++ +P          PQ+ L    +   T  S ++ N + + 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLL----LTTATQASKKKDNELLLL 181

Query: 76  SI-ELPNEVIDPHNVSDA----------PVKSNVRITKKFKLEKEITRSRYMVQDP-NII 123
            + +L   ++   N  +           P+  N  I  K    + +  S +  + P  + 
Sbjct: 182 KMSQLAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNR-LKVSPFASESPEKLT 240

Query: 124 STIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPISK-GQ 166
           +T+  NG V IFD                 ++  P+ T   H +  GY L ++P++K G 
Sbjct: 241 ATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGS 300

Query: 167 LLSAADDGYIAMYDINAESEDPVET-WQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSI 225
           LL+    G + +   +       +T + + +N  I DI++   +AT+F +   +   + I
Sbjct: 301 LLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCD-GYIRI 359

Query: 226 YDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLR----NTRKTLH 278
           +D R+K    +I ++      N +++++    L ++   + +  ++DLR    NT  +  
Sbjct: 360 WDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTS 419

Query: 279 SMSG---HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA------QD 328
            ++    H+G +T++ F+   D I+  +SED  + +WDL +E   E++ + A      Q+
Sbjct: 420 PVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQE 479

Query: 329 ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
             P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 480 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 521

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 129/288 (44%), Gaps = 42/288 (14%)

Query: 122 IISTIDGNGTVSIFD---------------RNSSDSPVKTYSYHKD-NGYGLSFNP-ISK 164
           + +T+  NG V IFD                 ++  P+ T   H +  GY L ++P I  
Sbjct: 233 LTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRS 292

Query: 165 GQLLSAADDG--YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNT 222
           G LL+    G  Y      +    D  + +  ++N  I DI+W   +AT+F T   +   
Sbjct: 293 GALLTGDCSGQVYFTQRHTSKWVTDK-QPFTVSNNKSIEDIQWSRTEATVFATAGCD-GY 350

Query: 223 LSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLRN------ 272
           + ++D R+K    +I  +      N +++++    L  A+G D   + ++DLR       
Sbjct: 351 IRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLL-ASGDDNGTWGVWDLRQFSPSNE 409

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDAQDAT- 330
             + +     H+G +T++ FH + + I+  +SED  + +WDL +E   E++ +   +   
Sbjct: 410 NAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKE 469

Query: 331 -----PELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 470 LAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 514

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 132/290 (45%), Gaps = 45/290 (15%)

Query: 122 IISTIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +T+  NG V IFD                 ++  P+ T   H +  GY L ++P++K 
Sbjct: 228 LAATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKT 287

Query: 165 GQLLSAADDGYIAMYDINAESEDPV---ETWQSTDNCIINDIKWHHFDATLFGTVSEEKN 221
           G LL+    G I  Y     +   +   + +   +N  I DI+W   ++T+F +   +  
Sbjct: 288 GALLTGDCSGQI--YFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCD-G 344

Query: 222 TLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLR------ 271
            + I+D R+K    +I ++      N +++S+    L  A+G D   + ++DLR      
Sbjct: 345 YIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLL-ASGDDNGTWGVWDLRQFSPEN 403

Query: 272 -NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA--- 326
             + + +     H+G +T++ F+   + I+   SED  + +WDL +E   E++ + A   
Sbjct: 404 AGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAET 463

Query: 327 ---QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              Q   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 464 KELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKTIS 510

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 91/409 (22%), Positives = 174/409 (42%), Gaps = 72/409 (17%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLPHD--------PQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    L WP +T++ +P +        PQ+ L    M   T  S ++ N + + 
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSIL----MTTATQASKKKDNELLVL 180

Query: 76  SIELPNEVI------------DPHNVSDAPVKSNVRITKKFKLEKEITR---SRYMVQDP 120
            +    + +            D  +    P+  N  I    KL     R   S +  +  
Sbjct: 181 KLSQLAKTLAKDEDDGAEDDEDDEDEDADPIIENENI----KLRDTTNRMQVSPFAAESQ 236

Query: 121 NIIS-TIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPIS 163
            +++ T+  NG   IFD                 ++  P  T   H +  GYGL ++P+ 
Sbjct: 237 EVLAATMSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLI 296

Query: 164 K-GQLLSAADDGYIAMYD-INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKN 221
           K G LL+    G + +    +++     + +   +N  I DIKW   + T+F T   + +
Sbjct: 297 KTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGH 356

Query: 222 TLSIYDLRTKDKVTSIEM---EQPFNSLAFSKHSKNLFSAAGTDQNVY-LYDLRNTRKTL 277
            + I+D+R+K    ++ +   +   N +++++    L  A G D   + ++DLR      
Sbjct: 357 -VRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLL-ATGDDNGTWGVWDLRQFSNQQ 414

Query: 278 HSMSG------HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDA---- 326
             +S       H+G +T++ F+   + I+  +SED  + +WDL +E   E++ + A    
Sbjct: 415 GGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVK 474

Query: 327 --QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
             Q   P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 475 ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 520

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 102/214 (47%), Gaps = 25/214 (11%)

Query: 122 IISTIDGNGTVSIFDRNSSD---SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           II+    NGT+ ++  N ++   S    +  H  +   + FN      L S  ++G I +
Sbjct: 76  IIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFI 135

Query: 179 YDINAESEDPV--------ETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           +D+N  +E P         ++  S D   +N + W+   A +F +     N  SI+DL+ 
Sbjct: 136 WDMNKCTESPSTYTPLTPGQSMSSVDE--VNSLAWNQSLAHVFASAGSS-NFASIWDLKA 192

Query: 231 KDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM 280
           K +V  +    P + +           K+S  + +A G+D +  + ++DLRN    + ++
Sbjct: 193 KKEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTL 252

Query: 281 S-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           + GH+  + +L++ D  + +L+SS  D  +++W+
Sbjct: 253 NQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 130/287 (45%), Gaps = 40/287 (13%)

Query: 122 IISTIDGNGTVSIFD---------------RNSSDSPVKTYSYHKD-NGYGLSFNPISK- 164
           + +T+  NG V IFD                  S  P+ T   H +  G+GL ++P+ K 
Sbjct: 244 LTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKS 303

Query: 165 GQLLSAADDGYIAMYDINAESE-DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTL 223
           G LL+    G I +   +        +++   +N  I DI+W   + T+F T   +   +
Sbjct: 304 GALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCD-GYI 362

Query: 224 SIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVY-LYDLRNTRKTLHS 279
            I+D R+K    +I         N +++++  + L  A+G D+ V+ ++DLR    +  +
Sbjct: 363 RIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLL-ASGDDKGVWGVWDLRQFSPSQEN 421

Query: 280 MSG------HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNEDAQDAT-- 330
            S       H+G +T++ F+   +  +  +SED  + +WDL +E   E++ +   +    
Sbjct: 422 ASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKEL 481

Query: 331 ----PELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
               P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 482 EQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKTIS 525

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 127/290 (43%), Gaps = 45/290 (15%)

Query: 122 IISTIDGNGTVSIFDRNSSDSPVKTYSYHKDN----------------GYGLSFNPISK- 164
           + +T+  NG V +FD  +     +T  Y                    GYGL ++P+ K 
Sbjct: 233 LTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKT 292

Query: 165 GQLLSAADDGYIAMYDINAES----EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEK 220
           G LL+    G I +   +       + P   + + +N  + DI+W   ++T+F T S   
Sbjct: 293 GALLTGDCSGQIFLTQRHTSKWITDKQP---FTAANNQSVEDIQWSPTESTVFAT-SGTD 348

Query: 221 NTLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTR--- 274
             + I+D R+K    +I         N +++++    L ++   + +  ++DLR      
Sbjct: 349 GYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPAN 408

Query: 275 ----KTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE----- 324
               + +     H GP+T++ F+   D ++  +SED  + +WDL +E   +++ +     
Sbjct: 409 SEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEY 468

Query: 325 -DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            + Q   P+L+ +H   +  V D   +  IP  + ST  +  + VWK+ S
Sbjct: 469 KELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTIS 515

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 98/220 (44%), Gaps = 35/220 (15%)

Query: 122 IISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYI 176
           I   +D NG + +F +  +D+ +   S  K   +      L FNP  +  L SA ++G I
Sbjct: 79  IAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEI 138

Query: 177 AMYDINAESEDPVETWQSTDNCI------------INDIKWHHFDATLFGTVSEEKNTLS 224
            ++DIN       +T  STD               I  + W+   A +F +  +     S
Sbjct: 139 LIWDIN-------KTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYAS 191

Query: 225 IYDLRTKDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTR 274
           I+DL+ K +V  +    P   L           K +  + +A+G+D +  + ++DLRN+ 
Sbjct: 192 IWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSN 251

Query: 275 KTLHSMSG-HEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
             + ++ G H   + +L++    + +L+SS  D  + +WD
Sbjct: 252 MPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/407 (21%), Positives = 178/407 (43%), Gaps = 67/407 (16%)

Query: 24  PLMYDFVSETKLTWPSLTVEWLP--------HDPQAPLTQQEMIIGTHTSDQEPNYVKIA 75
           P +Y+ +    L W  +T++ +P        + PQ+ L    M   T  S ++ N + + 
Sbjct: 125 PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSIL----MTTATQASKKKDNELLVL 180

Query: 76  SI-ELPNEVIDPHNVSDA-----------PVKSNVRITKKFKLEKEITRSRYMVQDPNII 123
            + +L   ++      +            P+  N  I+ K    + I  S +  + P ++
Sbjct: 181 KMSQLTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLKDTTNR-IKISPFAAESPEVL 239

Query: 124 S-TIDGNGTVSIFDRN---------------SSDSPVKTYSYHKD-NGYGLSFNPISK-G 165
           + T+  NG   I+D                 ++  P+ +   H +  GYGL ++P+ K G
Sbjct: 240 AATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKTG 299

Query: 166 QLLSAADDGYIAMYDINAES-EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLS 224
            +L+    G + +    A       + +   +N  I DI+W   + T+F T   + + + 
Sbjct: 300 SILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKSIEDIQWSRAEMTVFATCGVDGH-IR 358

Query: 225 IYDLRTKDKVTSIEM---EQPFNSLAFSKHSKNLFSAAGTDQNVY-LYDLR-----NTRK 275
           I+D R+K    ++ +   +   N +++++    L  A+G D   + ++DLR     NT K
Sbjct: 359 IWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLL-ASGDDSGTWGVWDLRQFSAQNTEK 417

Query: 276 T--LHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQVNE------DA 326
           T  +   + H+  +T++ F+   + I+  +SED  + +WDL +E   E++ +      + 
Sbjct: 418 TTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETAEL 477

Query: 327 QDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           Q   P+L+ +H   +  V D   +  IP  + ST  +  + +WK+ S
Sbjct: 478 QQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWKTIS 521

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 106/207 (51%), Gaps = 23/207 (11%)

Query: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIN 201
           S V+  S+  DN + L F P+    LL++  +G + + D   E+ +PV  ++  D   IN
Sbjct: 4   SLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLD--WETLNPVRNFK-IDQVSIN 59

Query: 202 DIKWHHFD---ATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHSKNLF 256
            +K  + D   A+LF T +   N++ IYD+++ D + +I  + + PF SL  S+H  ++ 
Sbjct: 60  SMKLINNDYNNASLFATAT--LNSVKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DML 114

Query: 257 SAA----GTDQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           +      G D  +Y+YD+RN    + S +  H   +T+++FH S    L+S S D    +
Sbjct: 115 ACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNV 174

Query: 312 WDLMEIGSEQVNEDAQDATPELMMIHA 338
           +DL    ++Q  +DA         IH+
Sbjct: 175 YDL----TQQEEDDALYQVINYASIHS 197

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 134 IFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           I+D  +  SPVK++   H D+   + F+P     LLS + DGY  +YD+  + ED
Sbjct: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 102/214 (47%), Gaps = 25/214 (11%)

Query: 122 IISTIDGNGTVSIFDRNSSD---SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           II+    NG++ ++  N  +   S +  +S H  +   + FN      L S  ++G I +
Sbjct: 76  IIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFI 135

Query: 179 YDINAESEDPV--------ETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           +D+N  +E P         ++  S D   +N + W+   A +F +     N  SI+DL+ 
Sbjct: 136 WDMNKCTESPANYTPLTPGQSMSSVDE--VNSLAWNQSLAHVFASAGSS-NFASIWDLKA 192

Query: 231 KDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM 280
           K +V  +    P + +           K+S  + +A G+D +  + ++DLRN    L ++
Sbjct: 193 KKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 281 S-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           + GH+  + +L++    + +L+SS  D  +++W+
Sbjct: 253 NQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 72/180 (40%), Gaps = 21/180 (11%)

Query: 205 WHH------FDATLFGTVS---EEKNTLSIYDLRTKDK---VTSIEMEQPFNSLAFSKHS 252
           W H         T+ GTV       ++L ++ L   D    + S++++  FN L +S H+
Sbjct: 15  WSHDKIPLLVSGTVSGTVDANFSSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWS-HN 73

Query: 253 KNLFSAAGTDQNVYLYDLRNTRKTLHSM---SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309
             + + A  + ++ LY        + SM   S H   V  ++F+   D +L S   +  I
Sbjct: 74  NKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEI 133

Query: 310 IIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
            IWD+      +  E   + TP            VN  + N S+  + AS    N   +W
Sbjct: 134 FIWDM-----NKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 103/214 (48%), Gaps = 25/214 (11%)

Query: 122 IISTIDGNGTVSIFDRNSSDSPVKT---YSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           II+    NG++ ++  N +++ + +   +S H  +   + FN      L S  ++G I +
Sbjct: 76  IIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFI 135

Query: 179 YDINAESEDPV--------ETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           +D+N  +E P         ++  S D  I   + W+   A +F +     N  SI+DL+ 
Sbjct: 136 WDMNKCTESPSNYTPLTPGQSMSSVDEVI--SLAWNQSLAHVFASAGSS-NFASIWDLKA 192

Query: 231 KDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM 280
           K +V  +    P + +           K+S  + +A G+D +  + ++DLRN    L ++
Sbjct: 193 KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTL 252

Query: 281 S-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           + GH+  + +L++    + +L+SS  D  +++W+
Sbjct: 253 NQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 27/183 (14%)

Query: 205 WHH------FDATLFGTVSEEKNT---LSIYDLRTKDK---VTSIEMEQPFNSLAFSKHS 252
           W H         T+ GTV    +T   L ++ L   D    + S++++  FN L +S H+
Sbjct: 15  WSHDKIPLLVSGTVSGTVDANFSTDSSLELWSLLAADSEKPIASLQVDSKFNDLDWS-HN 73

Query: 253 KNLFSAAGTDQNVYLYDLRNTRKTLHSM---SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309
             + + A  + ++ LY        ++SM   S H   V  ++F+   D +L S   +  I
Sbjct: 74  NKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEI 133

Query: 310 IIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND---FSLNSSIPWLIASTEEENII 366
            IWD+      +  E   + TP   +      SSV++    + N S+  + AS    N  
Sbjct: 134 FIWDM-----NKCTESPSNYTP---LTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFA 185

Query: 367 QVW 369
            +W
Sbjct: 186 SIW 188

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 104/214 (48%), Gaps = 28/214 (13%)

Query: 125 TIDG---NGTVSIFD-RNSSDSPVKT--YSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           TI G   NGT+ ++   ++ D+ V T  +S H  +   + FN      L S  ++G I +
Sbjct: 76  TIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFI 135

Query: 179 YDINAESEDPV--------ETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRT 230
           +D+N  +E P         ++  S D   +N + W+   A +F +     N  SI+DL+ 
Sbjct: 136 WDMNKCTESPSSYTPLTPGQSMSSVDE--VNSLAWNQSLAHVFASAGSS-NFASIWDLKA 192

Query: 231 KDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM 280
           K +V  +    P + +           K+S  + +A G+D +  + ++DLRN    L ++
Sbjct: 193 KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 281 S-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           S GH+  + +L++    + +L+SS  D  +++W+
Sbjct: 253 SQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 72/179 (40%), Gaps = 19/179 (10%)

Query: 205 WHH------FDATLFGTVSEEKNT---LSIYDLRTKDK---VTSIEMEQPFNSLAFSKHS 252
           W H         T+ GTV    +T   L ++ L T D    + S++++  FN L +S ++
Sbjct: 15  WSHDKIPLLVSGTVSGTVDANFSTDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNN 74

Query: 253 KNLFSAA--GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII 310
           K +  A   GT +   + D  +T  +    S H   V  ++F+   D +L S   +  I 
Sbjct: 75  KTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIF 134

Query: 311 IWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           IWD+      +  E     TP            VN  + N S+  + AS    N   +W
Sbjct: 135 IWDM-----NKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIW 188

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 105/204 (51%), Gaps = 29/204 (14%)

Query: 149 YHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI-NAESEDPVETWQSTDNCIINDIKWHH 207
           Y ++N + L   P+ +  L+++  DG + + D  N ++   ++   ++    IND+K  +
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTS----INDMKVIN 65

Query: 208 FD---ATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLFSAAGT- 261
            D     +F T +E+   + ++D+R ++ V S++ ++  PF    FS  S++   A GT 
Sbjct: 66  SDFDTGAVFATAAEDG--VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLACGTE 119

Query: 262 ----DQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
               D  +++YD+RN  K + S +  H   +T+++FH     +L+S S D  + I+DL +
Sbjct: 120 LKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQ 179

Query: 317 IGSEQVNEDAQDATPELMMIHAGH 340
                  +D +DA  +++   + H
Sbjct: 180 -------DDEEDALHQVINFASIH 196

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 127 DGNGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES 185
           D +  + I+D  +   PV+++   H D+   + F+P     L+S + DGY+ +YD+  + 
Sbjct: 122 DYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDD 181

Query: 186 ED 187
           E+
Sbjct: 182 EE 183

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 97/216 (44%), Gaps = 19/216 (8%)

Query: 119 DPNIISTIDGNGTVSIFDRNS-SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
           D  II+    NG+V +F  N+ S      +  HK       FN      L +    G I 
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKSEAKFQRHKTTAKVARFNAKQFNVLATGGTKGEIF 132

Query: 178 MYDINAESEDPVE-TWQSTDNCI-----INDIKWHHFDATLFGTVSEEKNTLSIYDLRTK 231
           ++D+N   E+P + T  +  N +     I  + W+   A +F +     +  SI+DL+ K
Sbjct: 133 IWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGS-TSYASIWDLKAK 191

Query: 232 DKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSMS 281
            +V  +    P   L           K+S  + +A G+D +  + ++DLRN    L  +S
Sbjct: 192 KEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLS 251

Query: 282 -GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
            GH   V +L++ +  + +L+SS  D  +++W+  E
Sbjct: 252 QGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQE 287

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 104/222 (46%), Gaps = 25/222 (11%)

Query: 115 YMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYS------YHKDNGYGLSFNPISKGQLL 168
           + V + NI   +D NG + +F+ ++    +K+         HK +   L FN      L+
Sbjct: 70  WSVDNINIAGALD-NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLV 128

Query: 169 SAAD-DGYIAMYDINAESEDPVETWQS-TDNCIINDIKWHHFDATLFGTVSEEKNTLSIY 226
           S +D +G I ++D+N   + P+      T    I  + W+   + +F   S   N +SI+
Sbjct: 129 SGSDKNGEILIWDLNNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSN-VSIF 187

Query: 227 DLRTKDKVTSIEMEQPFNSLA--FSK---HSKNLFSAAGTDQN--------VYLYDLRNT 273
           DL+ K +V  +    P N++   FS    H KN    A    N        ++++DLRN+
Sbjct: 188 DLKAKKEVIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNS 247

Query: 274 RKTLHSMS--GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
              L  +S  GH   + +L++  + + +L+SS  D  +++W+
Sbjct: 248 HTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 96/226 (42%), Gaps = 37/226 (16%)

Query: 167 LLSAADDGYIAMYDINAESEDPVETWQSTDN----CIINDIKWHHFDATLFGTVSEEKNT 222
           +  A D+G I +++ + +S+        +D+      +  +K++   + L  + S++   
Sbjct: 77  IAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGE 136

Query: 223 LSIYDLRTKDKVTSIEMEQPFN------SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKT 276
           + I+DL   DK T +    P        SLA++K   ++FS +    NV ++DL+  ++ 
Sbjct: 137 ILIWDLNNLDK-TPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEV 195

Query: 277 LHSMSGHEGPVTN-------LEFHDSVDGILVS------SSEDRRIIIWDLMEIGSEQVN 323
           +H    +  PV N       +E+H      + +      S+E   I IWDL         
Sbjct: 196 IH--LNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLR-------- 245

Query: 324 EDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
                 TP  ++   GH + +      S+   L+ S+  +N + +W
Sbjct: 246 ---NSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLW 288

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 98/196 (50%), Gaps = 22/196 (11%)

Query: 153 NGYGLSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQST--DNCIINDIKWHHFD 209
           N + L   PI    LL++  +G + + D    +S   ++T  ++  D  IIN+ +    +
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDMVIINNDR---MN 89

Query: 210 ATLFGTVSEEKNTLSIYDLRTKDKVTSIE--MEQPFNSLAFSKHSKNLFSAA----GTDQ 263
            +L  T +E  + + IYDL++ D V +++     PF SL  S+H   L        G D 
Sbjct: 90  GSLIATAAE--DAVKIYDLKSNDCVATLKNGKSAPFLSLD-SRH--GLLGCGTELSGVDA 144

Query: 264 NVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQV 322
            +++YD+R+ ++ L S+   H   +T+++FH S   +L+S S D  + I+DL    ++Q 
Sbjct: 145 ELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL----TQQE 200

Query: 323 NEDAQDATPELMMIHA 338
            +DA         IH+
Sbjct: 201 EDDALHQVINFASIHS 216

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  + ++D  S   P+++    H D+   + F+P     LLS + DGY+ +YD+  + ED
Sbjct: 143 DAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEED 202

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 21/206 (10%)

Query: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES---EDPVE-TWQSTDN 197
           +   T S+  DN + L   P+    LLSA  +G++ + D N+ +   + PV  T  S   
Sbjct: 4   TKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALK 62

Query: 198 CIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNL 255
            + ND+         F T SE+  ++ I+DLR    V +++  +  PF SL  S+H    
Sbjct: 63  VLDNDVD----SGNTFVTASED--SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLA 115

Query: 256 FSA--AGTDQNVYLYDLRNTRKTLHSMS-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
                +GTD  ++LYDL+     + S    H   +T+++FH S   +L+S S D  + ++
Sbjct: 116 CGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175

Query: 313 DLMEIGSEQVNEDAQDATPELMMIHA 338
           DL     +Q  E+A         IH+
Sbjct: 176 DL----KQQEEEEALHQVINFASIHS 197

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 132 VSIFDRNSSDSPVKTYS-YHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           + ++D    D+P++++   H D+   + F+      LLS + DGY+ +YD+  + E+
Sbjct: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 83/168 (49%), Gaps = 11/168 (6%)

Query: 153 NGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATL 212
           N + L   P+  G +L++   G + +  ++   +D  +  +++    IN +        L
Sbjct: 13  NNWCLKLQPVHNG-ILTSVSSGEVHLLGLDLSKQDSFKVGETS----INALSRVDGQENL 67

Query: 213 FGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAF-SKHSKNLFSA--AGTDQNVYLYD 269
           F   +   N + ++DLR   +V ++E E   N L+  S H    + +   G D +++L+D
Sbjct: 68  F--AASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFD 125

Query: 270 LRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
           +RN  K + S +  H+  +T++ FH +   +L+S S D    ++DL+E
Sbjct: 126 IRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLE 173

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 19/147 (12%)

Query: 59  IIGTHTSDQEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKL-EKEITRSRYMV 117
           ++G   S Q+   V   SI   + V    N+  A   SN    K F L E +   +    
Sbjct: 37  LLGLDLSKQDSFKVGETSINALSRVDGQENLFAA---SNGNKVKVFDLRENKEVATLEQE 93

Query: 118 QDPNIISTIDGNGTVS-------------IFDRNSSDSPVKTY-SYHKDNGYGLSFNPIS 163
              N++S   G+G ++             +FD  +   PV+++   H+D+   ++F+P  
Sbjct: 94  NGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPAD 153

Query: 164 KGQLLSAADDGYIAMYD-INAESEDPV 189
              LLS + DGY  +YD +  E ED +
Sbjct: 154 ANVLLSGSTDGYTNVYDLLEPEEEDAL 180

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 88/185 (47%), Gaps = 17/185 (9%)

Query: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198
           + +YS  + N +G     L   P  K  LL+   +G I + D +      V+  ++++  
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKS--VQKIKASETA 58

Query: 199 IINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFS 257
           I ND+K    D +    VS    + + ++D+RT D++  I+ E   NS   S  S++   
Sbjct: 59  I-NDMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEA--NSPFISLDSRHGLL 115

Query: 258 AAGT-----DQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           A GT     D  VY+YD+R     L S+   H   VT ++FH S   IL+S S D    I
Sbjct: 116 ACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNI 175

Query: 312 WDLME 316
           +DL +
Sbjct: 176 YDLKQ 180

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  V I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 125 DAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 96/183 (52%), Gaps = 15/183 (8%)

Query: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQST--DNC 198
           S V + ++  DN + L   P+    LL++  +G + + D +  +    ++   +T  D  
Sbjct: 4   SKVDSINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMV 62

Query: 199 IINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLF 256
           ++N+ + + F   L  T +E+  ++ I+DLR+ D V +++ E+  PF SL  S+H     
Sbjct: 63  VLNNDRNNGF---LIATAAED--SVKIFDLRSSDTVATLKNEKSAPFLSLD-SRHGMLAC 116

Query: 257 SA--AGTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
               +G D  +++YD++   + L S+   H   +TN++FH +   +L+S S D  + I+D
Sbjct: 117 GTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYD 176

Query: 314 LME 316
           L +
Sbjct: 177 LTQ 179

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           + I+D  +   P+++    H D+   + F+P     LLS + DGY+ +YD+    ED
Sbjct: 127 LHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPEED 183

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 21/204 (10%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           D  ++   DGNG +  F     +   +   +HK+N    SF  ++ G          I +
Sbjct: 156 DTKVLHPSDGNGLIKTF---YGEHAFQGIDHHKEN---TSF--VTGG--------AQIEL 199

Query: 179 YDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIE 238
           +DIN        +W   DN  I  +K++  +A L  + S   N++ +YDLRT      I 
Sbjct: 200 WDINRRKPLSNLSW-GIDN--ITAVKFNQNEADLLLS-SGSDNSVVLYDLRTNSPTQKIV 255

Query: 239 MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG 298
                NS+ ++      F  A  DQN Y YD+RN  + LH    H   + +++   + + 
Sbjct: 256 QTMKTNSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTGEE 315

Query: 299 ILVSSSEDRRIIIWDLMEIGSEQV 322
           I V+ S D+ I I+++    S +V
Sbjct: 316 I-VTGSYDKTIRIFNIKHGHSREV 338

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 78/186 (41%), Gaps = 27/186 (14%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE----------------DPVETWQ 193
           H+D  Y ++ N     +L SA+ DG +  ++I+   E                 P     
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREELCSFKAHYGLVTGLCVSPQHIGN 125

Query: 194 STDNCIIND-----IKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAF 248
            +D+ +++      +K    D+  F  V ++   L   D      + +   E  F  +  
Sbjct: 126 QSDSYMLSCGDDKMVKMWSVDSGDFNNVKDDTKVLHPSD--GNGLIKTFYGEHAFQGI-- 181

Query: 249 SKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRR 308
             H +N     G  Q + L+D+ N RK L ++S     +T ++F+ +   +L+SS  D  
Sbjct: 182 DHHKENTSFVTGGAQ-IELWDI-NRRKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNS 239

Query: 309 IIIWDL 314
           ++++DL
Sbjct: 240 VVLYDL 245

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 108/259 (41%), Gaps = 22/259 (8%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           N +    G+G++ +FD      P+  +  HK      ++N I+KG  +S++ DG + M+ 
Sbjct: 75  NQVLVAQGDGSLRLFDTTLQKYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKMWS 134

Query: 181 -INAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEM 239
            +  +S   +    S  +  IN    H+  A +   V+  ++T     L+ KD V   + 
Sbjct: 135 PLREQSLLTLLPKSSEQSSKIN----HNQIAKIPPHVNNNQSTPI---LQNKDCVYQAQ- 186

Query: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLR--NTRKTLHSMSGHEGPVT-NLEFHDSV 296
                   FS H  NL +    +  + L+D R  N R   +S   H G  T  L+F+   
Sbjct: 187 --------FSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYR 238

Query: 297 DGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMM--IHAGHRSSVNDFSLNSSIP 354
             +L SS  D  I IWD+  I +   N      +  + M  I   H  +V     +    
Sbjct: 239 PTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQS 298

Query: 355 WLIASTEEENIIQVWKSSS 373
            L+ ST  +   +VWK  S
Sbjct: 299 NLLLSTSYDMTSKVWKDFS 317

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT 235
           I ++DIN        +W   DN  IN +K++  DA + G+   + N++ +YDLRT     
Sbjct: 198 INLWDINRSKPLSDLSW-GADN--INTVKFNQNDANVLGSAGSD-NSIVLYDLRTNSATQ 253

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            I      NS+ ++      F  A  D N Y YD+RN  + L+    H   V +++   +
Sbjct: 254 KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPT 313

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQV 322
            + + V++S D+ I I+ + +  S ++
Sbjct: 314 GEEV-VTASYDKTIRIFPINKGHSREI 339

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 10/114 (8%)

Query: 126 IDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI--NA 183
           + G   ++++D N S  P+   S+  DN   + FN      L SA  D  I +YD+  N+
Sbjct: 192 VTGGPRINLWDINRS-KPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNS 250

Query: 184 ESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI 237
            ++  V+T +      +N + W+  +A  F   SE+ N    YD+R   +  ++
Sbjct: 251 ATQKIVQTMR------VNSMCWNPMEAFNFVVASEDHNAY-YYDMRNMSRALNV 297

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 88/186 (47%), Gaps = 19/186 (10%)

Query: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198
           + +YS    N +G     L   P  K  LL+   +G I + D N  +  P++  ++++  
Sbjct: 1   MNSYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWN--TGKPLQKIRASETA 58

Query: 199 IINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHSKNL 255
           I ND+K    D      +S    +++ ++D+R+ D V  I  E   PF SL  S+H   L
Sbjct: 59  I-NDMKIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLD-SRHG--L 114

Query: 256 FSAA----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRII 310
            +      G D  +++YD+R     L S+   H   VT ++FH S   +L+S S D    
Sbjct: 115 LACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTN 174

Query: 311 IWDLME 316
           I+DL +
Sbjct: 175 IYDLKQ 180

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  + I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 125 DAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDDEE 184

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 97/189 (51%), Gaps = 21/189 (11%)

Query: 143 PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINA-ESEDPVETWQSTDNCIIN 201
           P+   S+  +N + L F P+    LL++  +G I++ D    + +D ++  +++    IN
Sbjct: 5   PINLTSFGSNN-WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETS----IN 59

Query: 202 D---IKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLF 256
           D   +  ++   +L  T + E  ++ IYDL++ D + +I  E+  PF SL  S H  N+ 
Sbjct: 60  DFEIVNNNYNGGSLMVTATNE--SVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMM 114

Query: 257 SAA----GTDQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           +      G D  +Y+YD+R+    + S +  H   +T+++FH +   +L+S S D    I
Sbjct: 115 ACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNI 174

Query: 312 WDLMEIGSE 320
           +DL E   E
Sbjct: 175 YDLTETEEE 183

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 88/187 (47%), Gaps = 9/187 (4%)

Query: 136 DRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQST 195
           +++S+D  +KT+  H D  +    +  SK   ++A  +  I ++D +        +W   
Sbjct: 159 EQSSTDGLIKTF--HGDYAFLGIDHHRSKPYFVTAGAE--INLWDSSRSRPTANLSW-GA 213

Query: 196 DNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNL 255
           DN  ++ +K++  +  +F +   + N++ +YDLRT             N+L ++      
Sbjct: 214 DN--VSTVKFNQNETDIFASAGSD-NSVVLYDLRTNSPTQKFTQRMRTNALCWNPMEAYN 270

Query: 256 FSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           F  A  D N Y YD+RN  + LH    H   V +++F  + D I V+ S D+ I I+ + 
Sbjct: 271 FVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIYQVK 329

Query: 316 EIGSEQV 322
              S +V
Sbjct: 330 HGHSREV 336

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 93/218 (42%), Gaps = 44/218 (20%)

Query: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLS 169
           +T++R+     NI++T D  G + I+D N      K  +  +  G   ++ P     +L 
Sbjct: 113 VTQARFHSLQSNILATGDSKGGILIWDTN------KCLTKAQGGGVVSTYTP-----MLP 161

Query: 170 AADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           AA          N  SE+PV+       C+     W+   A +F + +   +  SI+DL+
Sbjct: 162 AA----------NKSSEEPVQ-------CLA----WNKKQAHIFAS-TNSTSFASIWDLK 199

Query: 230 TKDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHS 279
            K  V  +    P   L             S  + +  G D    V ++DLRN    L  
Sbjct: 200 AKKDVLHLSYTSPLTGLKPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRNANTPLQE 259

Query: 280 MSG-HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
           ++G H   + +L++    + +L+SS  D  +++W+ +E
Sbjct: 260 LTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWNPIE 297

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 43/116 (37%), Gaps = 9/116 (7%)

Query: 256 FSAAGTDQNVYLYDLRNTRKTLHSMSG-HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
           F +AG D         N  K+L S+ G H G VT   FH     IL +      I+IWD 
Sbjct: 88  FYSAGADNG-------NELKSLGSIEGKHAGAVTQARFHSLQSNILATGDSKGGILIWDT 140

Query: 315 ME-IGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
            + +   Q        TP L   +      V   + N     + AST   +   +W
Sbjct: 141 NKCLTKAQGGGVVSTYTPMLPAANKSSEEPVQCLAWNKKQAHIFASTNSTSFASIW 196

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN-AESEDPVETWQSTDN 197
           SS S V++ S+  +N + L   P  K  LL+   +G I + D N  +S   ++  +++  
Sbjct: 2   SSYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS-- 58

Query: 198 CIINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHSKN 254
             IND+K    D      VS    + + ++D+RT   V  I  E   PF SL  S+H   
Sbjct: 59  --INDLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRH--G 113

Query: 255 LFSAA----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309
           L +      G D  VY+YD+R     L S+   H   VT ++FH S   +L+S S D   
Sbjct: 114 LLACGTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYT 173

Query: 310 IIWDLME 316
            I+DL +
Sbjct: 174 NIYDLKQ 180

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  V I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 125 DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184

>KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} similar
           to uniprot|P20484 Saccharomyces cerevisiae YKL021C MAK11
           Protein essential for cell growth and replication of M
           dsRNA virus contains four beta-transducin repeats
          Length = 390

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 25/127 (19%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG---------ILVS 302
           SK    +   D+N+ +YDL+  RK L ++ GH+G +TNL F    D           L+S
Sbjct: 50  SKRYLVSGSNDENIRIYDLQK-RKELGTLLGHQGSITNLRFSRGKDADGQDIQLNKWLLS 108

Query: 303 SSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEE 362
           +SED +II+W + +               E      GH + +NDF ++ S   +  S  E
Sbjct: 109 ASEDHKIIVWRVKDW--------------ENFGTLKGHTARINDFDIHPS-NRVAVSVSE 153

Query: 363 ENIIQVW 369
           ++ I++W
Sbjct: 154 DHSIRLW 160

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 2/123 (1%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           ++ +K++  +  +F +   + N++ +YDLRT         +   N+L ++      F  A
Sbjct: 217 VSTVKFNQNETDIFASAGSD-NSVVLYDLRTNSPTQKFVQKMRTNALCWNPMEAYNFVVA 275

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGS 319
             D N Y YD+RN  + LH    H   V +++F  + D I V+ S D+ I I+ +    S
Sbjct: 276 NEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIYQVKHGHS 334

Query: 320 EQV 322
            ++
Sbjct: 335 REI 337

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 85/175 (48%), Gaps = 18/175 (10%)

Query: 156 GLSFNPISKGQ--LLSAADDGYIA---------MYDINAESEDPVETWQSTDNCIINDIK 204
           G+S NPI  G   + + ++DG I          + D+ A+S   +    + D   I  ++
Sbjct: 9   GVSLNPIYAGSSAVATVSEDGKILATPILDEINIIDLTADSRKILHKISNEDEQEITALQ 68

Query: 205 WHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQN 264
               D      VS+ +  L I+ L+T   V S+++  P + +  +  +  L +  GTD +
Sbjct: 69  LTP-DGQYLTYVSQAQ-LLKIFQLKTGKVVRSMKISSP-SYILDTDSTSTLLAVGGTDGS 125

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
           + + D+ N   T HS+ GH G +++L+F+  +D    +L S   +  + +WDL++
Sbjct: 126 IIVVDIENGYIT-HSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVK 179

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 95/215 (44%), Gaps = 23/215 (10%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKT---YSYHKDNGYGLSFNPISKGQLLSAADDGY 175
           D  II+    +G V +F  +S+   +K+   +  H+     + FN      L S    G 
Sbjct: 73  DDKIIAGALDSGVVELF--SSTGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGE 130

Query: 176 IAMYDIN-----AESEDPVETW-QSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           I ++D+N     +E   P+     ST    +  + W+   A +F +     +  SI+DL+
Sbjct: 131 IYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGS-TSYASIWDLK 189

Query: 230 TKDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHS 279
            K +V  +    P   L           K+S  + +A G+D    + ++DLRN    L  
Sbjct: 190 AKKEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQV 249

Query: 280 MS-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +S GH   + +L++    + +L+SS  D  I++W+
Sbjct: 250 LSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 91/215 (42%), Gaps = 43/215 (20%)

Query: 189 VETWQSTDNCIINDIKW--HHFDATLFGTVSEEKNTLS---------IYDLRTKDK---- 233
           VE + ST + + ++ ++  H   A      S++ N L+         I+DL T  K    
Sbjct: 86  VELFSSTGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIYIWDLNTCLKNSEG 145

Query: 234 -------VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLH-----SMS 281
                  V S  +E+   SLA+++   ++F++AG+     ++DL+  ++ +H       +
Sbjct: 146 YTPLTPGVASTPIEE-VTSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSYASPST 204

Query: 282 GHEGPVTNLEFH---DSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHA 338
           G +  ++ +E+H    +       S  +  I++WDL            ++A   L ++  
Sbjct: 205 GLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDL------------RNANTPLQVLSK 252

Query: 339 GHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           GH   +      S    L+ S+  +N I +W   S
Sbjct: 253 GHSKGILSLDWCSQDEELLLSSGRDNTIVLWNPES 287

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 65/177 (36%), Gaps = 17/177 (9%)

Query: 205 WHH------FDATLFGTVS---EEKNTLSIYDLRTKDKV---TSIEMEQPFNSLAFSKHS 252
           W H         T  GTV      ++ L ++ L   D      S+ ++  FN L +S   
Sbjct: 15  WSHERIPSLVTGTASGTVDANFSSESALELWSLLASDPSKPKASLAVDAKFNDLDWSNDD 74

Query: 253 KNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
           K +  A  +          ++ K+      H+G    ++F+   + +L S      I IW
Sbjct: 75  KIIAGALDSGVVELFSSTGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIYIW 134

Query: 313 DLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           DL         ++++  TP    + +     V   + N S+  + AS    +   +W
Sbjct: 135 DL-----NTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIW 186

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 68/147 (46%), Gaps = 5/147 (3%)

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT 235
           I ++D N        +W   DN  IN ++++  +  +  +   + N++ +YDLRT     
Sbjct: 194 IELWDTNRSKPISNLSW-GADN--INHVRFNQNEVDILASTGSD-NSVVLYDLRTNSPTQ 249

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            I      NS+ ++      F  A  D N Y YD+RN  K LH    H   V +++F  +
Sbjct: 250 KIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSPT 309

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQV 322
            D + V+ S D+ I I+ +    S ++
Sbjct: 310 GDEV-VTGSYDKTIRIYQVKHGHSREI 335

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT 235
           I ++D+N +      +W   DN  ++ ++++  +  +  +   + N++ +YDLRT     
Sbjct: 198 IQLWDVNRKKPLSNLSW-GVDN--VSFVRFNQNEEDILASTGSD-NSIVLYDLRTNSPTQ 253

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            +      N+L ++      F+ A  D N Y YD+RN  + LH    H   V +++F  +
Sbjct: 254 KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPT 313

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQV 322
            + I V+ S D+ I I++L    S +V
Sbjct: 314 GEEI-VTGSYDKTIRIFNLKHGHSREV 339

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 5/103 (4%)

Query: 217 SEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKT 276
           + +   L  YDL TK    S+++  P   L   + S  L +  GTD +V ++D+ N   T
Sbjct: 78  ASQNQLLRFYDLETKRTTRSMKISSPAYVLDCDE-SSTLLAVGGTDGSVNVFDIANGYVT 136

Query: 277 LHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
            HS+ GH   +++++F+  VD    +L S   +  + IWDL++
Sbjct: 137 -HSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVK 178

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/331 (20%), Positives = 122/331 (36%), Gaps = 70/331 (21%)

Query: 110 ITRSRYMVQDP-----------NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLS 158
           +TR  Y+ QD            N      G+G++ +FD      PV  Y  H+D     +
Sbjct: 52  VTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDKYPVAVYQEHRDEVASCN 111

Query: 159 FNPISKGQLLSAADDGYIAMYDIN----------------AESEDPVETWQSTDNCIIND 202
           ++ I +   +S+  DG + ++ +                 A  + P  T  +     +  
Sbjct: 112 WSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQ 171

Query: 203 IKWHHFDATLFGTVSEEKNTLSIYDLRT---KDKVTSIEMEQPFN---SLAFSKHSKNLF 256
            K+   D +L    S + +T+S++DLR        T   M    +   S+ F+K+  N+ 
Sbjct: 172 AKFSPHDDSLMVCCSGD-STVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVI 230

Query: 257 SAAGTDQNVYLYDLRNTRK---------------------TLHSMSGHEGPVTNLEFHDS 295
           +  G D  + ++DLR  R                      T   + GHE  V  + +   
Sbjct: 231 ATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPH 290

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQV------------NEDAQDATPELMMIHAGHRSS 343
               L+S+S D    IW  M   +++               +A D    L+     H   
Sbjct: 291 SSNYLLSTSYDMTCCIWQDMGYATDRTRGNNSGYGVTTGRTNASDLRNGLVSRFTAHTEF 350

Query: 344 V--NDFSLNSSIPWLIASTEEENIIQVWKSS 372
           V   D+SL  + P  +A+T  +  + VWK +
Sbjct: 351 VFDGDWSLWGA-PGFVATTGWDGNVFVWKGT 380

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 100/217 (46%), Gaps = 42/217 (19%)

Query: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIN 201
           S + T S+  +N + L   P+    LL++  +G+I + D           W + +  II+
Sbjct: 4   SKLHTASFGCEN-WCLQLQPLYNRGLLTSLSNGHIHLVD-----------WCTGE--IIH 49

Query: 202 DIKWH-------------HFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSL 246
           +   H               ++ LF + S  K+++ I+D+RT   V ++  ++  PF SL
Sbjct: 50  EFAAHSASISNLKVLNNEFTNSDLFASAS--KDSVKIFDVRTSSCVATLHNDKSAPFLSL 107

Query: 247 AFSKHSKNLFSA--AGTDQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSS 303
             S+H         +G D  +++YD++   K L S +  H   +T+ +FH    G+L+S 
Sbjct: 108 D-SRHDMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSG 166

Query: 304 SEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGH 340
           S D  + I+DL        N D +DA  +++   + H
Sbjct: 167 STDGYVNIYDL-------TNSDEEDALHQVINFASVH 196

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 19/121 (15%)

Query: 72  VKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRY-MVQDPNIISTIDGNG 130
           VKI  +   + V   HN   AP  S                SR+ M+     +S +D   
Sbjct: 82  VKIFDVRTSSCVATLHNDKSAPFLS--------------LDSRHDMLACGTELSGVDAE- 126

Query: 131 TVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI-NAESEDP 188
            + I+D      P++++   H D+     F+P   G L+S + DGY+ +YD+ N++ ED 
Sbjct: 127 -LHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSDEEDA 185

Query: 189 V 189
           +
Sbjct: 186 L 186

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 78/169 (46%), Gaps = 17/169 (10%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +NPI    L+S++ D    ++D+  +S + V+T     +  + D+++      LF +   
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGG 297

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFN------------SLAFSKHSKNLFSAAGTDQN-V 265
           +  ++ ++DLR+    T I  E P +             L  S H  N+ +    D N +
Sbjct: 298 D-GSVRVFDLRSLAHSTII-YEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKI 355

Query: 266 YLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
            + D+RN    L  + GH   V  +++H     +L+S  +D +++ WDL
Sbjct: 356 LILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 118 QDPNIISTIDGNGT-VSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176
            DPN+++T   +   + I D  + +SP+     H  +   + ++PI +  LLS  DD  +
Sbjct: 340 HDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQV 399

Query: 177 AMYDIN--AESEDPVETWQSTD 196
             +D+N    S DPV T +  D
Sbjct: 400 LYWDLNKCTASSDPVATTKDDD 421

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 223 LSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSG 282
           L IY L +K  V S+++  P   +   + S  L    GTD +V ++D+ N   T HS  G
Sbjct: 84  LRIYSLASKKIVRSMKVSSPVYVMDCDETS-TLLVIGGTDGSVSIFDIENGYVT-HSFKG 141

Query: 283 HEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
           H G +++++F+  +DG   +L S   +  + IWDL++
Sbjct: 142 HGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVK 178

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 80/171 (46%), Gaps = 19/171 (11%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +NPI    L+S++ D    ++D+  ES + V+T     +  + D+++      LF +   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDL--ESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGG 313

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFN--------------SLAFSKHSKNLFSAAGTDQN 264
           +  ++ ++DLR+    T I  E P                 L  S H  N+ +    D N
Sbjct: 314 D-GSVRVFDLRSLAHSTII-YEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSN 371

Query: 265 -VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
            + + D+RN    + ++ GH   +  +++H +   IL+S ++D +++ WDL
Sbjct: 372 KIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 118 QDPNIISTIDGNGT-VSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176
            DPNI++T   +   + I D  + ++PV T   H  +   + ++P  +  LLS ADD  +
Sbjct: 358 HDPNIVATFAADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQV 417

Query: 177 AMYDINA 183
             +D+N+
Sbjct: 418 LYWDLNS 424

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH   GHEGPV  ++FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEGHEGPVRAVDFHPT-QPIFVSAGDDASIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T   +    GH   V     +S +PW+I++++++ + I  W++   L  ++    
Sbjct: 83  ----ETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-- 315
           +A  DQ V +++ +N RK L  ++GH   V   +FH + D ++VS+S D  + +WD+   
Sbjct: 112 SASDDQTVRIWNWQN-RKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDISGL 169

Query: 316 --------------EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                          + S+Q   D      ++  I  GH   VN  S + ++P LI +  
Sbjct: 170 RKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLP-LIVTGG 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ SS
Sbjct: 229 DDRQVKLWRMSS 240

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 11/117 (9%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L    G D+ V L+ + + +   + +  GH   V  + FH   + IL S +ED+ + IWD
Sbjct: 223 LIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLIL-SVAEDKTLRIWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEEN 364
           L +    +  +   D      + P + +  A H S +  F L+   P   A+T  +N
Sbjct: 282 LDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRERP---AATTYQN 335

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQSTDN 197
           + +YS  + N +G     L   P  K  LL+   +G I + D    +S   ++  ++   
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETA-- 58

Query: 198 CIINDIKWHHFDATLFGTVSEEK-NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
             IND+K    D +    VS    + + ++D+RT   + +I+ E   NS   S  S++  
Sbjct: 59  --INDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNES--NSPFLSLDSRHGL 114

Query: 257 SAAGT-----DQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRII 310
            A GT     D  V++YD+R     L S+   H   VT ++FH S   IL+S S D    
Sbjct: 115 LACGTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTN 174

Query: 311 IWDLME 316
           I+DL +
Sbjct: 175 IYDLKQ 180

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  V I+D    D+P+++    H D+   + F+P     LLS + DGY  +YD+  + E+
Sbjct: 125 DAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEE 184

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 87/219 (39%), Gaps = 33/219 (15%)

Query: 118 QDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
           +D +I++    NG V  F      S V     H      L FN      L+S    G I 
Sbjct: 72  KDGSILAGALDNGVVEFFKPEELRS-VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIY 130

Query: 178 MYDIN------------AESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSI 225
           ++D N              +  P+E  QS        + W+   A +F +        SI
Sbjct: 131 VWDTNKIATQGYSPFGPGVAMTPIEEVQS--------LAWNQTLAHVFASAGSS-GFASI 181

Query: 226 YDLRTKDKVTSIEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRK 275
           +DL+ K +V  +    P + L            +S  + +A G D    + ++DLRN+  
Sbjct: 182 WDLKAKKEVIHLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNA 241

Query: 276 TLHSMS-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
            L  +S GH   + +L++    D +++SS  D   I+W+
Sbjct: 242 PLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILWN 280

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 8/117 (6%)

Query: 210 ATLFGTVSEE---KNTLSIYDLRTKDKVTSIEM---EQPFNSLAFSKHSKNLFSAAGTDQ 263
            T  GTV  +    +TL ++ + ++D  T   M   +  FN L +SK    L  A   D 
Sbjct: 26  GTASGTVDADFSSASTLELWSVLSRDARTPQGMIVADAKFNDLEWSKDGSIL--AGALDN 83

Query: 264 NVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSE 320
            V  +      +++  +  H   V  L F+     +LVS      I +WD  +I ++
Sbjct: 84  GVVEFFKPEELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQ 140

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH   GHEGPV  ++FH +   I  SS +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEGHEGPVRGIDFHPT-QPIFASSGDDSTIKLWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   +     +  +PW+I++++++ I I  W++   L  I+    
Sbjct: 83  ----DTNKCLYTFTGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKELACITGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 65/133 (48%), Gaps = 22/133 (16%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           +A  DQ + +++ +N RK L  ++GH   V   +FH + D ++VS+S D  + +WD+  +
Sbjct: 112 SASDDQTIRIWNWQN-RKELACITGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISAL 169

Query: 318 GSEQVNEDAQDATPELMM-----------------IHAGHRSSVNDFSLNSSIPWLIAST 360
              + +    D   E+M+                 I  GH   VN  + + ++P LI S 
Sbjct: 170 --RKKHSAPVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATFHPTLP-LIVSG 226

Query: 361 EEENIIQVWKSSS 373
            ++  +++W+ S+
Sbjct: 227 SDDRQVKLWRMSA 239

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  +   D+ V L+ +  T+   + +  GH   V  + FH     +++S+ ED+ + +WD
Sbjct: 222 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHSNNVDCVIFHPH-QNLIISAGEDKTLRVWD 280

Query: 314 L---MEIGSEQVNED---AQDATPELMMIHAGHRSSVNDFSLNSSIP 354
           L   M +   + ++D      A P + +  A H S +  F L+   P
Sbjct: 281 LDKRMPVKQFKRDDDRFWLIAAHPHINLFGAAHDSGIMIFKLDRERP 327

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 52/266 (19%), Positives = 105/266 (39%), Gaps = 64/266 (24%)

Query: 147 YSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI------I 200
           +  H+    G+ F+P ++    S+ DD  I ++ ++            T+ C+      +
Sbjct: 49  FEGHEGPVRGIDFHP-TQPIFASSGDDSTIKLWSLD------------TNKCLYTFTGHL 95

Query: 201 NDIKWHHFDATLFGTVSE-EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           + I+   F   L   +S  +  T+ I++ + + ++  I     F   A    +++L  +A
Sbjct: 96  DYIRTVFFHKELPWIISASDDQTIRIWNWQNRKELACITGHNHFVMCAQFHPTEDLVVSA 155

Query: 260 GTDQNVYLYDLRNTRKTLHS-----------------------------MSGHEGPVTNL 290
             D+ V ++D+   RK  HS                             + GH   V   
Sbjct: 156 SLDETVRVWDISALRKK-HSAPVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWA 214

Query: 291 EFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLN 350
            FH ++  ++VS S+DR++ +W +    + +V+               GH ++V D  + 
Sbjct: 215 TFHPTLP-LIVSGSDDRQVKLWRMSATKAWEVD------------TCRGHSNNV-DCVIF 260

Query: 351 SSIPWLIASTEEENIIQVWKSSSRLP 376
                LI S  E+  ++VW    R+P
Sbjct: 261 HPHQNLIISAGEDKTLRVWDLDKRMP 286

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 102/229 (44%), Gaps = 29/229 (12%)

Query: 156 GLSFNPISKGQ--LLSAADDGYIA---------MYDINAESEDPVETWQSTDNCIINDIK 204
           G+S NPI  G   + + +++G I          + D+   S + +    + D   I  +K
Sbjct: 9   GVSLNPIYAGSSAVATVSENGTILATPMLDEINIIDLTPGSRNIIHRISNEDEQEITALK 68

Query: 205 WHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQN 264
               D      VS+ +  L I+ L+T   V S+++  P + +  +  +  L +  GTD +
Sbjct: 69  LTP-DGQYLTYVSQAQ-LLKIFHLKTGKVVRSMKISSP-SYILDADSTSTLLAVGGTDGS 125

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLMEIGSEQ 321
           + + D+ N   T HS  GH G +++L+F+  +D    +L S   +  + +WDL++     
Sbjct: 126 IIVVDIENGYIT-HSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRKCLH 184

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL-IASTEEENIIQVW 369
             ++   A   L ++             NS  P+L + S   ++II +W
Sbjct: 185 TLQEHSSAVRGLDIVEVQ----------NSDEPFLKLLSGGRDDIINIW 223

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 95/185 (51%), Gaps = 11/185 (5%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+  GL+++P    ++++AA+DG I ++D+   S   + T+ S     
Sbjct: 327 SESYILKQQGHFDSLNGLTYSP-DGARVVTAANDGKIKVWDV--VSGFCLATF-SEHTSS 382

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL-RTKDKVTSIEMEQ-PFNSLAFSKHSKNLFS 257
           +  +++      LF   S    T+  +DL R ++  T    ++ PFN LA     + + +
Sbjct: 383 VTAVQFAKRGQVLFS--SSLDGTVRAWDLIRFRNFRTFTSTQRIPFNCLAVDPSGEVVCA 440

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
            +     ++++ ++ T + L S+ GHEGPV+ L F    + +L S+S D+ I IW +   
Sbjct: 441 GSSDSFEIHVWSVQ-TGQLLDSLDGHEGPVSCLAFSQE-NSVLASASWDKTIRIWSIFS- 497

Query: 318 GSEQV 322
            S+QV
Sbjct: 498 RSQQV 502

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 115/291 (39%), Gaps = 52/291 (17%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMY-------- 179
           G+G++ +FD    D P+  Y  H+   +  ++N I K   +S++ DG + ++        
Sbjct: 81  GDGSLRLFDIKLKDYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSL 140

Query: 180 ------DINAESE-------DPVETWQSTDN----------CIINDIKWHHFDATLFGTV 216
                 D NA S         PV    S             CI       H D  L    
Sbjct: 141 MTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPH-DPNLV-LC 198

Query: 217 SEEKNTLSIYDLRTKDKVT---SIEMEQPFNSLA--FSKHSKNLFSAAGTDQNVYLYDLR 271
           S   + +S+YDLR  +             F +L   F+K+  ++ +  G D+ + ++DLR
Sbjct: 199 SSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLR 258

Query: 272 NTRKTL---------HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW-DLMEIGSEQ 321
             RK L         + + GHE  V  + +      +L+S+S D    +W DL + G   
Sbjct: 259 MCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLLSTSYDMTCRVWTDLSDDGHGL 318

Query: 322 VNE-DAQDATPELMMIHAGHRSSV--NDFSLNSSIPWLIASTEEENIIQVW 369
             + ++ D       I   H   V   D+SL  + P  +AST  +  + +W
Sbjct: 319 TGKTNSIDPAHGCRFIFMEHSEFVFGADWSLWGT-PGFVASTGWDGQVCIW 368

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 83/224 (37%), Gaps = 39/224 (17%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNG-YGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG + I D   +   V++ S+   +G + L++N   + Q L A  DG + ++DI  + +
Sbjct: 36  GNGKLIILDIMPNGQLVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLK-D 94

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKN-------------TLSIYDLRTKDK 233
            P+  ++     + +   W+     +F + S +               T+S  D      
Sbjct: 95  YPIAIYKEHQREVFS-CNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAAST 153

Query: 234 VTSIEMEQPFN--------------------SLAFSKHSKNLFSAAGTDQNVYLYDLRNT 273
           ++      P                         FS H  NL   +  +  + LYDLR  
Sbjct: 154 LSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVP 213

Query: 274 RKTL--HSMSGHEG-PVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
              L  H   GH G      +F+     I+ +   D+ I +WDL
Sbjct: 214 NNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDL 257

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 18/150 (12%)

Query: 217 SEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKT 276
           + +   L I+DLR    V S+++  P + +  S  +  L +  GTD ++ + D+ N   T
Sbjct: 78  ASQAQLLKIFDLREGKIVRSMKISSP-SYVVDSDSTSTLLAIGGTDGSITVVDVENGYVT 136

Query: 277 LHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME-------------IGSE 320
            HS+ GH G +++++F+   +G   +L S   +  + IWDL++             +   
Sbjct: 137 -HSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGI 195

Query: 321 QVNEDAQDATPELMMIHAGHRSSVNDFSLN 350
             +E   +   EL +I  G    +N +  N
Sbjct: 196 DFHESKNNDESELFLISGGRDDVINYWQFN 225

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 213 FGTVSEEKNTLSIYDLRTKD-KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLR 271
           F T S +K T  ++DL + + K T     +    +AF ++ + + + +G D+ + ++ L 
Sbjct: 500 FATASYDK-TCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSG-DKTIKIWSL- 556

Query: 272 NTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATP 331
           +T   + +  GH   V    F +     LVSSS D  + IWD               +T 
Sbjct: 557 DTFAVVKTFEGHTNAVQRCSFINK-QTQLVSSSADGLVKIWDC--------------STG 601

Query: 332 ELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPR 377
           E +    GH + +    +      LI S + + + Q WK S+   R
Sbjct: 602 ECVKTLDGHTNRIWALCVAEDGD-LIVSADADGVFQFWKDSTEQER 646

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 67/147 (45%), Gaps = 5/147 (3%)

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT 235
           I ++D N        TW   DN  +  +K++  +  +  +   + N++ +YDLRT     
Sbjct: 195 IQLWDANRSKPISNLTW-GADN--VTSVKFNQTETDILASTGSD-NSIVLYDLRTNSPTQ 250

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            I      N++ ++      F  A  D N Y YD+RN  + L+    H   V +++F  +
Sbjct: 251 KIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT 310

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQV 322
            D I V+ S D+ I I+   +  S +V
Sbjct: 311 GDEI-VTGSYDKTIRIYKTNQGHSREV 336

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/240 (20%), Positives = 99/240 (41%), Gaps = 18/240 (7%)

Query: 101 TKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFN 160
           TK F  +  +    +  Q    +    G+G++ +FD + +  P+  ++ HK      ++N
Sbjct: 54  TKSFLTQDCLFDIAWNEQHEKQVVVAQGDGSLRLFDIDLAKYPIAIFNEHKKEVMSCNWN 113

Query: 161 PISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEK 220
            I+K    S++ DG + ++  +   ++ + T + T        KW     ++   + + +
Sbjct: 114 LINKTMFTSSSWDGTVKIW--SPTRKESLLTLRPTP-------KWKKHLDSMEPIIPKRR 164

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLR---NTRKTL 277
           N + I      +   +   +       FS H  NL      D    ++DLR   NT++  
Sbjct: 165 NNIQIQPSHKINMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNF 224

Query: 278 HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIH 337
            S +G E  V + +F+     +L ++  D  I IWD   +    V  DA     E++  H
Sbjct: 225 LSHAGME--VLSADFNKYRPNVLATAGVDNSIRIWDFRML----VARDAAICINEIVNAH 278

>TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.663
           YKL021C
          Length = 393

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 19/115 (16%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI---LVSSSEDRRIIIWDL 314
           +   D+++ +YDL+  RK L ++  H+G +T L+F  + D     L SSS+D+ IIIW +
Sbjct: 57  SGSNDEHIRIYDLQK-RKELGTLLAHQGSITGLKFSKTEDNKSKWLFSSSDDKNIIIWRV 115

Query: 315 MEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
            +               E   I  GH + +NDF ++ S   +  S  E++ I++W
Sbjct: 116 KD--------------WENFGILKGHMNRINDFDIHPS-NRIAVSVSEDHTIRLW 155

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query: 223 LSIYDLRTKDKVTSIEMEQ-PFNSLAFSK----HSKNLFSAAGTDQNVYLYDLRNTRKTL 277
           + IYDL+ + ++ ++   Q     L FSK     SK LFS++  D+N+ ++ +++  +  
Sbjct: 64  IRIYDLQKRKELGTLLAHQGSITGLKFSKTEDNKSKWLFSSSD-DKNIIIWRVKDW-ENF 121

Query: 278 HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
             + GH   + + + H S + I VS SED  I +W+LM
Sbjct: 122 GILKGHMNRINDFDIHPS-NRIAVSVSEDHTIRLWNLM 158

>TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67
           YFL009W
          Length = 643

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 23/122 (18%)

Query: 259 AGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIG 318
           +G D  V        +K L S++GHEG V  L++ D  DGI+VS S DR + IWD+ E+G
Sbjct: 280 SGADDKVIRVYSSKDKKLLKSLTGHEGGVWALKYVD--DGIIVSGSTDRTVRIWDI-ELG 336

Query: 319 SEQVNEDAQDATPELMMIHAGHRSSVNDFSL--NSSIPWLIASTEEENIIQVWKSSSRLP 376
                            +  GH S+V    +     I +++  +  +N + VWK    LP
Sbjct: 337 C-------------CTHVFKGHTSTVRCLEVVEYKGIKYIVTGS-RDNTLHVWK----LP 378

Query: 377 RI 378
           ++
Sbjct: 379 KV 380

>CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021c MAK11 involved in cell growth and replication of
           M1 dsRNA virus
          Length = 388

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 24/126 (19%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVD--------GILVSS 303
           SK    +   D+++ +YDL+  RK L ++  H+G +TNL+F    D          L+S+
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSA 108

Query: 304 SEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEE 363
           SED +II+W        +V +     T +      GH + +ND  ++ S   ++AS  E+
Sbjct: 109 SEDNKIIVW--------RVKDWENFGTLK------GHTARINDMDIHPS-NRVVASVSED 153

Query: 364 NIIQVW 369
           + I++W
Sbjct: 154 HSIRLW 159

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 13/103 (12%)

Query: 223 LSIYDLRTKDKVTSIEMEQ-PFNSLAFSKHS---------KNLFSAAGTDQNVYLYDLRN 272
           + IYDL+ + ++ ++   Q    +L FSK S         K L SA+  D  + ++ +++
Sbjct: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSAS-EDNKIIVWRVKD 121

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
             +   ++ GH   + +++ H S + ++ S SED  I +W+LM
Sbjct: 122 W-ENFGTLKGHTARINDMDIHPS-NRVVASVSEDHSIRLWNLM 162

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 59/111 (53%), Gaps = 6/111 (5%)

Query: 209 DATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLY 268
           D      VS+ +  L I+ L+T   V S+++  P + +  +  +  L +  GTD ++ + 
Sbjct: 72  DGQYLAYVSQAQ-LLKIFQLKTGRIVRSLKISSP-SYILDTDPTSTLLAVGGTDGSIVIV 129

Query: 269 DLRNTRKTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
           D+ N   T HS+ GH G +++L+F+  +D    +L S   +  + +WDL++
Sbjct: 130 DIENGYIT-HSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVK 179

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 118/301 (39%), Gaps = 53/301 (17%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           N +    G+G++ +FD N    P+  +  H+   +  ++N ++K   +S++ DG + ++ 
Sbjct: 74  NQVLAAQGDGSLRLFDINLPQYPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWS 133

Query: 181 ------------INAESEDPVETWQST-------DNCIINDIKWHHFDATLFGTVSEEKN 221
                       I  E    VE            ++ II+  K    D       S    
Sbjct: 134 PMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNK----DCIYQAQFSPHDP 189

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNS---------------LAFSKHSKNLFSAAGTDQNVY 266
            L I        VT  ++ QP N+                 F+K+  ++ +  G D+ V 
Sbjct: 190 NL-IMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVK 248

Query: 267 LYDLRNTRK---------TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-- 315
           ++DLR  RK         +++ + GHE  +  + +      +++S+S D    +WD +  
Sbjct: 249 IWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWDDLSD 308

Query: 316 EIGSEQVNEDAQDATPELMMIHAGHRSSV--NDFSLNSSIPWLIASTEEENIIQVWKSSS 373
             G      ++ D T     I   H   V   D+SL    P  +AST  +  + +W +S+
Sbjct: 309 SNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGADWSLWGQ-PGYVASTAWDGNVCIWHTSA 367

Query: 374 R 374
           R
Sbjct: 368 R 368

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 115/291 (39%), Gaps = 48/291 (16%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNG-YGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG + I D +     V++ S+   +G + +++N     Q+L+A  DG + ++DIN   +
Sbjct: 36  GNGKLFILDIDPHGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFDINLP-Q 94

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTS---IEMEQ-- 241
            P+  +Q     + +   W+  +   F   S    T+ I+    ++ +T+   I ME+  
Sbjct: 95  YPISIFQEHQKEVFS-CNWNLVNKQTF-VSSSWDGTVKIWSPMRQESLTTLVPIPMERSP 152

Query: 242 ---------PFNS----------------LAFSKHSKNLFSAAGTDQNVYLYDLRN-TRK 275
                    P ++                  FS H  NL      +  V L+DLR  T  
Sbjct: 153 LVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNT 212

Query: 276 TLHSMSGHEGPVT-NLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELM 334
              +   H G  T   +F+     I+ +   D+ + IWDL  +          +   + M
Sbjct: 213 NQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDLRMV------RKFSNPLQQPM 266

Query: 335 MIH--AGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKP 383
            I+   GH  ++   S +     L+ ST  +   +VW   S     SN +P
Sbjct: 267 SINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWDDLSD----SNGRP 313

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 90/181 (49%), Gaps = 16/181 (8%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN-----AESEDPVETWQS 194
           S+S +     H D    L+++P    ++++A+ DG I ++DI      A  E+ V    +
Sbjct: 346 SESYILKQQGHFDTMNDLAYSP-DGSRIVTASSDGKIKIWDIVSGFCLATFEEHVSAVTA 404

Query: 195 TDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKN 254
                   I    F A L GTV +  + +   + RT    T+ E  Q FN LA     + 
Sbjct: 405 VQFAKKGQI---MFSACLDGTV-KAWDLIRYRNFRT---FTATERIQ-FNCLAVDPSGEI 456

Query: 255 LFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
           + + +  D N++++ ++ T + L ++SGHEGPV+ L F +  + +L S+S D+ I IW +
Sbjct: 457 VCAGSLDDFNIHVWSVQ-TGQLLDTLSGHEGPVSCLSFSNE-NSVLASASWDKTIRIWSI 514

Query: 315 M 315
            
Sbjct: 515 F 515

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 13/155 (8%)

Query: 209 DATLFGTVSEEKNTLSIYDLRTKDKVT-SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYL 267
           D+TL   +S   N +S++DL      T   E  +  + +A +K    L S     + + L
Sbjct: 42  DSTLL--LSPVGNRVSVFDLINNKSFTFEYEHRKNISRIALNKQGTLLLSVDEDGRGI-L 98

Query: 268 YDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQ 327
            + + TR  +H  +  +  V +L+F  S DG L + +  R + IW    IG     ED Q
Sbjct: 99  VNFK-TRNVIHHFN-FKDKVYDLKF--SPDGKLFALTCGRFLQIWKTPSIG-----EDRQ 149

Query: 328 DATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEE 362
            A      IHAGH + +   + +    ++I+S+++
Sbjct: 150 FAPFVRHRIHAGHFAEIISLTWSKDSRFVISSSKD 184

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 191 TWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSK 250
           TW   DN  + ++K++  +  +  +   + N++ +YDLRT      I      N++ ++ 
Sbjct: 210 TW-GADN--VTNVKFNQTETDILASTGSD-NSIVLYDLRTNSPTQKIVQSMRSNAICWNP 265

Query: 251 HSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI-LVSSSEDRRI 309
                F  A  D N Y YD+RN  + L+    H   V +++F  S  G  LV+ S D+ I
Sbjct: 266 MEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDF--SPTGTELVTGSYDKTI 323

Query: 310 IIWDLMEIGSEQV 322
            I+D+    S ++
Sbjct: 324 RIYDIGHGHSREI 336

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 63/144 (43%), Gaps = 15/144 (10%)

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEF------HDSVDG 298
            +A + +S N  +AA  D  V  +++ +TR+ L S   H G VT L         D  + 
Sbjct: 72  CIAKNYNSLNKLAAASADGVVKYWNM-STREELCSFKAHYGLVTGLCVSPEKYSSDKNEH 130

Query: 299 ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMM--IHAGHRSSVNDFSLNSSIPWL 356
            ++S  +D+ I +W +       V +D    T + ++   +  H     D   N+S  ++
Sbjct: 131 FMISCGDDKTIKLWSVNSEDFANVKDDESVNTKDGLIKTFYGEHAFQGLDHHRNNST-FV 189

Query: 357 IASTEEENIIQVWKSSSRLPRISN 380
               +    IQ+W SS   P ISN
Sbjct: 190 TGGAQ----IQLWDSSRSKP-ISN 208

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 91/208 (43%), Gaps = 20/208 (9%)

Query: 125 TIDG---NGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           TI G   NG + +F   N   + V   + H  +   L FN   +  L+S ++ G I ++D
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWD 135

Query: 181 IN-AESEDPVETWQSTDNCIINDI---KWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTS 236
            N A+  D V     T    + +I    W+   A +F +        SI+DL+ K +V  
Sbjct: 136 TNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYA-SIWDLKAKKEVIH 194

Query: 237 IEMEQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM-SGHEG 285
           +    P   L            +S  + +A G D +  + ++DLRN    L  +  GH  
Sbjct: 195 LSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHSK 254

Query: 286 PVTNLEFHDSVDGILVSSSEDRRIIIWD 313
            + +L++    + +++SS  D  +++W+
Sbjct: 255 GIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 224 SIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVY-LYDLRNTRKT-LHSMS 281
           S+    T   V SI  +  FN L +S  +K +  A   D  +  L+ L N + T +  ++
Sbjct: 46  SLLSTDTVKPVASISTDTKFNDLDWSYDNKTI--AGALDNGIIELFYLSNDQLTSVAKLT 103

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
            H   V  L+F+   + +LVS S    I +WD
Sbjct: 104 THTSSVKTLKFNSKQENVLVSGSNKGEIFVWD 135

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 90/201 (44%), Gaps = 15/201 (7%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           G+G++ +FD N    P+  +  HK      ++N I+K   LS++ DG + ++    ++  
Sbjct: 81  GDGSLRLFDINLQKYPIAIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVWSTARQASL 140

Query: 188 PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFN--- 244
              +   TD   I + K  + + +L   VS+    L       +  VTS  M+   N   
Sbjct: 141 ITLSPIHTDPTAIVNTK-SNINPSL-NNVSQP--ILHPRSTAIRQPVTSASMQGNDNKNC 196

Query: 245 --SLAFSKHSKNLFSAAGTDQNVYLYDLR----NTRKTLHSMSGHEGPVTNLEFHDSVDG 298
                FS H  N+ +       + L+DLR    N ++ + + SG+E     L+F+     
Sbjct: 197 IYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYE--TLTLDFNKYRSH 254

Query: 299 ILVSSSEDRRIIIWDLMEIGS 319
           I+ +S  D+ I +WD+  I S
Sbjct: 255 IIATSGVDKAIKMWDMRFIPS 275

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 123/295 (41%), Gaps = 42/295 (14%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           N +    G+G++ +FD   +D PV  +  H+   +  ++N I+K   +S++ DG + ++ 
Sbjct: 74  NHVLVAQGDGSLRLFDIQLNDYPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWT 133

Query: 181 INAESEDPVETWQ--STDNCIINDIKWHHFDATLFGTVSEEKNTLS-----------IYD 227
              +S     T +  +  N  ++       +     ++S+ KN +            +  
Sbjct: 134 PMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMS 193

Query: 228 LRTKDKVTSIEMEQPFNS---------------LAFSKHSKNLFSAAGTDQNVYLYDLRN 272
                 VT  ++ QP N+                 F+K+  ++ +  G D  V ++DLR 
Sbjct: 194 CAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRM 253

Query: 273 TRK---------TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW-DLMEIGSEQV 322
            RK         +++ + GH+  +  + +      +L+S+S D    +W DL + G    
Sbjct: 254 VRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPT 313

Query: 323 NE-DAQDATPELMMIHAGHRSSV--NDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
            + ++ D T     I + H   V   D+SL    P  +AST  +  + +W + +R
Sbjct: 314 GKTNSIDPTHGCRFIFSHHTEFVFGADWSLWGQ-PGYVASTSWDGDVCIWYAFAR 367

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/274 (20%), Positives = 111/274 (40%), Gaps = 37/274 (13%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNG-YGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG + I D ++    ++T S+   +G + +++N + +  +L A  DG + ++DI   ++
Sbjct: 36  GNGKLFIIDIDNQGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQL-ND 94

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLF------GTV-------------------SEEKN 221
            PV  +Q  +  + +   W+  +  LF      GTV                   +   +
Sbjct: 95  YPVAIFQEHEKEVFS-CNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTPKPMTAHNS 153

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSL---AFSKHSKNLFSAAGTDQNVYLYDLRN-TRKTL 277
            LS  D+   ++     + +  N +    FS H  N+  +   +  V ++DLR       
Sbjct: 154 ALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQ 213

Query: 278 HSMSGHEGPVT-NLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMI 336
           +S   H G  T   +F+     I+ +   D  + +WDL  +     N     +  E+   
Sbjct: 214 YSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEI--- 270

Query: 337 HAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWK 370
             GH  ++   S +     ++ ST  +   +VW+
Sbjct: 271 -CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 71/183 (38%), Gaps = 17/183 (9%)

Query: 91  DAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYH 150
           D P+ +  R T   K +  I +S++   DPNI+ +  GN  V++FD     +    YS+ 
Sbjct: 159 DIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQP-ANANQYSFM 217

Query: 151 KDNG---YGLSFNPISKGQLLSAADDGYIAMYDIN------AESEDPVETWQ-STDNCII 200
             NG       FN      + +   D  + ++D+       A S  P+   +    +  I
Sbjct: 218 AHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAI 277

Query: 201 NDIKWHHFDATLFGTVSEEKNTLSIYDL-----RTKDKVTSIEMEQPFNSLAFSKHSKNL 255
             + W    + +  + S +       DL     R   K  SI+         FS H++ +
Sbjct: 278 RKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGCR-FIFSHHTEFV 336

Query: 256 FSA 258
           F A
Sbjct: 337 FGA 339

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 63/116 (54%), Gaps = 4/116 (3%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK--VTSIEMEQPFNSLAFSKHSKNLFS 257
           I DI +H     +  T S +   L+ +D+R+  +   ++ E     + + ++  + N+ +
Sbjct: 117 ITDINFHPHHPEILATCSVDTYVLA-WDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMA 175

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           ++ +D  V ++DLR     L+++ GHEG V N++F+ + +  ++SSS D  +  WD
Sbjct: 176 SSHSDH-VCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 101/245 (41%), Gaps = 29/245 (11%)

Query: 145 KTYSYHKDNGY-GLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDI 203
           K+ S   D G+  +S NP  +  +L++    Y+   D   +   P        +  + D+
Sbjct: 17  KSLSLRVDGGFNAVSINPSGRDVVLASRRGLYVVDLD---DPFSPPRWLHHRTSWEVADV 73

Query: 204 KWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIE--MEQPFNSLA---FSKHSKNLFSA 258
           +W    A  +  VS       +++L +++   +IE  +   F ++    F  H   + + 
Sbjct: 74  QWSPHPAKPYWVVSTSNQKAMVWNL-SRNSTNAIEHILHGHFRAITDINFHPHHPEILAT 132

Query: 259 AGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIG 318
              D  V  +D+R+ ++  +S S      + ++++     I+ SS  D  + IWDL    
Sbjct: 133 CSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSDH-VCIWDLR--- 188

Query: 319 SEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRI 378
                   +  TP  +    GH  SVN+   N +    I S+  +  ++ W  S     +
Sbjct: 189 --------KGCTP--LYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWDYS-----V 233

Query: 379 SNSKP 383
           S++KP
Sbjct: 234 SDTKP 238

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 30/60 (50%)

Query: 132 VSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVET 191
           V I+D     +P+ T   H+ +   + FN   + +++S+++DG +  +D +     P  T
Sbjct: 182 VCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWDYSVSDTKPRHT 241

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           S+ L   A     + L+D R     LH   GH+GPV  ++FH +   I  S+ +D  I I
Sbjct: 22  SRPLVLVALFSSTIQLWDYR-MGTLLHRFEGHDGPVRGIDFHPT-QPIFASTGDDATIRI 79

Query: 312 WDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKS 371
           W L               T + +    GH   V     +  +PWLI++++++  I++W  
Sbjct: 80  WSL--------------DTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQT-IRIWNW 124

Query: 372 SSR 374
            +R
Sbjct: 125 QNR 127

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 19/168 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ I+ L T   + +      +    F  H      +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIRIWSLDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVN------EDAQDATPELM- 334
           GH   V   +FH + D ++VS+S D  + +WD+  +  +         ED   A   L+ 
Sbjct: 135 GHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMIAQQNLLD 193

Query: 335 ---------MIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                     I  GH   VN  S + ++P LI S  ++  +++W+ SS
Sbjct: 194 GGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMSS 240

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ + +T+   + S  GH   V  + FH     +++S+ ED+ + +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHPQ-QNLIISAGEDKTLRVWD 281

Query: 314 L-MEIGSEQVNEDAQD-----ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L   +  +Q   +        A P + +  A H S +  F L+   P
Sbjct: 282 LDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRERP 328

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 77/174 (44%), Gaps = 16/174 (9%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           I+ +K++  +  +  +   + N+L +YDLRT      I      N++ ++      F  A
Sbjct: 216 ISTVKFNQNETDILASAGSD-NSLVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVVA 274

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGS 319
             D N Y YD+RN  + L+    H   V +++F  + D I V+ S D+ I I++     S
Sbjct: 275 NEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIFNTTHGHS 333

Query: 320 EQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
            ++              H      V     +    ++++ +++ N +++W+S +
Sbjct: 334 REI-------------YHTKRMQHVFQVKFSMDAKYIVSGSDDGN-VRLWRSKA 373

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 122/298 (40%), Gaps = 52/298 (17%)

Query: 50  QAPLTQQEMIIGTHTSDQEPNYVKIASIELPNE-------VIDPHNVSDAPVKSNVRI-- 100
           Q  +T +  ++   T+ ++  + + +S +L  E         +P +  D  V S+ R+  
Sbjct: 6   QRIITSKAPLLPQQTTPEQRYWRQYSSTQLVKEHNSVTHIAFNPQHTHDFAVTSSTRVQI 65

Query: 101 --------TKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDR----------NSSDS 142
                    K F   K++  S     D  ++   D  G VS+FD           N S  
Sbjct: 66  FSSRTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGLVSVFDSYNPRTLLLSINVSTH 125

Query: 143 PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIND 202
           PV    +H  +             L++A+DD    ++DI+   E  +E   ++D   +  
Sbjct: 126 PVHVTKFHSQDS----------KTLVTASDDRVTRLWDISYAYEPSLELTGASD--YVRT 173

Query: 203 IKWHHFDATLFGTVSEEKNTLSIYDLRT--KDKVTSIEMEQPF-NSLAFSKHSKNLFSAA 259
           + +      L  T S +   + +YD R    + V S+  EQP  N LA S     L SA 
Sbjct: 174 LTFIPSAPHLVATGSYD-GIVRLYDTRNSGSEPVFSLNHEQPLENILAIS--PTQLISAG 230

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG----ILVSSSEDRRIIIWD 313
           G   N  ++DL + +K LH        VT L++ ++ D      L++SS D  + ++D
Sbjct: 231 G--NNFKVWDLTSNKK-LHERGNFNKTVTCLDYVENFDAPSQCALIASSLDGHVKVFD 285

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 71/169 (42%), Gaps = 24/169 (14%)

Query: 223 LSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKN---LFSAAGTDQNVYLYDLRNTRKTLHS 279
           + I+  RT+  V +      F  + +S   +N   L  A      V ++D  N R  L S
Sbjct: 63  VQIFSSRTRQVVKTFSR---FKDVVYSASFRNDGKLLVAGDATGLVSVFDSYNPRTLLLS 119

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAG 339
           ++    PV   +FH      LV++S+DR   +WD+           A + + EL     G
Sbjct: 120 INVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDI---------SYAYEPSLEL----TG 166

Query: 340 HRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYD 388
               V   +   S P L+A+   + I++++ +     R S S+P  + +
Sbjct: 167 ASDYVRTLTFIPSAPHLVATGSYDGIVRLYDT-----RNSGSEPVFSLN 210

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 17/177 (9%)

Query: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAAD-DGYIAMYDINAESEDPVETWQSTDNCI--I 200
           VKT+S  KD  Y  SF   + G+LL A D  G ++++D    S +P     S +     +
Sbjct: 74  VKTFSRFKDVVYSASFR--NDGKLLVAGDATGLVSVFD----SYNPRTLLLSINVSTHPV 127

Query: 201 NDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQP---FNSLAFSKHSKNLFS 257
           +  K+H  D+    T S+++ T  ++D+    +  S+E+        +L F   + +L +
Sbjct: 128 HVTKFHSQDSKTLVTASDDRVT-RLWDISYAYE-PSLELTGASDYVRTLTFIPSAPHLVA 185

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
               D  V LYD RN+         HE P+ N+    ++    + S+      +WDL
Sbjct: 186 TGSYDGIVRLYDTRNSGSEPVFSLNHEQPLENIL---AISPTQLISAGGNNFKVWDL 239

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 96/208 (46%), Gaps = 21/208 (10%)

Query: 129 NGTVSIFDRNSSDS--PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINA--- 183
           NG V +F  NS D+   +K  S H  +   ++FN   +  L S + +G I ++D+N    
Sbjct: 83  NGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCID 142

Query: 184 ---ESEDPVETWQS-TDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEM 239
              +S  P+    + T    I  + W+   + +F +     +  SI+DL+ K +V  +  
Sbjct: 143 QSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAG-NTSYASIWDLKAKKEVIHLSY 201

Query: 240 EQPFNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSM-SGHEGPVT 288
             P +SL           ++S  + +A+ +D    + ++DLRN    L  + +G+   + 
Sbjct: 202 TSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSKGIL 261

Query: 289 NLEFHDSVDGILVSSSEDRRIIIWDLME 316
           +L++      +L+SS  D   ++W+  E
Sbjct: 262 SLDWCKHDSNLLLSSGRDNTAVLWNPEE 289

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 86/192 (44%), Gaps = 27/192 (14%)

Query: 100 ITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSS-DSPVKTYSYHKDNGYGLS 158
           I K  K    +T   +  +  N++++   NG + I+D N   D    +YS       G++
Sbjct: 100 IKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCIDQSNDSYSPLTP---GMA 156

Query: 159 FNPISKGQLL-----------SAADDGYIAMYDINAESEDPVETWQSTDNCI---INDIK 204
             P+ +   L           SA +  Y +++D+ A+ E    ++ S  + +   ++ ++
Sbjct: 157 MTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIHLSYTSPSSSLKPQLSVVE 216

Query: 205 WHHFDATLFGTVSEEKN--TLSIYDLRTKDKVTSIEMEQPFN-----SLAFSKHSKNLFS 257
           WH  ++T   T S   N   + I+DLR  +  T +++ +  N     SL + KH  NL  
Sbjct: 217 WHPENSTRVATASNSDNEPIILIWDLRNAN--TPLQILENGNSKGILSLDWCKHDSNLLL 274

Query: 258 AAGTDQNVYLYD 269
           ++G D    L++
Sbjct: 275 SSGRDNTAVLWN 286

>NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}
           Anc_2.663 YKL021C
          Length = 401

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 11/71 (15%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEF----HDSVDG------ILV 301
           SK    +   D+++ +YDL+  RK L ++  H+G +TNL+F    H S +G       L+
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKTKHGSTEGEGSNNKWLL 108

Query: 302 SSSEDRRIIIW 312
           S+SED +IIIW
Sbjct: 109 SASEDHKIIIW 119

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-- 315
           +A  DQ + +++ +N RK L  ++GH   V   +FH + D ++VS+S D  I +WD+   
Sbjct: 112 SASDDQTIRIWNWQN-RKELACLTGHNHFVMCAQFHPTED-LVVSASLDETIRVWDIAGL 169

Query: 316 --------------EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                         ++ S+Q   DA      +  I  GH   VN  S + ++P LI S  
Sbjct: 170 RKRHSAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGG 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ SS
Sbjct: 229 DDRQVKLWRMSS 240

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGIDFHPT-QPIFVSAGDDYSIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   V     +  +PW+I++++++ I I  W++   L  ++    
Sbjct: 83  ----ETNKCLYTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKELACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ + +T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTLRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEE 362
           L +    +  +   D      A P + +  A H S +  F L+   P  +    E
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSVTHQNE 336

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 20/111 (18%)

Query: 262 DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQ 321
           D+ + +YD R ++K L  +SGHEG V  L++    DGI+VS S DR + IWD+       
Sbjct: 375 DRQLRIYDAR-SKKFLKELSGHEGGVWALKY--DADGIIVSGSTDRSVRIWDIKRGCCTH 431

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSLNS--SIPWLIASTEEENIIQVWK 370
           V                GH S+V    + +  ++ +++  +  +N + VWK
Sbjct: 432 V--------------FKGHTSTVRCLEIVTYKNMKYIVTGS-RDNTLHVWK 467

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 88/204 (43%), Gaps = 19/204 (9%)

Query: 170 AADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           A     I ++D+N        +W   DN  I  +K++  +  +  +   + N++ +YDLR
Sbjct: 195 ATGGAKIQLWDVNRVKPVSNLSW-GADN--ITSVKFNQNETDILASTGSD-NSIVLYDLR 250

Query: 230 TKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           T      I      N++ ++      F  A  D N Y YD+RN  ++L+    H   V +
Sbjct: 251 TNSPTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMD 310

Query: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSL 349
           ++F  + D I V+ S D+ I I++     S ++              H      V     
Sbjct: 311 VDFSPTGDEI-VTGSYDKSIRIYNTNHGHSREI-------------YHTKRMQHVFQVKY 356

Query: 350 NSSIPWLIASTEEENIIQVWKSSS 373
           +    ++I+ +++ N +++W+S +
Sbjct: 357 SMDAKYIISGSDDGN-VRLWRSKA 379

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 12/176 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++AA+DG I ++D+   S   + T        
Sbjct: 330 SESYILKQQGHFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDV--VSGFCLATLDE-HTAA 385

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
           +  +++      LF   +    T+  +DL   R     T+ E  Q FNSLA     + + 
Sbjct: 386 VTQVQFAKKGQVLFS--ASLDGTVKAWDLIRYRNFRVFTAAERIQ-FNSLAVDPSGEVVC 442

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
           + +  + +++++ ++ T + L S+SGHEGPV+ L F    +G+L S+S D+ I IW
Sbjct: 443 AGSMDNFDIHVWSVQ-TGQLLDSLSGHEGPVSCLAFSQE-NGVLASASWDKTIRIW 496

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 2/123 (1%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           I  +K++  D+ +  +   + N++ +YDLRT      I  +   NSL ++      F   
Sbjct: 215 ITSVKFNQNDSNILASTGSD-NSIVLYDLRTNSPTQKIVQQMRTNSLCWNPMEPFNFVTG 273

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGS 319
             D N Y YD+R   + L+    H   V +++F  + D I V+ S D+ I I+      S
Sbjct: 274 NEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGDEI-VTGSYDKTIRIFKTNHGHS 332

Query: 320 EQV 322
            +V
Sbjct: 333 REV 335

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 21/121 (17%)

Query: 251 HSKNLFSAAG-TDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRI 309
           HS+    AAG  D  + L+DL  ++  L S +GH+  +T L+F D     L+S SED  I
Sbjct: 86  HSETGLIAAGYADGVIKLWDLV-SKTVLLSFNGHKSRITMLKF-DKTGTQLISGSEDSNI 143

Query: 310 IIWDLM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQV 368
           I+WDL+ E+G  ++                 H+ ++     +S   WLI ST ++ +I+V
Sbjct: 144 IVWDLVSEVGLYKLR---------------SHKGTITGLWCDSD-NWLI-STSKDGLIKV 186

Query: 369 W 369
           W
Sbjct: 187 W 187

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 221 NTLSIYDLRTKDKVTSIEMEQP-FNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
             + ++DL +K  + S    +     L F K    L S +  D N+ ++DL  +   L+ 
Sbjct: 99  GVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS-EDSNIIVWDLV-SEVGLYK 156

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
           +  H+G +T L + DS D  L+S+S+D  I +WDL
Sbjct: 157 LRSHKGTITGL-WCDS-DNWLISTSKDGLIKVWDL 189

>KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {ON}
           Anc_8.67 YFL009W
          Length = 672

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 20/117 (17%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
               D+ + +YD  NT+  L  +SGHEG V  L++   +DGI+VS S DR + +WD+   
Sbjct: 313 TGADDKMIRIYD-SNTKNFLLELSGHEGGVWALKY--DMDGIVVSGSTDRCVRVWDIKR- 368

Query: 318 GSEQVNEDAQDATPELMMIHAGHRSSVN--DFSLNSSIPWLIASTEEENIIQVWKSS 372
                           + +  GH S+V   D      I ++I  +  +N + VWK S
Sbjct: 369 -------------GCCLHVFKGHSSTVRCLDIVEFKGIKYIITGS-RDNTLHVWKLS 411

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 75/168 (44%), Gaps = 19/168 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L TK  + ++     +    F  H      +   DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLETKKCLFTLNGHLDYVRTVFFHHELPWIISCSDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI-------GSEQVNE---------D 325
           GH   V   +FH S D ++VS+S D  + +WD+  +       G+    E         D
Sbjct: 135 GHNHFVMCAQFHPSED-LVVSASLDETVRVWDISGLRKKHSAPGASSFEEQMIAQQNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                  +  I  GH   VN  S + ++P LI S  ++  +++W+ S+
Sbjct: 194 GGFGECVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKIWRMSA 240

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   V     +  +PW+I+ ++++ I I  W++   +  ++    
Sbjct: 83  ----ETKKCLFTLNGHLDYVRTVFFHHELPWIISCSDDQTIRIWNWQNRKEIACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V ++ +  T+   + +  GH   V ++ FH     +++S  ED+ I  WD
Sbjct: 223 LIVSGGDDRQVKIWRMSATKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTIRTWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S V  F L+   P
Sbjct: 282 LDKRTPVKQFKRENDRFWLIRAHPNINLFGAAHDSGVMVFKLDRERP 328

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 19/121 (15%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHD---SVDGILVSSSEDRR 308
           SK    +   D+++ +YDL+  RK L ++  H+G +T L+F     S +  L+S+SED++
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITALKFSKNEASTNKWLLSASEDKK 108

Query: 309 IIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQV 368
           IIIW        +V +     T +      GH   +ND  ++ S   +  S  E++ I++
Sbjct: 109 IIIW--------RVKDWENYGTLK------GHTGRINDLDIHPS-SRIAISVSEDHSIRL 153

Query: 369 W 369
           W
Sbjct: 154 W 154

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 58/105 (55%), Gaps = 8/105 (7%)

Query: 223 LSIYDLRTKDKVTSIEMEQ-PFNSLAFSKH----SKNLFSAAGTDQNVYLYDLRNTRKTL 277
           + IYDL+ + ++ ++   Q    +L FSK+    +K L SA+  D+ + ++ +++  +  
Sbjct: 63  IRIYDLQKRKELGTLLAHQGSITALKFSKNEASTNKWLLSAS-EDKKIIIWRVKDW-ENY 120

Query: 278 HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQV 322
            ++ GH G + +L+ H S   I +S SED  I +W+LM +    V
Sbjct: 121 GTLKGHTGRINDLDIHPS-SRIAISVSEDHSIRLWNLMTVKKAAV 164

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 279 SMSGHEGPVTNLEFHDSVDGI-LVSSSEDRRIIIWDL 314
           S+ GH   V + +F+ +  GI LVS   D +I++WD+
Sbjct: 260 SLLGHTNRVKDFKFYQNEFGIYLVSIGSDGKIVVWDM 296

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 5/143 (3%)

Query: 170 AADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           A     I ++D+N        +W   DN  I  +K++  +  +  +   + N++ +YDLR
Sbjct: 195 ATGGAKIHLWDVNRLKPVSNLSW-GADN--ITSVKFNQSETDILASTGSD-NSIVLYDLR 250

Query: 230 TKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           T      I      N++ ++      F  A  D N Y YD+RN  ++L+    H   V +
Sbjct: 251 TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMD 310

Query: 290 LEFHDSVDGILVSSSEDRRIIIW 312
           ++F  + D I V+ S D+ I I+
Sbjct: 311 VDFSPTGDEI-VTGSYDKSIRIY 332

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 93/224 (41%), Gaps = 20/224 (8%)

Query: 99  RITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLS 158
           ++ K F   K++  S    QD  +++  D  G VS++D  +  + + + +      +   
Sbjct: 72  QVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNPRAQLVSIAASSHPTHVAK 131

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDN----CIINDIKWHHFDATLFG 214
           F+P     L++A+DD  + ++DI    E  VE   ++D     C++          +  G
Sbjct: 132 FHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAPHLVVTGSYDG 191

Query: 215 TVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTR 274
            V        ++D RT ++ T++    P   +  +  +  L S  G    V  +DL   R
Sbjct: 192 QV-------RLFDTRTNERATTLAQGMPVEDV-IAVSATQLVSCGGPKFKV--WDLTAQR 241

Query: 275 KTLHSMSGHEGPVTNLEFHDSVD-----GILVSSSEDRRIIIWD 313
             L   +     VT L   D V+       LV+SS D  + I+D
Sbjct: 242 PLLER-ANFAKTVTCLNHVDLVEDSPMSSTLVASSLDGHVKIFD 284

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 49/115 (42%), Gaps = 1/115 (0%)

Query: 223 LSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSG 282
           + ++  RT+  + +    +     A  +    L +       V +YD  N R  L S++ 
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNPRAQLVSIAA 122

Query: 283 HEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVN-EDAQDATPELMMI 336
              P    +FH +    LV++S+DR + +WD+ +    QV    A D    + M+
Sbjct: 123 SSHPTHVAKFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMV 177

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 228 LRTKDKVTSIEMEQPFNSLAF---SKHSKNLFSAAGTDQN-VYLYDLRNTRKTLHSMSGH 283
           L T  +V S+++    N+L     S    N+ +  G D N V + D+RN    + ++ GH
Sbjct: 350 LNTSSRVGSVDLSSKSNALLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGH 409

Query: 284 EGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
             P+  +++H +    ++SSS+D +++ W+L
Sbjct: 410 SAPINQIKWHPTKKNTILSSSDDCQVLYWNL 440

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 119 DPNIISTIDGNG-TVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
           DPN+I+T   +  +V I D  +  +PV T   H      + ++P  K  +LS++DD  + 
Sbjct: 377 DPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILSSSDDCQVL 436

Query: 178 MYDIN 182
            +++N
Sbjct: 437 YWNLN 441

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 94/218 (43%), Gaps = 25/218 (11%)

Query: 165 GQLLSAADDGYI----AMYDINAESED-PVETWQSTDNCIINDIKWHHF--DATLFGTVS 217
           G + S ++DG +     +  IN  S D P     S D     DI   H   D +    VS
Sbjct: 20  GAIASVSEDGRLLATSVVDKINIVSLDSPRRVLHSVDTEDEQDITALHLTPDGSYLCFVS 79

Query: 218 EEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTL 277
           + +  L +Y L+ +  + S+++  P   +   + S  L +  GTD +V + D+ N   T 
Sbjct: 80  QAQ-LLRVYSLKQERIIRSMKISSPVYVMNCDQTS-TLLAIGGTDGSVSVIDIENGYVT- 136

Query: 278 HSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDAT---- 330
           HS+ GH   +++++FH  ++     L S   +  I +WDL++   +   ++   A     
Sbjct: 137 HSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLD 196

Query: 331 --------PELMMIHAGHRSSVNDFSLNSSIPWLIAST 360
                     L ++  G  + +N F  NS+  + +  T
Sbjct: 197 FRVTDEEKGTLQLLSGGRDNILNLFEFNSTKKYKLLKT 234

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 211 TLFGTVSEEKNTLSIYDLRTKD-KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
           +LF T S +K T  I++L   + + T    ++    +AF ++ K L + +G D+ + ++ 
Sbjct: 508 SLFATASYDK-TCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSG-DKTIKIWS 565

Query: 270 LRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
           L  +   + ++ GH   V    F +  +  L+S+  D  +IIWDL
Sbjct: 566 LE-SYAVVKTLEGHTNAVQRCSFINK-NKQLISTGADGLVIIWDL 608

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           I  +K++  +  +  +   + N + +YDLRT      I      N++ ++      F  A
Sbjct: 215 ITSVKFNQNEVDILASTGSD-NAIVLYDLRTNSPTQKIIQTMRTNAICWNPMEAFNFVIA 273

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
             D N Y YD+RN  + LH    H   V +++F  + D I V+ S D+ I I+
Sbjct: 274 NEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIF 325

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 76/160 (47%), Gaps = 32/160 (20%)

Query: 223 LSIYDLRTKDKVTSI-----------EMEQPFNSLAFSKHS-KNLFSAAGTDQNVYLYDL 270
           ++I+D++T D VT++           +  +P        H   NL +    D  + ++DL
Sbjct: 49  VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDL 108

Query: 271 RNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-EIGSEQVNEDAQDA 329
             ++  L + +GH+  +T ++F DS    L+S S+D  II+WDL+ E+G  ++       
Sbjct: 109 V-SKTVLLNFNGHKAAITLMQF-DSTGTRLISGSKDSNIIVWDLVGEVGLYKLR------ 160

Query: 330 TPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
                     H+ ++  F       WL+ ST ++ +I++W
Sbjct: 161 ---------SHKDAITGFWCQGE-DWLV-STSKDGLIKIW 189

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 96/194 (49%), Gaps = 21/194 (10%)

Query: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQ--LLSAADDGYIAMYDINAESEDPVETWQSTD 196
           SS S V + S+  +N + L   P+  G   LL++  +G +   D +  +   ++ +  ++
Sbjct: 3   SSYSLVNSRSFGSNN-WALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTT--IQKYNISE 59

Query: 197 NCIINDIKWHHFDAT---LFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKH 251
             I ND++  + + T   LF T +   N++ I+D+ +  +V +I  +   PF SL  S+H
Sbjct: 60  TSI-NDLQLINHNPTSSPLFTTAT--SNSVKIFDIHSTKEVATIHSQGNVPFPSLD-SRH 115

Query: 252 SKNLFSAA----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSED 306
              L +      G D  +Y+YD+R   + + S+   H   VT L++H +   IL+S S D
Sbjct: 116 G--LLACGTELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173

Query: 307 RRIIIWDLMEIGSE 320
               ++DL E   E
Sbjct: 174 GYTNVYDLSEAEEE 187

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 9/118 (7%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN-AESE 186
           +  + I+D    D PV++    H D+   L ++P     LLS + DGY  +YD++ AE E
Sbjct: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFN 244
           D +   Q  +   I+   W         T+S  + T +I++L   DK  +++  QP +
Sbjct: 188 DSLH--QVINFASIHSCGW--LSPRRIFTLSHME-TFAIHEL--NDKSDTLKEPQPID 238

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 17/130 (13%)

Query: 240 EQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI 299
           E+P   + FS    NLF+ A  DQ   L+        L  M+GH   V  + FH +   I
Sbjct: 616 EKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYP-LRVMAGHLNDVDCVSFHSNGRYI 674

Query: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
              SS D+ + +WD+               T + + +  GH S+V   S++    W I++
Sbjct: 675 FTGSS-DKTVRMWDI--------------NTGDSVRLFMGHNSTVTSLSVSPDGKW-IST 718

Query: 360 TEEENIIQVW 369
             ++ II +W
Sbjct: 719 GSDDGIITIW 728

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 76/175 (43%), Gaps = 8/175 (4%)

Query: 141 DSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCII 200
           D P+ +Y  H+   + + F+P       +A++D    ++  +      V      D   +
Sbjct: 606 DKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLND---V 662

Query: 201 NDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT-SIEMEQPFNSLAFSKHSKNLFSAA 259
           + + +H     +F   S++  T+ ++D+ T D V   +       SL+ S   K   S  
Sbjct: 663 DCVSFHSNGRYIFTGSSDK--TVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGK-WISTG 719

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
             D  + ++D+ + RK L +M GH     +   ++    +LVS   D+ + +WDL
Sbjct: 720 SDDGIITIWDIGSGRK-LKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 15/101 (14%)

Query: 276 TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMM 335
           T  +  GH G V +  F  + D  L+S+SED+ + +W +            QD  P  ++
Sbjct: 566 TCKTFIGHSGTVYSTSF-SAGDEYLLSASEDKTVRLWSV------------QDDKP--LV 610

Query: 336 IHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLP 376
            + GH   V D   + S   L A+   +   ++W      P
Sbjct: 611 SYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYP 651

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198
           S  S + +Y +  +N +     P+ K  +L++  +G + + D   +S   +  ++S +  
Sbjct: 2   SQCSQIGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMD--WKSNKSINKFKSDETA 58

Query: 199 I----INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHS 252
           I    I +  WH  + T F T S   + + ++D+R+   + +I  E+  PF SL  S++ 
Sbjct: 59  INALQIVNTDWH--NETRFITAS--MHAVKLFDVRSNACIGTIHNEVGAPFLSLD-SRYD 113

Query: 253 KNLFSA--AGTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRI 309
           K        G D  ++++DLR       S+   H   +T+++FH S   +L+S S D   
Sbjct: 114 KIACGTELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYT 173

Query: 310 IIWDLME 316
            I+DL +
Sbjct: 174 NIYDLSQ 180

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  + IFD    D+P K+    H D+   + F+P     LLS + DGY  +YD++ E ED
Sbjct: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/312 (19%), Positives = 115/312 (36%), Gaps = 52/312 (16%)

Query: 27  YDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQEPNYVKIASIELPNEVIDP 86
           +D V++  + +P   ++W+P              GT       + ++I S+E        
Sbjct: 96  WDSVAQASVIYPLSKIQWMPK-------------GTGKLATCSDSLRIRSVE-------- 134

Query: 87  HNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNIIS----TIDGN--------GTVSI 134
                   + N+ + K  K   E++  R + Q P + S     +D N         T ++
Sbjct: 135 ---EQLHEQLNLSLVKYGKSLGEVSNGRMLGQLPPVTSFDWNALDTNLILFSSIDTTCTV 191

Query: 135 FDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINA--------ESE 186
           +D  +S+        H    +   F   S     S   DG + ++D+          E +
Sbjct: 192 WDLQASNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQ 251

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSL 246
             V+  Q+     ++ +  H  D  L      +KN+ S     +               L
Sbjct: 252 QQVQG-QTPSQTQVHTLAAHEQDGQL------QKNSQSSALSSSASSSLGALDNCALLRL 304

Query: 247 AFSKHSKNLFSAAGTDQNVYL-YDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE 305
             S    N+ +    D NV +  D+R     +  + GH  PV  L++H S   +L +  +
Sbjct: 305 EPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHAAPVNQLKWHPSKPNVLATCGD 364

Query: 306 DRRIIIWDLMEI 317
           D +I+ WDL+E+
Sbjct: 365 DCQILYWDLLEL 376

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 221 NTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLFSA--AGTDQNVYLYDLRNTRKT 276
           ++++I D+R++DK+ S++ ++  PF SL  S+H         +G D  +++YD+RN    
Sbjct: 81  DSVNILDVRSRDKLASLKNDKNAPFLSLD-SRHGMLACGTELSGVDAELHIYDVRNWSTP 139

Query: 277 LHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMM 335
           + S +  H   VT++ FH S   +L+S S D    ++DL     +Q  +DA         
Sbjct: 140 IRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL----KQQEEDDALHQVINYAS 195

Query: 336 IHA 338
           IH+
Sbjct: 196 IHS 198

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           + I+D  +  +P++++   H D+   + F+P  +  LLS + DGY  +YD+  + ED
Sbjct: 128 LHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQEED 184

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 20/184 (10%)

Query: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES----EDPVETWQSTDNCI 199
           V   ++  DN + L   P+    LL ++ +G + + D N+ S     +  ET  ++   I
Sbjct: 6   VNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVI 64

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-VTSIEMEQPFNSLAFSKHSKNLFSA 258
            ND +    +  +F   S    ++ IYD+R  D  V +I+ ++  NS+  S  S++    
Sbjct: 65  NNDFE----NGCIFAATSLA--SVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLV 116

Query: 259 AGT-----DQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
            GT     D  +++YD+R   K + + +  H   +T+++FH S   IL+S S D    I+
Sbjct: 117 CGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176

Query: 313 DLME 316
           DL +
Sbjct: 177 DLAQ 180

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 134 IFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           I+D      PV+ +   H D+   + F+P  K  LLS + DGY  +YD+  E ED
Sbjct: 130 IYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 100 ITKKFKL-EKEITRSRYMVQD--PNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYG 156
           I KKF++ E  I   R +  D     I       +V I+D  + DSPV T    K++ + 
Sbjct: 47  IIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVF- 105

Query: 157 LSF----NPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATL 212
           LS     + +  G  L+   D  + +YD+   S+ PV  +  + +  I DIK+H  D  +
Sbjct: 106 LSLESRHDMLVCGTELTGV-DAEMFIYDVRYFSK-PVRAFVDSHHDDITDIKFHPSDKNI 163

Query: 213 FGTVSEEKNTLSIYDLRTKDK 233
             + S +  T +IYDL  +D+
Sbjct: 164 LLSGSTDGYT-NIYDLAQEDE 183

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 89/179 (49%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++AADDG I ++D+ +       T  ++    
Sbjct: 330 SESYILKQQGHFDSTNSLTYSP-DGSRVVTAADDGKIKVWDVVSGFCLATFTEHTSS--- 385

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
           +  +++      LF   S    T+  +DL   R     T+ E  Q FN LA     + + 
Sbjct: 386 VTQVQFAKKGQVLFS--SSLDGTVRAWDLIRYRNFRTFTAAERIQ-FNCLAVDPSGEVVC 442

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +    +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ + IW + 
Sbjct: 443 AGSIDSFDIHVWSVQ-TGQLLDTLSGHEGPVSCLSFSQE-NSVLASASWDKTVRIWSIF 499

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 101/241 (41%), Gaps = 40/241 (16%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           +P  +    G+GT+++FD  +    ++ Y  H    +  ++N +++   +S + DG + +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKI 131

Query: 179 YDINAESE---------------DPVETWQSTDN-----CIINDIKWHHFDATLFGTVSE 218
           +D  A SE               + +ET     N     CI   +   H D  +      
Sbjct: 132 WDC-ARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPH-DPNM-AMCCS 188

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFNSLA--FSKHSKNLFSAAGTDQNVYLYDLRNTRKT 276
             + L+ +DLR  ++  SI       +L+  ++K+   + ++AG D+ + ++DLR  +  
Sbjct: 189 GNSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNK 248

Query: 277 LHSM--------------SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW-DLMEIGSEQ 321
            H+M              + HE  +  + +        +++S D    +W DL   G+ Q
Sbjct: 249 PHNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQDLSHDGTRQ 308

Query: 322 V 322
           V
Sbjct: 309 V 309

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 32/161 (19%)

Query: 223 LSIYDLRTKDKVTSI------------EMEQPFNSLAFSKHS-KNLFSAAGTDQNVYLYD 269
           ++I+D++T + V  +            ++ +P +   F  H   NL +A  +D  + ++D
Sbjct: 43  INIWDIKTGELVNQLTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWD 102

Query: 270 LRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-EIGSEQVNEDAQD 328
           L  ++  L + +GH+  +T L F DS    L+S S D  II+WDL+ E+G  ++      
Sbjct: 103 LI-SKTILLTFNGHKSAITILTF-DSTGTRLISGSNDSDIIVWDLVSEVGLYKLR----- 155

Query: 329 ATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
                      H+ ++     +    WLI ST ++ +I+VW
Sbjct: 156 ----------SHKDNITGIWCSDDENWLI-STSKDGLIKVW 185

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 5/143 (3%)

Query: 170 AADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           A     I ++D+N        +W   DN  I  +K++  +  +  +   + N++ +YDLR
Sbjct: 195 ATGGAKIHLWDVNRLKPVSDLSW-GADN--ITSLKFNQNETDILASTGSD-NSIVLYDLR 250

Query: 230 TKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           T      I      N++ ++      F  A  D N Y YD+RN  ++L+    H   V +
Sbjct: 251 TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMD 310

Query: 290 LEFHDSVDGILVSSSEDRRIIIW 312
           ++F  + D I V+ S D+ I I+
Sbjct: 311 VDFSPTGDEI-VTGSYDKSIRIY 332

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 78/202 (38%), Gaps = 21/202 (10%)

Query: 129 NGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE-- 186
           NG V  F      S V   + H      + FN       +S    G I ++D N  S   
Sbjct: 82  NGVVEFFCARERRS-VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAG 140

Query: 187 ----DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQP 242
                P       D   +  + W+   A +F +        SI+DL+ K +V  +    P
Sbjct: 141 YSPFGPGTAMTPIDE--VQSLAWNQSLAHVFASAGSS-GFASIWDLKAKKEVIHLSYTSP 197

Query: 243 FNSLA--------FSKHSKNLFSAAGTDQN--VYLYDLRNTRKTLHSMS-GHEGPVTNLE 291
            + L            +S  + +A G D    + ++DLRN    L  MS GH   + +L+
Sbjct: 198 HSGLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLD 257

Query: 292 FHDSVDGILVSSSEDRRIIIWD 313
           +    + +++SS  D   I+W+
Sbjct: 258 WCKHDEKLMLSSGRDNTCILWN 279

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 96/227 (42%), Gaps = 27/227 (11%)

Query: 114 RYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLL----- 168
           R+  +  N+  +    G + ++D N   +     + +   G G +  PI + Q L     
Sbjct: 110 RFNAKQANVAVSGGSQGEIFVWDTNKISA-----AGYSPFGPGTAMTPIDEVQSLAWNQS 164

Query: 169 ------SAADDGYIAMYDINAESEDPVETWQSTDNCIIND---IKWHHFDATLFGTVSEE 219
                 SA   G+ +++D+ A+ E    ++ S  + + N    ++WH  ++T   T +  
Sbjct: 165 LAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQLAVVEWHPSNSTRVATATGN 224

Query: 220 KN--TLSIYDLRTKD---KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTR 274
            N   + ++DLR  +   +V S    +   SL + KH + L  ++G D    L++    +
Sbjct: 225 DNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWNPEEAQ 284

Query: 275 K-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSE 320
           K T +   G+       +F      +  S+S D +I +  L  + ++
Sbjct: 285 KLTQYPTRGNW--CFKTKFAPEAPDLFASASFDNKIQVQTLQNLANK 329

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  L+FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +   +GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----DTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 19/168 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L T   + ++     +    F         +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLDTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGS-----------EQVNE-----D 325
           GH   V   +FH + D ++VS+S D  I IWD+  +             EQ+N      D
Sbjct: 135 GHNHFVMCAQFHPT-DDLIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQMNAQQNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                  +  I  GH   VN  S + ++P LI S  ++  +++W+ S+
Sbjct: 194 GSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMSA 240

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 50/264 (18%), Positives = 104/264 (39%), Gaps = 65/264 (24%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI------INDI 203
           H+    GL F+P ++   +SA DD  I ++ ++            T+ C+      ++ +
Sbjct: 52  HEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSLD------------TNKCLYTLSGHLDYV 98

Query: 204 KWHHFDATLFGTVSE-EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTD 262
           +   F   L   +S  +  T+ I++ + + ++  +     F   A    + +L  +A  D
Sbjct: 99  RTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLD 158

Query: 263 QNVYLYDLRNTRKTLHS------------------------------MSGHEGPVTNLEF 292
           + + ++D+   RK  HS                              + GH   V    F
Sbjct: 159 ETIRIWDISGLRKR-HSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASF 217

Query: 293 HDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSS 352
           H ++  ++VS+S+DR++ +W +    + +V+               GH ++V+    +  
Sbjct: 218 HPTLP-LIVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPH 264

Query: 353 IPWLIASTEEENIIQVWKSSSRLP 376
              LI S  E+  ++VW    R P
Sbjct: 265 QN-LIISVGEDKTLRVWDLDKRTP 287

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 83/196 (42%), Gaps = 28/196 (14%)

Query: 189 VETWQSTDNCIINDIKWHHFDAT-----------LFGTVSEEKNTLSIYDLRTKDKVTSI 237
           +E W S  +  I+++ W   + T           L  T S+  N++ +YDLRT      I
Sbjct: 194 IELWDSNRSNPISNLSWGADNVTNVKFNQNEHDILASTGSD--NSIVLYDLRTNSPTQKI 251

Query: 238 EMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVD 297
                 NSL ++      F  A  DQN Y YD+R   + L+    H   V +++F  +  
Sbjct: 252 VQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPTGQ 311

Query: 298 GILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLI 357
            I V+ S D+ I I+++    S ++              H      V     +    ++I
Sbjct: 312 EI-VTGSYDKTIRIYNIKHGHSREI-------------YHTRRMQHVFQVKFSMDSKYII 357

Query: 358 ASTEEENIIQVWKSSS 373
           + +++ N +++W+S +
Sbjct: 358 SGSDDGN-VRLWRSKA 372

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 55/105 (52%), Gaps = 5/105 (4%)

Query: 215 TVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTR 274
           T   +   L I+ L+T   V S+++  P + +  +  +  L +  GTD ++ + D+ N  
Sbjct: 77  TYVSQAQLLKIFHLKTGKVVRSMKISSP-SYILDADSTSTLLAVGGTDGSIIVVDIENGY 135

Query: 275 KTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
            T HS  GH G +++L+F+  ++    +L S   +  + +WDL++
Sbjct: 136 IT-HSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVK 179

>SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [1326
           bp, 441 aa] {ON} weakly similar to uniprot|Q12206
           YOR229W Saccharomyces cerevisiae WTM2 WD repeat
           containing transcriptional modulator 2
          Length = 441

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 73/360 (20%), Positives = 146/360 (40%), Gaps = 47/360 (13%)

Query: 13  DEEYKLWKSNVPLMYDFVSETKLTWPS-------------LTVEWLPHDPQAPLTQQEMI 59
           +EE+K+WK ++P +Y  +S  K ++ S              T E +P   Q  LT    +
Sbjct: 4   NEEFKIWKKSIPSIYQHISTFKPSFTSRVYDTESIPKTMTFTHELVPDKEQGTLTTS--V 61

Query: 60  IGTHTSD--QEPNYVKIASIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKE-ITRSRYM 116
           + +  SD  + P  + +       E +      +  V     +  K+  + E I + +Y+
Sbjct: 62  LYSQGSDIFEVPCSLPLGLHSSFGESLPEPQYHETSVSKEHGLQPKWSYQGENIIKLQYV 121

Query: 117 VQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176
                 +  +  NG+++ F +     PVK  +  +  G   SF+ I     L   ++G I
Sbjct: 122 GTPDCAVIAMASNGSLAWF-KEGIKVPVKVMA--EIMGPSTSFSMIHS---LKQINNGII 175

Query: 177 AMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTK--DKV 234
           + + ++ ++E  V+T                  + + G  SEE + L I D   K  + +
Sbjct: 176 SDFALSHDTETVVKT-----------------QSRIAG--SEESSILKIVDNSDKPGELL 216

Query: 235 TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHD 294
            +I +     S     H+ +LFS    D  +  +D+R+ +          G +T  +   
Sbjct: 217 RTINIPGTTVSHTVKFHNNHLFSTCSDDNRLRFWDVRSDKPVWSLSDPKNGSLTCFDVSP 276

Query: 295 SVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIP 354
            +D + V+ +    + +WDL  + +   ++D  D T E++ ++     SV D     + P
Sbjct: 277 VIDTLFVTGTSTGVLKLWDLRAVAASSGHDD--DCTTEIVSLYHSGGDSVADVQFGFTSP 334

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 85/174 (48%), Gaps = 9/174 (5%)

Query: 148 SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQSTDNCIINDIKWH 206
           S+  DN + L   P+ +  +L+A  +G++ + D    +S   V   +S+ N +   +   
Sbjct: 10  SFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL-QVLDSA 67

Query: 207 HFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAF-SKHSKNLFSA--AGTDQ 263
           H   T+F T +++   + ++D+RT+  V ++       +L+  S+H    F     G D 
Sbjct: 68  HDRGTVFATAADDG--VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDA 125

Query: 264 NVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
            V L+ L    + L + +  H   VT+++FH +   +L+S S D  + ++DL +
Sbjct: 126 VVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           +  VS+F       P++ +   H D+   + F+P     LLS + DGY+ +YD+    ED
Sbjct: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEED 183

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  L+FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +   +GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----DTNKCLYTLSGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           +A  DQ + +++ +N RK +  ++GH   V   +FH + D ++VS+S D  I IWD+  +
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPT-DDLIVSASLDETIRIWDISGL 169

Query: 318 GS-----------EQVNE-----DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                        EQ+N      D       +  I  GH   VN  S + ++P LI S  
Sbjct: 170 RKRHSAPSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSAS 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ S+
Sbjct: 229 DDRQVKLWRMSA 240

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 50/264 (18%), Positives = 104/264 (39%), Gaps = 65/264 (24%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI------INDI 203
           H+    GL F+P ++   +SA DD  I ++ ++            T+ C+      ++ +
Sbjct: 52  HEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSLD------------TNKCLYTLSGHLDYV 98

Query: 204 KWHHFDATLFGTVSE-EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTD 262
           +   F   L   +S  +  T+ I++ + + ++  +     F   A    + +L  +A  D
Sbjct: 99  RTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLD 158

Query: 263 QNVYLYDLRNTRKTLHS------------------------------MSGHEGPVTNLEF 292
           + + ++D+   RK  HS                              + GH   V    F
Sbjct: 159 ETIRIWDISGLRKR-HSAPSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASF 217

Query: 293 HDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSS 352
           H ++  ++VS+S+DR++ +W +    + +V+               GH ++V+    +  
Sbjct: 218 HPTLP-LIVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPH 264

Query: 353 IPWLIASTEEENIIQVWKSSSRLP 376
              LI S  E+  ++VW    R P
Sbjct: 265 QN-LIISVGEDKTLRVWDLDKRTP 287

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (47%), Gaps = 15/119 (12%)

Query: 220 KNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
           K  L +YD    D+ T+        +L F + + +LF + G D  + ++D+ + R  L  
Sbjct: 164 KRILHVYD--GHDRGTT--------ALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRD 213

Query: 280 MSGHEGPVTNLEF-HDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIH 337
             GH   ++   F HD+V     SSS D+ + IWD  E G + +N  +  ATP  M  H
Sbjct: 214 YCGHRKAISATSFSHDNVQ--FASSSYDKTVKIWD-TETG-DIINRLSFKATPNCMTFH 268

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 75/161 (46%), Gaps = 6/161 (3%)

Query: 157 LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTV 216
           ++F+P +K QLL    D  I  +D+  + +D V          IN +++   D + F + 
Sbjct: 265 MTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFP-DGSKFISS 323

Query: 217 SEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSK-NLFSAAGTDQNVYLYDL--RNT 273
           S++K ++ I++ +    +  I     + +     H + N F+A   D ++Y+Y +  +  
Sbjct: 324 SDDK-SIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYK 382

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE-DRRIIIWD 313
           R    +  GH+    N  F  + DG  V++ +   R+ IWD
Sbjct: 383 RHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWD 423

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 14/96 (14%)

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPEL 333
           ++ LH   GH+   T LEF      + +S   D  + IWD+     E++          L
Sbjct: 164 KRILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYH---ERL----------L 210

Query: 334 MMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           +  + GHR +++  S  S      AS+  +  +++W
Sbjct: 211 LRDYCGHRKAISATSF-SHDNVQFASSSYDKTVKIW 245

>SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} similar
           to uniprot|P20484 Saccharomyces cerevisiae YKL021C MAK11
           Protein essential for cell growth and replication of M
           dsRNA virus contains four beta-transducin repeats
          Length = 394

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 31/133 (23%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEF---------HDSVDGI--- 299
           SK    +   D+++ +YDL+  RK L ++  H+G VTNL F          ++VDG    
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLSHQGSVTNLRFSRGKKPDSSEETVDGKGSG 108

Query: 300 ---LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWL 356
              L+SSSED +II+W + +               E      GH + +ND  ++ S   +
Sbjct: 109 NKWLLSSSEDHKIIVWRVKDW--------------ENFGTLKGHTARINDLDIHPS-NRV 153

Query: 357 IASTEEENIIQVW 369
             S  +++ I++W
Sbjct: 154 AVSVSDDHSIRLW 166

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 279 SMSGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWDL 314
           S+ GH   V + +F+++ +G  LV+   D RI++WD+
Sbjct: 279 SLLGHSNRVKDFKFYNNENGKYLVTVGSDGRIVVWDM 315

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 253 KNLFSAAGTDQNVYLYDLRNTR-KTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           K L +AAG  QNV LYD+R T    + +  GH+G VT++ F    +  +V+SSED  I +
Sbjct: 64  KKLLAAAGY-QNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQD-NKWMVTSSEDGTIKV 121

Query: 312 WDL 314
           WD+
Sbjct: 122 WDV 124

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 112/256 (43%), Gaps = 29/256 (11%)

Query: 128 GNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G   V ++D R ++ + V T+  HK N   +SF   +K  ++++++DG I ++D+ +   
Sbjct: 71  GYQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNK-WMVTSSEDGTIKVWDVRS--- 126

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPF 243
            P        N  +N++  H     L     +   T+ I+DL   +   ++   +     
Sbjct: 127 -PSVPRNYKHNAPVNEVVIHPNQGELISC--DRDGTIKIWDLGENQCTHQLIPDDDNTSL 183

Query: 244 NSLAFSKHSKNLFSAAGTDQNVYLYDLRN-----TRKTLHSMSGHEGPVTNLEFHDSVDG 298
            SL+ +    ++  AA    + Y++++ N       K ++  S H+  +T +     V  
Sbjct: 184 QSLSVAS-DGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKH 242

Query: 299 ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIA 358
            + + S DR   IW         V E   D   E  +   GH+  V D + ++   +L+ 
Sbjct: 243 -MATCSADRTAKIW--------SVGETEDDFNLETTL--DGHQRWVWDCAFSADSAYLVT 291

Query: 359 STEEENIIQVWKSSSR 374
           ++  ++ +++W  S+R
Sbjct: 292 AS-SDHYVRLWDLSTR 306

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
           N++ +YDLRT      I      N++ ++      F  A  D N Y YD+RN  ++L+  
Sbjct: 242 NSVVLYDLRTNSPTQKIVQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVF 301

Query: 281 SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGH 340
             H   V +++F  + D I V+ S D+ I I+   +  S ++    +     +M +    
Sbjct: 302 KDHVSAVMDVDFSPTGDEI-VTGSYDKTIRIFKTNQGHSREIYHTKR--MQHVMQV---- 354

Query: 341 RSSVNDFSLNSSIPWLIASTEEENIIQVWKS 371
                 +S++S   +LI+ +++ N +++W+S
Sbjct: 355 -----KYSMDSK--YLISGSDDGN-VRMWRS 377

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++A+DDG I ++DI   S   + T++   + +
Sbjct: 332 SESYILKQQGHFDSTNSLAYSP-DGSRVVTASDDGKIKVWDIT--SGFCLATFEEHTSSV 388

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      +F   S    T+  +DL   R     T  E  Q FN LA     + + 
Sbjct: 389 -TAVQFAKRGQVMFS--SSLDGTVRAWDLIRYRNFRTFTGTERIQ-FNCLAVDPSGEVVC 444

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  + +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 445 AGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF 501

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 95/222 (42%), Gaps = 25/222 (11%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +NP     L+S++ D    ++D+  +S + ++T     +  + D+++      LF +   
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDL--QSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGG 275

Query: 219 EKNTLSIYDLRTKDKVTSI----------EMEQPFNSLAF-----SKHSKNLFSAAGTDQ 263
           +  ++ ++DLR     T I          ++  P    A      S    N+ +    D 
Sbjct: 276 D-GSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDS 334

Query: 264 N-VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL-MEIGSEQ 321
           + V + D+R+    L ++  H  P+  +++H +   +L+S+S+D +++ WDL   + SE 
Sbjct: 335 SKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSES 394

Query: 322 VNEDAQDATPE-----LMMIHAGHRSSVNDFSLNSSIPWLIA 358
             +   D+ P+       M +A     VN+        W  A
Sbjct: 395 TKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 119 DPNIISTIDGNGT-VSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
           DPN+I+T   + + V I D  S  SP+ T   H      + ++P  +  LLSA+DD  + 
Sbjct: 323 DPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVL 382

Query: 178 MYDIN 182
            +D+N
Sbjct: 383 YWDLN 387

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++A+DDG I ++DI   S   + T++   + +
Sbjct: 329 SESYILKQQGHFDSTNCLAYSP-DGSRVVTASDDGKIKVWDIT--SGFCLATFEEHTSSV 385

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      +F   S    T+  +DL   R     T  E  Q FN LA     + + 
Sbjct: 386 -TAVQFAKRGQVMFS--SSLDGTVRAWDLIRYRNFRTFTGTERIQ-FNCLAVDPSGEVVC 441

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  + +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 442 AGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF 498

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  L+FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +    GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----DTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           +A  DQ + +++ +N RK +  ++GH   V   +FH + D ++VS+S D  I IWD+  +
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPT-DDLIVSASLDETIRIWDISGL 169

Query: 318 GS-----------EQVNE-----DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                        EQ+N      D       +  I  GH   VN  S + ++P LI S  
Sbjct: 170 RKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSAS 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ S+
Sbjct: 229 DDRQVKLWRMSA 240

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 50/264 (18%), Positives = 104/264 (39%), Gaps = 65/264 (24%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI------INDI 203
           H+    GL F+P ++   +SA DD  I ++ ++            T+ C+      ++ +
Sbjct: 52  HEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSLD------------TNKCLYTLTGHLDYV 98

Query: 204 KWHHFDATLFGTVSE-EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTD 262
           +   F   L   +S  +  T+ I++ + + ++  +     F   A    + +L  +A  D
Sbjct: 99  RTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLD 158

Query: 263 QNVYLYDLRNTRKTLHS------------------------------MSGHEGPVTNLEF 292
           + + ++D+   RK  HS                              + GH   V    F
Sbjct: 159 ETIRIWDISGLRKR-HSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASF 217

Query: 293 HDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSS 352
           H ++  ++VS+S+DR++ +W +    + +V+               GH ++V+    +  
Sbjct: 218 HPTLP-LIVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPH 264

Query: 353 IPWLIASTEEENIIQVWKSSSRLP 376
              LI S  E+  ++VW    R P
Sbjct: 265 QN-LIISVGEDKTLRVWDLDKRTP 287

>KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 911

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 90/178 (50%), Gaps = 10/178 (5%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D   GL ++P    ++++A+ +G I ++D+ +          +     
Sbjct: 330 SESYILKQQGHFDTLNGLCYSP-DGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSA 388

Query: 200 INDIKWHH--FDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFS 257
           +   K     F A+L GTV +  + +   + RT    T+ E  Q FNSLA     + + +
Sbjct: 389 VEFAKKGQVLFSASLDGTV-KAWDLIRYRNFRT---FTATERIQ-FNSLAVDPSGEVVCA 443

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
            +    +++++ ++ T + + ++SGHEGP++ L F +  +G+L S+S D+ I +W L 
Sbjct: 444 GSEDSFDIFVWSVQ-TGQLVDTLSGHEGPISCLSFSNE-NGVLASASWDKTIRVWSLF 499

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 19/106 (17%)

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPE 332
           TR  LH  +  E  V +L+F  S DG L + +  R + IW      + +  ED Q A   
Sbjct: 86  TRNVLHHFNFKE-KVYDLKF--SPDGKLFALACGRFLQIWR-----TPETTEDRQFAPFV 137

Query: 333 LMMIHAGHRSSVNDFSLNSSIPW-----LIASTEEENIIQVWKSSS 373
              IHAGH S +      +S+ W      I ST ++   ++W  +S
Sbjct: 138 RYRIHAGHFSDI------TSLTWSKDSRFIISTSKDLTARIWSVNS 177

>Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON}
           YDR364C (REAL)
          Length = 455

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS 304
           +L F   + +LF + G D  + ++D  + R+ L    GH  P+  L F D     L SSS
Sbjct: 167 ALKFLPKTGHLFLSGGNDHTIKIWDFYHDRECLRDFQGHTKPIKALRFADDCLSFL-SSS 225

Query: 305 EDRRIIIWD 313
            DR + +WD
Sbjct: 226 FDRNVKMWD 234

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 89/210 (42%), Gaps = 29/210 (13%)

Query: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE---------DPVETWQS 194
           ++ Y+ H      L F P +    LS  +D  I ++D   + E          P++  + 
Sbjct: 155 IRKYAGHSSGTTALKFLPKTGHLFLSGGNDHTIKIWDFYHDRECLRDFQGHTKPIKALRF 214

Query: 195 TDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKN 254
            D+C+             F + S ++N + ++D  T    T + ++     +     + +
Sbjct: 215 ADDCLS------------FLSSSFDRN-VKMWDTETGKVKTRLHLKSTPADVESRPTNPH 261

Query: 255 LFSAAGTDQNVYLYDLRNTRKT--LHSMSGHEGPVTNLEFHDSVDG-ILVSSSEDRRIII 311
            F    ++  +  YD R + K   + +   H   +  L++    DG   +SSSED+ + I
Sbjct: 262 EFIVGLSNSKILHYDDRVSEKQGLVQTYDHHLSSILALKYFP--DGSKFISSSEDKTVRI 319

Query: 312 WD-LMEIGSEQVNEDAQDATPELMMIHAGH 340
           W+  + +  +Q+++ AQ + P  + +H  H
Sbjct: 320 WENQINVPIKQISDTAQHSMP-FLNVHPSH 348

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 249 SKHSKNLFSAAGTDQN-VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDR 307
           S +  N+ +    D N + + D+RN    + ++ GH   V  +++H +   +L+S S+D 
Sbjct: 360 SPYDPNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDC 419

Query: 308 RIIIWDL----MEIGSEQVNEDAQDATP 331
           +++ WDL    MEI    V       TP
Sbjct: 420 QVLYWDLNNSFMEINGGSVKSPGASGTP 447

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  L+FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +    GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----DTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-- 315
           +A  DQ + +++ +N RK +  ++GH   V   +FH + D ++VS+S D  I IWD+   
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPT-DDLIVSASLDETIRIWDISGL 169

Query: 316 --------------EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                         ++ ++Q   D       +  I  GH   VN  S + ++P LI S  
Sbjct: 170 RKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGS 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ S+
Sbjct: 229 DDRQVKLWRMSA 240

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  +   D+ V L+ +  T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTLRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S +  F L+   P
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP 328

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++A+DDG I ++D+   S   + T++   + +
Sbjct: 334 SESYILKQQGHFDSTNSLAYSP-DGSRVVTASDDGKIKVWDVT--SGFCLATFEEHTSSV 390

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      +F   S    T+  +DL   R     T  E  Q FN LA     + + 
Sbjct: 391 -TAVQFAKRGQVMFS--SSMDGTVRAWDLIRYRNFRTFTGTERIQ-FNCLAVDPSGEVVC 446

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  + +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 447 AGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF 503

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D    L+++P    ++++AA+DG I ++D+   S   + T+Q   + +
Sbjct: 332 SESYILKQQGHFDATNSLTYSP-DGSRVVTAAEDGKIKVWDV--VSGFCLATFQEHTSSV 388

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      LF   S    T+  +DL   R     T+ E  Q FN LA     + + 
Sbjct: 389 -TQVQFAKRGQVLFS--SSLDGTVRAWDLIRYRNFRTFTAAERIQ-FNCLAVDPSGEVVC 444

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  + +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ + +W + 
Sbjct: 445 AGSLDNFDIHVWSVQ-TGQLLDTLSGHEGPVSCLAFSQE-NSVLASASWDKTVRVWSIF 501

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 19/168 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L TK  + ++     +    F         +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM----------------EIGSEQVNED 325
           GH   V   +FH + D ++VS+S D  + +WD+                 +I ++Q   D
Sbjct: 135 GHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                  +  I  GH   VN  S + ++P LI S  ++  +++W+ SS
Sbjct: 194 GGFGDCVVKFILEGHARGVNWASFHPTLP-LIVSGGDDRQVKLWRMSS 240

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 264 NVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVN 323
           ++ L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L         
Sbjct: 34  SIQLWDYR-MGTLLHKFEDHEGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL--------- 82

Query: 324 EDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                 T + +    GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  -----DTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ + +T+   + +  GH   V ++ FH     +++S  ED+ I +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTIRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S +  F L+   P
Sbjct: 282 LDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERP 328

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 9/100 (9%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +L +  G D  V L+D+R TRK + ++ GH+ P+T ++    VD  +VSSS D  + +WD
Sbjct: 184 DLIATGGRDAVVKLWDIR-TRKAVKTLVGHKAPITKVKC-TPVDPQVVSSSTDTTVRLWD 241

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSI 353
           ++   S +V    + A   + + H G      +FSL S+ 
Sbjct: 242 IVAGKSMKVLTHHKRAVRSIAL-HPG------EFSLASAC 274

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 43/90 (47%), Gaps = 15/90 (16%)

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAG 339
           ++GH G V  +      +   V+ S D  + +WDL              A+ +L +  +G
Sbjct: 82  INGHLGWVRCVAVEPVDNEWFVTGSNDTTLKVWDL--------------ASGKLKLTLSG 127

Query: 340 HRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           H   V D +++   P++ +++E++ +++ W
Sbjct: 128 HTMGVRDVAVSERHPYMFSASEDK-LVKCW 156

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 111/289 (38%), Gaps = 57/289 (19%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD 180
           N +    G+G++ +FD +    P+  +  H       ++N I+K   +S++ DG + ++ 
Sbjct: 75  NQVLVAQGDGSLRLFDTSLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKIWT 134

Query: 181 INAESE------DPVETWQSTDNCI--INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKD 232
            N +         PV   Q  DN I   N  +         GT+S  KN   IY  +   
Sbjct: 135 PNRKESLRTLQVQPVMQSQLVDNTIAKTNGSR---------GTISANKNC--IYQAQ--- 180

Query: 233 KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLR--NTRKTLHSMSGHEGPVT-N 289
                          FS H +NL      +  V L+DLR  N+         H G  T  
Sbjct: 181 ---------------FSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLT 225

Query: 290 LEFHDSVDGILVSSSEDRRIIIWD---LMEIG--SEQVNEDAQDATPELMMIHAGHRSSV 344
            +F+     ++ +S  D  I IWD   L+ +G  S+ +N  A      +  I   H  +V
Sbjct: 226 CDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQHINSSA----ACINEITRAHELAV 281

Query: 345 NDFSLNSSIPWLIASTEEENIIQVWKSSS--------RLPRISNSKPFI 385
              + +   P ++ S   +    VW+  S        +   I +SK FI
Sbjct: 282 RKVAWSPHHPNVLLSASYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGFI 330

>Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W
           (REAL)
          Length = 391

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 69/164 (42%), Gaps = 31/164 (18%)

Query: 227 DLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGP 286
           D R         M      L F     N       D+ + +YD  N +K L  +SGH+G 
Sbjct: 14  DFRPGRTTLRGHMTSVITCLQFED---NYVITGADDKMIRVYDAIN-KKFLLQLSGHDGG 69

Query: 287 VTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND 346
           V  L++  S DGILVS S D  + +WD+ +     V E              GH+S+V  
Sbjct: 70  VWALKY--SHDGILVSGSADSTVRVWDIKKGYCTHVFE--------------GHKSTVRC 113

Query: 347 FSL----NSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFIN 386
             +    N++    I +   +N + VWK    LP+ S++  + N
Sbjct: 114 LDIVEYENTN---YIVTGSRDNTLHVWK----LPKKSSATDYEN 150

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  L+FH +   I VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRGLDFHPT-QPIFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   V     +  +PW+I++++++ I I  W++   +  ++    
Sbjct: 83  ----ETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQNRKEIACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 75/167 (44%), Gaps = 19/167 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L T   + +++    +    F  H      +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM----------------EIGSEQVNED 325
           GH   V   +FH + D ++VS+S D  + +WD+                 +I ++    D
Sbjct: 135 GHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHSAPGTTSMEDQIAAQNNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSS 372
                  +  I  GH   VN  S + ++P LI S  ++  +++W+ S
Sbjct: 194 GGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 107/257 (41%), Gaps = 51/257 (19%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFD 209
           H+    GL F+P ++   +SA DD  I ++ +  E+   + T Q   +  +  + +HH  
Sbjct: 52  HEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSL--ETNKCLYTLQGHLD-YVRTVFFHHEL 107

Query: 210 ATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
             +    + +  T+ I++ + + ++  +     F   A    +++L  +A  D++V ++D
Sbjct: 108 PWIIS--ASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPNEDLVVSASLDESVRVWD 165

Query: 270 LRNTRKTLHS------------------------------MSGHEGPVTNLEFHDSVDGI 299
           +   RK  HS                              + GH   V    FH ++  +
Sbjct: 166 ISGLRKK-HSAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-L 223

Query: 300 LVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
           +VS S+DR++ +W + +  + +V+               GH ++V D  +      LI S
Sbjct: 224 IVSGSDDRQVKLWRMSQTKAWEVD------------TCRGHTNNV-DCVIFHPHQNLIIS 270

Query: 360 TEEENIIQVWKSSSRLP 376
             E+  +++W    R+P
Sbjct: 271 VGEDKTLRIWDLDKRVP 287

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/247 (20%), Positives = 102/247 (41%), Gaps = 42/247 (17%)

Query: 76  SIELPNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIF 135
           SI L ++ +  +  S   +K N ++  K     ++    Y  +  N ++    +  +SI+
Sbjct: 152 SISLVHDFMSTNQSSQGIIKRNKQV--KLSTIADVKTGYYNYK--NYVAVSSNSTVISIY 207

Query: 136 DRNSSDSP----VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVET 191
           D N S S     V ++  H  +     FN +    ++S   DG I ++D+ + + +  + 
Sbjct: 208 DINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCIKIWDLRSNNPNRCDV 267

Query: 192 WQSTDNCIINDIKW---HHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAF 248
             ST +  + D+KW   H+F +T  G +                              A 
Sbjct: 268 SISTSSDSVRDVKWMPYHNFSSTPTGGLE-----------------------------AS 298

Query: 249 SKHSKNLFSAAGTDQNVYL-YDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDR 307
           S++S     A+  D  + L +D+R   +    ++ H GP   L +H +++ I  +   D 
Sbjct: 299 SENSMGYKFASIHDSGLLLKFDIRQPNQVEQKINAHTGPGLCLNWHPNLNYI-TTGGRDG 357

Query: 308 RIIIWDL 314
           ++ +W+L
Sbjct: 358 KLCVWNL 364

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 91/193 (47%), Gaps = 13/193 (6%)

Query: 129 NGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLL-SAADDGYIAMYDINAESED 187
           +G +S+FD  S +S + +   H     GL +N  S+G LL + ADD Y+ +   N ES  
Sbjct: 199 DGGISVFDCESLES-LASLPAHAGKVGGLDWN--SEGSLLVTGADDNYVRLTRYNGESNG 255

Query: 188 --PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEME-QPFN 244
              V T    +N ++N + +H  D   +   +    T  ++D+ T  ++   E   +   
Sbjct: 256 LVNVATLGGHENRVVNTV-FHPSDK--YVASASFDTTWRLWDVETAQELQLQEGHSKEVY 312

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSS 304
           SL+F      L  + G D    ++DLR+  K + ++ GH  PV  +++  S    L +  
Sbjct: 313 SLSFQPDGA-LICSGGLDSLAMVWDLRSG-KNIVTLQGHAKPVYCVDW-SSNSHQLATGG 369

Query: 305 EDRRIIIWDLMEI 317
            D  + +WDL ++
Sbjct: 370 GDGVVNVWDLRKL 382

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 92/180 (51%), Gaps = 14/180 (7%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D    L+++P    ++++AA+DG I ++D+   S   + T++   + +
Sbjct: 330 SESYILKQQGHFDATNSLTYSP-DGSRVVTAAEDGKIKVWDV--ASGFCLATFEEHTSAV 386

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      LF   +    T+  +DL   R     T+ E  Q F  LA  + S  + 
Sbjct: 387 -TAVQFAKKGQVLFS--ASLDGTVRAWDLIRYRNFRVFTATERVQ-FTCLAV-EPSGEVV 441

Query: 257 SAAGTDQ-NVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           SA  TD  +V+++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 442 SAGSTDSFDVFVWSVQ-TGQLLDTLSGHEGPVSCLAFSME-NAVLASASWDKTIRIWSIF 499

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/198 (21%), Positives = 86/198 (43%), Gaps = 19/198 (9%)

Query: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVT 235
           I ++D N  +     +W   DN  I  +K++  +  +F +   + N++ +YDLRT     
Sbjct: 195 IQLWDSNRSTPLSNLSW-GADN--ITTVKFNQNETDIFASAGSD-NSIVLYDLRTNSPTQ 250

Query: 236 SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
            I      N++ ++      F     D N Y YD+RN  + ++    H   V +++F  +
Sbjct: 251 KIVQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPT 310

Query: 296 VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPW 355
            D I V+ S D+ I I+   +  S ++              H      V     +    +
Sbjct: 311 GDEI-VTGSYDKTIRIFKTNQGHSREI-------------YHTKRMQHVFQVKFSMDSKY 356

Query: 356 LIASTEEENIIQVWKSSS 373
           +I+ +++ N +++W+S +
Sbjct: 357 VISGSDDGN-VRLWRSKA 373

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 126 IDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI--NA 183
           + G   + ++D N S +P+   S+  DN   + FN        SA  D  I +YD+  N+
Sbjct: 189 VTGGAQIQLWDSNRS-TPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNS 247

Query: 184 ESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI 237
            ++  V+T ++      N I W+  +A  F   +E+ N    YD+R   +  ++
Sbjct: 248 PTQKIVQTMRT------NAICWNPMEAFNFVIGNEDHNAY-YYDMRNMSRAINV 294

>KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}
           Anc_2.663 YKL021C
          Length = 389

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 18/120 (15%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFH--DSVDGILVSSSEDRRI 309
           SK    +   D+++ +YDL+  RK L ++  H+G +T L+F   +S    ++SSSED +I
Sbjct: 51  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITALKFSSGESNGKWMLSSSEDNKI 109

Query: 310 IIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           IIW + +               E   +  GH   VND +++ S   +  S  +++ I++W
Sbjct: 110 IIWRVKDW--------------ENYGVLKGHLKRVNDIAIHPS-SRVAVSVSDDHSIRLW 154

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 169 SAADDGYIAMYDINAESEDPVETWQSTDNCII---NDIKWHHFDATLFGTVSEEKNTLSI 225
           +A D+  +A +D     +D V    +T N I+   ND    H+D      +     T+++
Sbjct: 361 NANDNLCLATFD---GHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL 417

Query: 226 YDLRTKDKVTSIEMEQPFNS--LAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGH 283
                   V+ +++   FN+  +  +    N       D  VYL+DLR  R  + S+ GH
Sbjct: 418 K--MVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGR-VVGSLEGH 474

Query: 284 EGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
            GP+T+L++  S    L++ S D+   IWDL
Sbjct: 475 RGPITSLKYMGSE---LITGSMDKSTRIWDL 502

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 243 FNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVS 302
            NSLA +     L S A  D  + L+D+ +T + L  +SGH   V    F D    +L S
Sbjct: 283 INSLAINAQLGVLSSTANLDNEIKLWDI-STTQCLGVLSGHRATVNTTRFIDDTR-LLAS 340

Query: 303 SSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSV 344
           + +D  + +WD+  I    V++D        +    GH+ SV
Sbjct: 341 AGKDASVKVWDVDNI----VDKDGNANDNLCLATFDGHKDSV 378

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 19/168 (11%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L TK  + ++     +    F         +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM----------------EIGSEQVNED 325
           GH   V   +FH + D ++VS+S D  + +WD+                 +I ++Q   D
Sbjct: 135 GHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                  +  I  GH   VN  S + ++P LI S  ++  +++W+ SS
Sbjct: 194 GGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGDDRQVKLWRMSS 240

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 17/111 (15%)

Query: 264 NVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVN 323
           ++ L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L         
Sbjct: 34  SIQLWDYR-MGTLLHKFEDHEGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL--------- 82

Query: 324 EDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                 T + +    GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  -----DTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQT-IRIWNWQNR 127

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ + +T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTVRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S +  F L+   P
Sbjct: 282 LDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERP 328

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           +A  DQ + +++ +N RK +  ++GH   V + +FH + D ++VS+S D  I +WD+  +
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMSAQFHPTED-LVVSASLDETIRVWDISGL 169

Query: 318 GSEQVNEDAQDATPELMM----------------IHAGHRSSVNDFSLNSSIPWLIASTE 361
             +     A     +++M                I  GH   VN  S + ++P LI S  
Sbjct: 170 RKKHSAPGATSLEDQMLMQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGG 228

Query: 362 EENIIQVWKSSS 373
           ++  +++W+ SS
Sbjct: 229 DDRQVKLWRMSS 240

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRYEDHEGPVRAVDFHPT-QPLFVSAGDDYNIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +    GH   V     ++ +PW+I++++++  I++W   +R
Sbjct: 83  ----DTNKCLYTLTGHLDYVRTVFFHNELPWIISASDDQT-IRIWNWQNR 127

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ + +T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 223 LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTLRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S +  F L+   P
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP 328

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 76/172 (44%), Gaps = 23/172 (13%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L T   + ++E    +    F         +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLETNKCLYTLEGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN-RKEIACIT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM--------------------EIGSEQ 321
           GH   V   +FH + D ++VS+S D  + +WD+                     +I ++Q
Sbjct: 135 GHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHSAPGGANIPSTFEEKIAAQQ 193

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              D       +  I  GH   VN  S + ++P LI S  ++  +++WK S+
Sbjct: 194 NLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMSA 244

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    H+GPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHDGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   V     +  +PW+I++++++ I I  W++   +  I+    
Sbjct: 83  ----ETNKCLYTLEGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACITGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ +  T+   L S  GH   V ++ FH +   +++S  ED+ + IWD
Sbjct: 227 LIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPT-QNLIISVGEDKTLRIWD 285

Query: 314 L-MEIGSEQVNEDAQD-----ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L   +  +Q   +        A P + +  A H S +  F L+   P
Sbjct: 286 LDKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 84/189 (44%), Gaps = 15/189 (7%)

Query: 144 VKTYSYHKDNGYG-----LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198
           + +YS    N  G     L   P+ +  LLS+  +G + + D N  + + + T ++  N 
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWN--TGNCIRTVKAG-NT 57

Query: 199 IINDIKWHHFDATLFGTVSEEKN-TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFS 257
            IN ++    D       S   N  + + DLR +      E+     +   S  S++   
Sbjct: 58  SINRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGML 117

Query: 258 AAGT-----DQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           A GT     D  +++YD+RN  K +  +   H   VT+++FH S   +L+S S D    +
Sbjct: 118 ACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177

Query: 312 WDLMEIGSE 320
           +DL ++  E
Sbjct: 178 YDLTQVEEE 186

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 20/117 (17%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           NL +A   D  + ++DL  ++  L S SGH+  VT L+F DS    L+S S D  IIIWD
Sbjct: 90  NLLAAGYADGVIKIWDLM-SKTVLLSFSGHKSGVTILKF-DSTGTRLMSGSRDSDIIIWD 147

Query: 314 LM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           L+ E+G  ++                 H+ ++          WL+ ST ++ +I++W
Sbjct: 148 LVSEVGVFKLR---------------SHKDAITGIWCEGE-DWLV-STAKDGLIKLW 187

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 24/234 (10%)

Query: 145 KTYSYHKDNGY-GLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDI 203
           K+ S   D G+  +S NP  +  +L++    YI   D++     P   + +T +  + D+
Sbjct: 17  KSLSLKVDGGFNAVSINPSGRDVVLASRQGLYII--DLDDPFSPPRWLYHAT-SWQVADV 73

Query: 204 KWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEM-----EQPFNSLAFSKHSKNLFSA 258
           +W    A  +  VS       I++L TK    +IE       +    + FS    ++ + 
Sbjct: 74  QWSPHPAKPYWVVSTSNQKAIIWNL-TKTSSNAIEYVLHGHSRAITDINFSPQHPDILAT 132

Query: 259 AGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIG 318
              D  V+ +D+R+ ++  +S S  +     ++++ S   I+ SS  D  + IWDL    
Sbjct: 133 CSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVNIMASSHGDD-VFIWDLR--- 188

Query: 319 SEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSS 372
                     +TP   +  + H SSVN    N      I S+  +  ++ W  S
Sbjct: 189 --------NGSTPLFKL--SSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYS 232

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           D NI+++  G+  V I+D  +  +P+   S H+ +   + FN     +++S+++DG +  
Sbjct: 170 DVNIMASSHGDD-VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKF 228

Query: 179 YDINAESEDPVET 191
           +D +   ED + T
Sbjct: 229 WDYSRNVEDSLRT 241

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS  +D  + +W L          
Sbjct: 35  IQLWDYR-MGVLLHRFEDHEGPVRGVDFHPT-QPLFVSGGDDYTVKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
              D+   L  +H GH   V     ++ +PW+I++++++ I I  W++   +  ++    
Sbjct: 83  ---DSRKCLFTLH-GHLDYVRTVFFHNELPWIISASDDQTIRIWNWQNRKEIACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 18/131 (13%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           +A  DQ + +++ +N RK +  ++GH   V   +FH + D +++S+S D  + +WD+  +
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPNED-LVISASLDETVRVWDISGL 169

Query: 318 -------GSEQVNE--------DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEE 362
                  GS+  +E        D       +  I  GH   VN  S + ++P LI S  +
Sbjct: 170 RKRHSAPGSQNFDEVISQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSD 228

Query: 363 ENIIQVWKSSS 373
           +  +++W+ S+
Sbjct: 229 DRQVKLWRMSA 239

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 222 TLSIYDLRTKDKVTSIE-MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
           T+ ++D R    +   E  E P   + F   ++ LF + G D  V ++ L ++RK L ++
Sbjct: 34  TIQLWDYRMGVLLHRFEDHEGPVRGVDFHP-TQPLFVSGGDDYTVKVWSL-DSRKCLFTL 91

Query: 281 SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
            GH   V  + FH+ +  I +S+S+D+ I IW+
Sbjct: 92  HGHLDYVRTVFFHNELPWI-ISASDDQTIRIWN 123

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 78/160 (48%), Gaps = 32/160 (20%)

Query: 223 LSIYDLRTKDKVTSI-----------EMEQPFNSLAFSKHSK-NLFSAAGTDQNVYLYDL 270
           ++++DL+T D V+ +           +  +P  +     H++ NL +    +  + ++DL
Sbjct: 45  VNLWDLKTGDLVSCLSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDL 104

Query: 271 RNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-EIGSEQVNEDAQDA 329
             ++  L +++GH+  VT L+F D     L+S S+D  II+WDL+ E+G  ++       
Sbjct: 105 M-SKTVLLTLNGHKSAVTILKF-DITGTRLISGSQDSNIIMWDLIGEVGLYKLR------ 156

Query: 330 TPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
                     H+ +++   L     WLI ST  + +I+VW
Sbjct: 157 ---------SHKGAISGLWLEKD-EWLI-STSRDGLIKVW 185

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 66/154 (42%), Gaps = 17/154 (11%)

Query: 162 ISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKN 221
           +  G L+S   DG +    I+A+S  P ET              +H +  L   V   + 
Sbjct: 50  LKTGDLVSCLSDG-LPPGSIDAKSTKPAETTYLE----------YHAETNLLA-VGYAEG 97

Query: 222 TLSIYDLRTKDKVTSIEMEQ-PFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
            + ++DL +K  + ++   +     L F      L S +  D N+ ++DL      L+ +
Sbjct: 98  VIKVWDLMSKTVLLTLNGHKSAVTILKFDITGTRLISGS-QDSNIIMWDLIG-EVGLYKL 155

Query: 281 SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
             H+G ++ L      D  L+S+S D  I +WDL
Sbjct: 156 RSHKGAISGLWLEK--DEWLISTSRDGLIKVWDL 187

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 5/110 (4%)

Query: 208 FDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ-PFNSLAFSKHSKNLFSAAGTDQNVY 266
           FD+ +  T S +KN + I+ L   D   S+   Q    S+ F   S N FS +  D  V 
Sbjct: 577 FDSKVIITSSADKN-IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCS-KDGLVK 634

Query: 267 LYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
            +D  +  + +  ++GH+  V  L   ++    +VS+S DR I IW+  E
Sbjct: 635 YWD-GDKFECIQKLAGHQSEVWALAISNN-GKYVVSASHDRSIRIWEETE 682

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 19/117 (16%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +L +    D N+ ++DL  ++  L +++GH+  +T L+F D     LVS S D  IIIWD
Sbjct: 92  SLLAVGYRDGNIKVWDLV-SKTVLINLNGHKSSITVLKF-DVNCTRLVSGSSDSNIIIWD 149

Query: 314 LM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           L+ E+G  ++                 H+  ++D  ++    WL+ S  ++ +I+VW
Sbjct: 150 LVSEVGICKLR---------------SHKDRISDLYVDDDFNWLL-SVSKDGLIKVW 190

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKT-LHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII 310
           S   F AA    NV LYD+R T    + S  GH G VT++ F    +  +VSSSED  I 
Sbjct: 42  SDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE-NKWMVSSSEDGTIK 100

Query: 311 IWDLMEIGSEQVNEDAQDATPELMM 335
           +WD+    S Q N   Q A  E+++
Sbjct: 101 VWDV-RAPSVQRNYKHQAAVNEVVI 124

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 223 LSIYDLRTKDK--VTSIEMEQP-FNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
           + +YD+RT +   VTS E  +    S+AF + +K + S++  D  + ++D+R    ++  
Sbjct: 55  VRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSS-EDGTIKVWDVR--APSVQR 111

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
              H+  V  +  H +  G L+S  +D  + IWDL E
Sbjct: 112 NYKHQAAVNEVVIHPN-QGELISCDQDGNVRIWDLGE 147

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 128 GNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G+  V ++D R ++ +PV ++  H+ N   ++F   +K  ++S+++DG I ++D+ A S 
Sbjct: 51  GHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK-WMVSSSEDGTIKVWDVRAPSV 109

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFN 244
                 Q+     +N++  H     L     ++   + I+DL     V  +  E + P  
Sbjct: 110 QRNYKHQAA----VNEVVIHPNQGELISC--DQDGNVRIWDLGENQCVHQLAPEDDTPLQ 163

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS-VDGILVSS 303
           SL+ +    ++  A     N Y++ + +      + + +  PVT    H   +  +L+SS
Sbjct: 164 SLSVAS-DGSMLVAGNNKGNCYVWQMPH-----QTDAANPKPVTKFRSHAKYITRVLLSS 217

Query: 304 SEDRRIIIWDLMEIGSEQVNEDAQ----DATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
                    D+  + +   +  A+    D   +L      H+  V D + ++   +L+ +
Sbjct: 218 ---------DVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTA 268

Query: 360 TEEENIIQVWKSSSR 374
              ++ +++W  S+R
Sbjct: 269 C-SDHYVRLWDLSTR 282

>NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663
          Length = 384

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 11/71 (15%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSV----DG------ILV 301
           SK    +   D+++ +YDL+  RK L ++  H+G +TNL+F  S     DG       L+
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLL 108

Query: 302 SSSEDRRIIIW 312
           S+SED +IIIW
Sbjct: 109 SASEDNKIIIW 119

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 57/112 (50%), Gaps = 15/112 (13%)

Query: 223 LSIYDLRTKDKVTSIEMEQ-PFNSLAFSK-----------HSKNLFSAAGTDQNVYLYDL 270
           + IYDL+ + ++ ++   Q    +L FSK           ++K L SA+  D  + ++ +
Sbjct: 63  IRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEGSNNKWLLSAS-EDNKIIIWRV 121

Query: 271 RNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQV 322
           ++  +   ++ GH   + +++ H S + + +S SED  I +W+LM +    V
Sbjct: 122 KDW-ENFGTLKGHIARINDVDIHPS-NRVAISVSEDHSIRLWNLMTVKKAAV 171

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++A++DG I ++DI   S   + T++   + +
Sbjct: 334 SESYILKQQGHFDSTNSLAYSP-DGSRVVTASEDGKIKVWDIT--SGFCLATFEEHTSSV 390

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      +F   S    T+  +DL   R     T  E  Q FN LA     + + 
Sbjct: 391 -TAVQFAKRGQVMFS--SSLDGTVRAWDLIRYRNFRTFTGTERIQ-FNCLAVDPSGEVVC 446

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  + +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 447 AGSLDNFDIHVWSVQ-TGQLLDALSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF 503

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 118/255 (46%), Gaps = 31/255 (12%)

Query: 128 GNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G+  V ++D R ++ +PV T+  HK N   LSF   ++  ++++++DG I ++D+ +   
Sbjct: 51  GHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNR-WMVTSSEDGTIKVWDVRS--- 106

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFN 244
            P        N  +N++  H     L     +    + I+DL        +  E   P  
Sbjct: 107 -PSVPRNYKHNAPVNEVVIHPNQGELISC--DRDGNIRIWDLGENQCTHQLTPEDNTPLQ 163

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS-VDGILVSS 303
           SL+ +    ++  AA +  N Y++++ N     H+ + +  PVT  + H + +  IL+SS
Sbjct: 164 SLSVAS-DGSMLVAANSKGNCYVWEMPN-----HTDASNLKPVTKFKAHSNYITRILLSS 217

Query: 304 SEDRRIIIWDLMEIGSEQVNEDAQ----DATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
                    D+  + +   ++ A+    D   +L     GH+  V D + ++   +L+ +
Sbjct: 218 ---------DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268

Query: 360 TEEENIIQVWKSSSR 374
           +  ++ +++W  S+R
Sbjct: 269 S-SDHYVRLWDLSTR 282

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 17/155 (10%)

Query: 166 QLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIN-----DIKWHHFDATLFGTVSEEK 220
           +LL AA    + +YDI   + +PV T++     + +     D +W           S E 
Sbjct: 45  KLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM--------VTSSED 96

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
            T+ ++D+R+     + +   P N +    +   L S    D N+ ++DL   + T    
Sbjct: 97  GTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELIS-CDRDGNIRIWDLGENQCTHQLT 155

Query: 281 SGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWDL 314
                P+ +L    + DG +LV+++      +W++
Sbjct: 156 PEDNTPLQSLSV--ASDGSMLVAANSKGNCYVWEM 188

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           I  +K++  +  +  +   + N++ +YD+RT      I      N++ ++      F  A
Sbjct: 216 ITSVKFNQTETDILASTGSD-NSIVLYDVRTNSPTQKIVQRLRTNAICWNPMEAFNFVTA 274

Query: 260 GTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
             D N Y YD+RN  + L+    H   V +++F  + D I V+ S D+ I I+
Sbjct: 275 NEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDEI-VTGSYDKTIRIF 326

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
           N++ +YDLRT      I      N++ ++      F  A  D N Y YD+RN  + L+  
Sbjct: 236 NSVVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVF 295

Query: 281 SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQV 322
             H   V +++F  + D I V+ S D+ + I+ +    S ++
Sbjct: 296 KDHVSAVMDVDFSPTGDEI-VTGSYDKTVRIYQVNHGHSREI 336

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 12/125 (9%)

Query: 248 FSKHSK--NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSE 305
           F +H K  NL +    D  V ++DL  ++  L +++GH   +T L+F D+    L+S S 
Sbjct: 111 FLQHHKETNLLAVGYNDGVVKVWDLY-SKTVLCNLNGHSSAITALKF-DTSGTRLISGSR 168

Query: 306 DRRIIIWDLM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEEN 364
           D  II+WDL+ E+G  ++    +DA   +           N+    + + WLI ST ++ 
Sbjct: 169 DSNIIVWDLVSEVGLYKLRSH-KDAITGIWC-----NEVTNNNQEENELDWLI-STSKDG 221

Query: 365 IIQVW 369
           +I++W
Sbjct: 222 LIKIW 226

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 23/163 (14%)

Query: 162 ISKGQLLSAADDGYIAM-YDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEK 220
           +  G+L S  +DG +     ++A+S  P ET              HH +  L   V    
Sbjct: 79  LKTGELASFLNDGLVPPPGSVDAKSSKPAET----------TFLQHHKETNLLA-VGYND 127

Query: 221 NTLSIYDLRTKDKVTSIE-MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
             + ++DL +K  + ++        +L F      L S +  D N+ ++DL  +   L+ 
Sbjct: 128 GVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGS-RDSNIIVWDLV-SEVGLYK 185

Query: 280 MSGHEGPVTNLEFHDSVDG--------ILVSSSEDRRIIIWDL 314
           +  H+  +T +  ++  +          L+S+S+D  I IWDL
Sbjct: 186 LRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDL 228

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 78/176 (44%), Gaps = 21/176 (11%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +NPI    L+S++ D    ++D+  +S + V T     +  + D+K+      LF +   
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDL--QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGG 287

Query: 219 EKNTLSIYDLRT----------------KDKVTSIEME-QPFNSLAFSKHSKNLFSAAGT 261
           +  ++ ++DLR+                 D +T  E        L  S    N+ +    
Sbjct: 288 D-GSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFAL 346

Query: 262 D-QNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
           D +++ + D+RN    + ++ GH   V  +++H     +L+S  +D +++ WDL E
Sbjct: 347 DSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 100 ITKKFKLEKEITRSRYMVQDPNIISTID-GNGTVSIFDRNSSDSPVKTYSYHKDNGYGLS 158
           +T   K    + R +    DPN+++T    + ++ I D  +  SPV T   H      + 
Sbjct: 318 LTDNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIK 377

Query: 159 FNPISKGQLLSAADDGYIAMYDIN 182
           ++P     LLS  DD  +  +D+N
Sbjct: 378 WHPKKSNVLLSCGDDCQVLYWDLN 401

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 88/193 (45%), Gaps = 25/193 (12%)

Query: 153 NGYGLSFNPISKGQ-LLSAADDGYIAMYDIN-AESEDPVETWQSTDNCIINDIKWHHFD- 209
           N +   F P+ K   LL +  +G I   D    +S+  +       N  IND+K  + D 
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRV----SNLSINDLKILNSDF 72

Query: 210 --ATLFGTVSEEKNTLSIYDLRTKDK-VTSIEMEQ--PFNSLAFSKHSKNLFSA--AGTD 262
              +LF T + E  ++ I+D+ + +  + ++  ++  PF SL  S+H          G D
Sbjct: 73  HCGSLFSTATAE--SVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHGLLAMGTELQGVD 129

Query: 263 QNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQ 321
             + +YD+R     L S+   H   VT L+FH S   +L+S S D    ++DL +     
Sbjct: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----- 184

Query: 322 VNEDAQDATPELM 334
             +D  DA  ++M
Sbjct: 185 --QDEDDALHQVM 195

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187
           ++I+D    D+P+++    H D+   L F+P     LLS + DGY  +YD+  + ED
Sbjct: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGVLLHRFEEHEGPVRGVDFHPT-QPLFVSAGDDYSIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
               +T + +    GH   V     ++ +PW+I++++++ I I  W++   +  ++    
Sbjct: 83  ----STHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 52/94 (55%), Gaps = 4/94 (4%)

Query: 221 NTLSIYDLRTKDKVTSIE-MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
           +T+ ++D R    +   E  E P   + F   ++ LF +AG D ++ ++ L +T K L +
Sbjct: 33  STIQLWDYRMGVLLHRFEEHEGPVRGVDFHP-TQPLFVSAGDDYSIKVWSL-STHKCLFT 90

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           ++GH   V  + FH  +  I +S+S+D+ I IW+
Sbjct: 91  LNGHLDYVRTVFFHTELPWI-ISASDDQTIRIWN 123

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 53/269 (19%), Positives = 107/269 (39%), Gaps = 69/269 (25%)

Query: 147 YSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI------I 200
           +  H+    G+ F+P ++   +SA DD  I ++ +            ST  C+      +
Sbjct: 49  FEEHEGPVRGVDFHP-TQPLFVSAGDDYSIKVWSL------------STHKCLFTLNGHL 95

Query: 201 NDIKWHHFDATLFGTVSE-EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAA 259
           + ++   F   L   +S  +  T+ I++ + + ++  +     F   A    +++L  +A
Sbjct: 96  DYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSA 155

Query: 260 GTDQNVYLYDLRNTRKTLHS------------------------------MSGHEGPVTN 289
             D+ V ++D+   RK  HS                              + GH   V  
Sbjct: 156 SLDETVRIWDISGLRKR-HSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNW 214

Query: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSL 349
             FH ++  ++VS S+DR++ +W +    + +V+               GH ++V+    
Sbjct: 215 ASFHPTLP-LIVSGSDDRQVKLWRMSSTKAWEVD------------TCRGHTNNVDSVIF 261

Query: 350 NSSIPW--LIASTEEENIIQVWKSSSRLP 376
           +   P+  LI S  E++ I+VW    R P
Sbjct: 262 H---PFQNLIISVGEDSTIRVWDLDKRTP 287

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGI-LVSS 303
           SL F  +S NL  + G D  V ++D  + R  L    GH   + +L+F+D  DG   +SS
Sbjct: 160 SLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFND--DGTNFISS 217

Query: 304 SEDRRIIIWD 313
           S D  I IWD
Sbjct: 218 SFDHTIKIWD 227

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 83/188 (44%), Gaps = 10/188 (5%)

Query: 150 HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFD 209
           H +    L+F P S   LLS  +D  + ++D      + +  ++     I N + ++  D
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF-YHKRNLLRDYKGHSKAI-NSLDFND-D 210

Query: 210 ATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
            T F + S + +T+ I+D       T +  +   N + F   + + F     +  +Y YD
Sbjct: 211 GTNFISSSFD-HTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYD 269

Query: 270 LRNTRK--TLHSMSGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWD-LMEIGSEQVNED 325
            R +     +     H   +  L+F    DG   +SSSED+ + IWD  + +  +Q+++ 
Sbjct: 270 TRISENDGRVQVYDHHMSSILALKFF--PDGSKFISSSEDKTVRIWDNQVNVPIKQISDT 327

Query: 326 AQDATPEL 333
            Q + P +
Sbjct: 328 TQYSMPSI 335

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 40/96 (41%), Gaps = 14/96 (14%)

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPEL 333
           +K  ++M GH    T+L F  +   +L+S   D  + +WD                   L
Sbjct: 145 KKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNL 191

Query: 334 MMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           +  + GH  ++N    N      I+S+  ++ I++W
Sbjct: 192 LRDYKGHSKAINSLDFNDDGTNFISSS-FDHTIKIW 226

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 123/267 (46%), Gaps = 32/267 (11%)

Query: 116 MVQDPNIISTIDGNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDG 174
           +  D  +++T  G+  V ++D R ++ +PV ++  H+ N   +SF   ++  ++++++DG
Sbjct: 40  ITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNR-WMVTSSEDG 97

Query: 175 YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV 234
            I ++D+ +    P        N  +N++  H     L     +    + I+DL      
Sbjct: 98  TIKVWDVRS----PSIPRNYKHNAPVNEVVIHPNQGELIS--CDRDGNIRIWDLGENQCT 151

Query: 235 TSI--EMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEF 292
             +  E +    SL+ +    ++ +AA T  N Y++++ N     H+ + H  PVT    
Sbjct: 152 HQLTPEDDTSLQSLSMAS-DGSMLAAANTKGNCYVWEMPN-----HTDASHLKPVTKFRA 205

Query: 293 HDS-VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQ----DATPELMMIHAGHRSSVNDF 347
           H + +  IL+SS         D+  + +   +  A+    D   +L     GH+  V D 
Sbjct: 206 HSTYITRILLSS---------DVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256

Query: 348 SLNSSIPWLIASTEEENIIQVWKSSSR 374
           + ++   +L+ ++  ++ +++W  S+R
Sbjct: 257 AFSADSAYLVTAS-SDHYVRLWDLSTR 282

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 123/267 (46%), Gaps = 32/267 (11%)

Query: 116 MVQDPNIISTIDGNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDG 174
           +  D  +++T  G+  V ++D R ++ +PV ++  H+ N   +SF   ++  ++++++DG
Sbjct: 40  ITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNR-WMVTSSEDG 97

Query: 175 YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV 234
            I ++D+ +    P        N  +N++  H     L     +    + I+DL      
Sbjct: 98  TIKVWDVRS----PSIPRNYKHNAPVNEVVIHPNQGELIS--CDRDGNIRIWDLGENQCT 151

Query: 235 TSI--EMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEF 292
             +  E +    SL+ +    ++ +AA T  N Y++++ N     H+ + H  PVT    
Sbjct: 152 HQLTPEDDTSLQSLSMAS-DGSMLAAANTKGNCYVWEMPN-----HTDASHLKPVTKFRA 205

Query: 293 HDS-VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQ----DATPELMMIHAGHRSSVNDF 347
           H + +  IL+SS         D+  + +   +  A+    D   +L     GH+  V D 
Sbjct: 206 HSTYITRILLSS---------DVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC 256

Query: 348 SLNSSIPWLIASTEEENIIQVWKSSSR 374
           + ++   +L+ ++  ++ +++W  S+R
Sbjct: 257 AFSADSAYLVTAS-SDHYVRLWDLSTR 282

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 34/187 (18%)

Query: 152 DNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQS--------TDNCIINDI 203
           +N + L+  P  +  LL++  +G +   D           WQ+        T    +N +
Sbjct: 13  NNNWCLNLQPAYQHSLLASLSNGQVHQLD-----------WQTGKSIAHIKTGEVAVNKL 61

Query: 204 KW---HHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLFSA 258
           K     H + + + T +     + I+D+R+ + + +I  ++  PF SL  S+H  N+ + 
Sbjct: 62  KLINNDHENESTYATAT--MGAVKIWDIRSNNCLATISNDKNAPFLSLD-SRH--NMLAC 116

Query: 259 A----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
                G+D  +++YD+R     L S+   H   +T++ FH S   +L+S S D    I+D
Sbjct: 117 GTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176

Query: 314 LMEIGSE 320
           L +   E
Sbjct: 177 LRQAEEE 183

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI-NAESEDPV 189
           + I+D    DSP+++    H D+   ++F+P     L+S + DGY  +YD+  AE ED +
Sbjct: 127 LHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 78/177 (44%), Gaps = 36/177 (20%)

Query: 139 SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNC 198
           S  + V T+  H D    LSF+    G L+S + D  +  +D+            ++  C
Sbjct: 486 SETACVYTFDSHVDEITALSFDS---GHLVSGSQDRTVRQWDL------------TSGKC 530

Query: 199 IINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSA 258
           +         D +  G +S+  +      L + D    I   Q F++            A
Sbjct: 531 L------QTIDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGALQCFDAAL----------A 574

Query: 259 AGT-DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
            GT D  V L+DLR + K + ++ GH G VT+L+F DS +  L++ S DR + IWDL
Sbjct: 575 TGTRDGAVRLWDLR-SGKIIRTLEGHTGAVTSLKF-DSKN--LITGSLDRSVRIWDL 627

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 22/170 (12%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L T   + ++     +    F  H      +A  DQ + +++ +N RK + ++ 
Sbjct: 76  TIKVWSLETNKCLYTLTGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQN-RKEIANLI 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMM------ 335
           GH   V   +FH + D ++VS+S D  + +WD+  +  +  +  AQ A+ E  M      
Sbjct: 135 GHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKH-SAPAQSASFEEQMSTQQNI 192

Query: 336 ------------IHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
                       I  GH   VN  S + ++P LI S  ++  +++W+ S+
Sbjct: 193 LDGGFGDCVVKFILEGHTRGVNWVSFHPTLP-LIVSGSDDRQVKLWRMSA 241

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV +++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRSVDFHPT-QPLFVSAGDDCTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +    GH   V     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----ETNKCLYTLTGHLDYVRTVFFHHELPWIISASDDQT-IRIWNWQNR 127

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 59/141 (41%), Gaps = 17/141 (12%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  +   D+ V L+ +  T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 224 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPH-QNLIISVGEDKTLRVWD 282

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP---------WLIA 358
           L +    +  +   D      A P + +  A H S V  F L+   P         + I 
Sbjct: 283 LDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGVMIFKLDRERPPATIHQNQLFFIN 342

Query: 359 STEEENIIQVWKSSSRLPRIS 379
            +++       K+ + LP +S
Sbjct: 343 KSKQVQTFDYHKNVASLPYVS 363

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 92/179 (51%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D+   L+++P    ++++AA+DG I ++D+   S   + T++   + +
Sbjct: 329 SESYILKQQGHFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDV--VSGFCLATFEEHTSSV 385

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
              +++      LF   +    T+  +DL   R     T+ E  Q FNSLA     + + 
Sbjct: 386 -TQVQFAKKGQVLFS--ASLDGTVRAWDLIRYRNFRVFTAAERIQ-FNSLAVDPSGEVVC 441

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +    +++++ ++ T + L +++GHEGP++ L F    + IL S+S D+ I IW + 
Sbjct: 442 AGSVDSFDIHVWSVQ-TGQLLDTLAGHEGPISCLAFSQE-NSILASASWDKTIRIWSIF 498

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 5/143 (3%)

Query: 170 AADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           A     I ++D+N        +W   DN  I  ++++  +  +  +   + N++ +YDLR
Sbjct: 195 ATGGAKIHLWDVNRLKPISNLSW-GADN--ITSVRFNQNETDILASTGSD-NSIVLYDLR 250

Query: 230 TKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289
           T      I      N++ ++      F  A  D N Y YD+RN  ++L     H   V +
Sbjct: 251 TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMD 310

Query: 290 LEFHDSVDGILVSSSEDRRIIIW 312
           ++F  + D I V+ S D+ I ++
Sbjct: 311 VDFSPTGDEI-VTGSYDKSIRMY 332

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 10/104 (9%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI--NAES 185
           G   + ++D N    P+   S+  DN   + FN      L S   D  I +YD+  N+ +
Sbjct: 197 GGAKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 186 EDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLR 229
           +  V+T ++      N I W+  +A  F T +E+ N    YD+R
Sbjct: 256 QKIVQTMRT------NAICWNPMEAFNFVTANEDHNAY-YYDMR 292

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 115/259 (44%), Gaps = 39/259 (15%)

Query: 128 GNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G+  V ++D R ++ +PV ++  HK N   LSF   +K  ++S+++DG I ++D+ +   
Sbjct: 51  GHQNVRLYDIRTTNPNPVASFEGHKGNVTSLSFQQDNK-WMVSSSEDGTIKVWDVRS--- 106

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFN 244
            P        N  +N++  H     L     +    + I+DL        +  E   P  
Sbjct: 107 -PSIPRNYKHNAPVNEVVIHPNQGELISC--DRDGNIRIWDLGENQCTHQLTPEDDIPLQ 163

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFH-DSVDGILVSS 303
           S++ +    ++  AA T  N +++++ N     H+ + +  PVT  + H D +  IL+SS
Sbjct: 164 SISVAS-DGSMLVAANTKGNCFVWEMPN-----HTDASNLKPVTKFKAHNDYITRILLSS 217

Query: 304 --------SEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPW 355
                   S D    +W +             D   +L     GH+  V D + ++   +
Sbjct: 218 DVKHLATCSADHTTRVWSI-------------DNNFKLESTLDGHQRWVWDCAFSADSAY 264

Query: 356 LIASTEEENIIQVWKSSSR 374
           L+ ++  ++ +++W  S+R
Sbjct: 265 LVTAS-SDHYVRLWDLSTR 282

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 68/155 (43%), Gaps = 17/155 (10%)

Query: 166 QLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIN-----DIKWHHFDATLFGTVSEEK 220
           +LL+AA    + +YDI   + +PV +++     + +     D KW           S E 
Sbjct: 45  KLLAAAGHQNVRLYDIRTTNPNPVASFEGHKGNVTSLSFQQDNKWM--------VSSSED 96

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
            T+ ++D+R+     + +   P N +    +   L S    D N+ ++DL   + T    
Sbjct: 97  GTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELIS-CDRDGNIRIWDLGENQCTHQLT 155

Query: 281 SGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWDL 314
              + P+ ++    + DG +LV+++      +W++
Sbjct: 156 PEDDIPLQSISV--ASDGSMLVAANTKGNCFVWEM 188

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 91/179 (50%), Gaps = 12/179 (6%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCI 199
           S+S +     H D   GL+++P    ++++A++DG I ++D+   S   + T++   + +
Sbjct: 330 SESYILKQQGHFDTLNGLTYSP-DGSRVVTASEDGKIKIWDV--VSGFCLATFEEHTSAV 386

Query: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDL---RTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
            + +++      LF   +    T+  +DL   R     T+ E  Q FNSLA     + + 
Sbjct: 387 -SAVQFSKRGQVLFS--ASLDGTVRAWDLIRYRNFRTFTAAERIQ-FNSLAVDPSGEVVC 442

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           + +  +  + ++ ++ T + L  ++GHEGPV+ L F    + +L S+S D+ I +W + 
Sbjct: 443 AGSIDNYEIQVWSVQ-TGQLLDCLAGHEGPVSCLAFSQE-NNVLASASWDKTIRVWSIF 499

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 57/107 (53%), Gaps = 5/107 (4%)

Query: 207 HFDATLFGTVSEEKNTLSIYDLRTKDKVTSIE--MEQPFNSLAFSKHSKNLFSAAGTDQN 264
           H D +L  +V  + N + ++DLR+ +++ +I   + Q +N       S+   + AG D  
Sbjct: 237 HPDGSLLSSVGGDGNCV-LWDLRSGNRILNIRGHVGQLYNGCWSPNGSE--IATAGVDGV 293

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
           + ++D+R   K L S+  H+G +++L + +     L+SS  D +I I
Sbjct: 294 IKIWDIRAKGKELSSIYLHKGVISDLRWENMYGRYLISSGYDGKIGI 340

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 100/237 (42%), Gaps = 43/237 (18%)

Query: 100 ITKKFKLEKE-ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYS-------YHK 151
           I K F  E E I  S  +      I+ +  +G  S+   +S DS  K +        Y +
Sbjct: 164 IVKLFSFENEKIQESNSIEAHEARITAVKYHGCASLLATSSFDSTWKLWDLAKMTELYLQ 223

Query: 152 DNG-----YGLSFNPISKGQLLSA-ADDGYIAMYDINAESEDPVETWQSTDNCIINDIKW 205
           + G     + L F+P   G LLS+   DG   ++D+             + N I+N I+ 
Sbjct: 224 EGGHSTEIFNLDFHP--DGSLLSSVGGDGNCVLWDLR------------SGNRILN-IRG 268

Query: 206 H---HFDATLFGTVSE-----EKNTLSIYDLRTKDK-VTSIEMEQPFNS-LAFSKHSKNL 255
           H    ++       SE         + I+D+R K K ++SI + +   S L +       
Sbjct: 269 HVGQLYNGCWSPNGSEIATAGVDGVIKIWDIRAKGKELSSIYLHKGVISDLRWENMYGRY 328

Query: 256 FSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312
             ++G D  + + +  +T K ++SMSGH G  + L+ H     I++S   DR I  W
Sbjct: 329 LISSGYDGKIGIINA-DTWKVINSMSGHTGKASTLDAHGE---IIISGGWDRSIRKW 381

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 90/213 (42%), Gaps = 17/213 (7%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           D  II+    NG V  FD  +  S  K +  H+     L FN      L+S    G I +
Sbjct: 73  DDKIIAGALENGVVEFFDPKALKSVAKIHK-HQGPVKTLKFNAKQNNVLVSGGTQGEIFV 131

Query: 179 YDINA-ESEDPVETWQSTDNCIINDIK---WHHFDATLFGTVSEEKNTLSIYDLRTKDKV 234
           +D N   S D         N  I+++    W+   A +F   +      S++DL+ K +V
Sbjct: 132 WDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVF-ASASSSGYASVWDLKAKKQV 190

Query: 235 -------TSIEMEQPFNSLAFSKHSKNLFSAAG---TDQNVYLYDLRNTRKTLHSMS-GH 283
                  ++  ++ P   + +   S  + + A    T+  V  +DLRN    L  +S GH
Sbjct: 191 LHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGH 250

Query: 284 EGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
              V +L++    + +L+SS  D   ++W+  E
Sbjct: 251 SKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQE 283

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query: 221 NTLSIYDLRTKDKVT---SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTL 277
           +TL ++ L + D      S+  +  FN L +S   K + + A  +  V  +D +   K++
Sbjct: 40  STLELWSLLSFDGSKPSGSVVADGKFNDLDWSGDDK-IIAGALENGVVEFFDPK-ALKSV 97

Query: 278 HSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGS 319
             +  H+GPV  L+F+   + +LVS      I +WD  +IGS
Sbjct: 98  AKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGS 139

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 14/92 (15%)

Query: 256 FSAAGTDQNVYLYDL-RNTRKTLHSMSGHEGPVTNLEF-HDSVDGILVSSSEDRRIIIWD 313
            +   +D+ + +Y++  ++ K L +++GHEGPV  +++ H     IL S S D ++IIW 
Sbjct: 24  LATCSSDKTIKIYEIDGDSHKLLTTLTGHEGPVWRIDWAHPKFGTILASCSYDGKVIIW- 82

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVN 345
                        ++ T   + +H+ H +SVN
Sbjct: 83  -----------KEENGTWSQIAVHSVHSASVN 103

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 32/160 (20%)

Query: 223 LSIYDLRTKDKVTSI-----------EMEQPFNSLAFSKHS-KNLFSAAGTDQNVYLYDL 270
           ++I+D++T D V+ +              +P        H   +L +    D  + ++DL
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 271 RNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-EIGSEQVNEDAQDA 329
             ++  L + +GH+  +T L+F D     L+S S+D  II+WDL+ E+G  ++       
Sbjct: 109 M-SKTVLLNFNGHKAAITLLQF-DGTGTRLISGSKDSNIIVWDLVGEVGLYKLRS----- 161

Query: 330 TPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
                     H+ S+  F       WLI ST ++ +I++W
Sbjct: 162 ----------HKDSITGFWCQGE-DWLI-STSKDGMIKLW 189

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/297 (19%), Positives = 121/297 (40%), Gaps = 46/297 (15%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMY- 179
           N +    G+G++ +FD   +D P+  +  H+   +  ++N I+K   +S++ DG + ++ 
Sbjct: 74  NQVLVAQGDGSLRLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWS 133

Query: 180 -------------------------DINAESEDPVETWQSTDNCIINDIKWHHFDATLFG 214
                                    DI   ++    +     NCI    ++   D  +  
Sbjct: 134 PTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQS-QFSPHDPNVIM 192

Query: 215 TVSEEKNTLSIYDLRTKDKVT--SIEMEQPFNSLA--FSKHSKNLFSAAGTDQNVYLYDL 270
           + +   + ++++DLR        S        +L   F+K+  ++ +  G D  + ++DL
Sbjct: 193 SCAGN-SYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDL 251

Query: 271 RNTRK---------TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW-DLMEIGSE 320
           R  RK         +++ + GH+  +  + +      +L+S+S D    +W DL + G  
Sbjct: 252 RMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQDLSDDGRR 311

Query: 321 QVNE-DAQDATPELMMIHAGHRSSV--NDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
              + ++ D       +   H   V   D+SL    P  IAST  +  + VW + ++
Sbjct: 312 PTGKTNSVDPARGCRFVFPHHTEFVFGADWSLWGK-PGYIASTSWDGDVCVWYAFTK 367

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 110/274 (40%), Gaps = 37/274 (13%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSYHKDNG-YGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG + I D N+     +  S+   +G + +++N + + Q+L A  DG + ++D    ++
Sbjct: 36  GNGKLFIVDINNQGIMTEAKSFLTQDGLFDVAWNELHENQVLVAQGDGSLRLFDTQL-TD 94

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLF------GTVS-------EEKNTLSIYDLRTKD- 232
            P+  +   +  + +   W+  +  LF      GTV        +   TL+   +  ++ 
Sbjct: 95  YPIAIFHEHEKEVFS-CNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNP 153

Query: 233 ----KVTSIEMEQPFNSLA----------FSKHSKNLFSAAGTDQNVYLYDLRN-TRKTL 277
               K   +  +Q   SL+          FS H  N+  +   +  V ++DLR       
Sbjct: 154 LMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQ 213

Query: 278 HSMSGHEGPVT-NLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMI 336
           +S   H G  T   +F+     I+ +   D  I +WDL  +     N     +  E+   
Sbjct: 214 YSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEI--- 270

Query: 337 HAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWK 370
             GH  ++   S +     ++ ST  +   +VW+
Sbjct: 271 -CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 91  DAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYH 150
           D P+ +    T   K +  I +S++   DPN+I +  GN  V++FD          YS+ 
Sbjct: 159 DIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPG-ANQYSFL 217

Query: 151 KDNG---YGLSFNPISKGQLLSAADDGYIAMYDI 181
             NG       FN      + +   D  I ++D+
Sbjct: 218 AHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDL 251

>TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON}
           Anc_2.663 YKL021C
          Length = 390

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 30/132 (22%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVD-------------- 297
           SK    +   D+++ +YDL+  RK L ++  H+G +T L F +S                
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITTLRFSNSAKEKQEEGSEIKPSAS 108

Query: 298 GILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLI 357
             L+S+SED +IIIW + +               E   +  GH + +ND  ++ S   + 
Sbjct: 109 KWLLSASEDNKIIIWRVRDW--------------ENFGVLKGHTARINDLDIHPS-NRIA 153

Query: 358 ASTEEENIIQVW 369
            S  E++ I++W
Sbjct: 154 VSVSEDHSIRLW 165

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 19/116 (16%)

Query: 223 LSIYDLRTKDKVTSIEMEQ-PFNSLAFSKHSKN---------------LFSAAGTDQNVY 266
           + IYDL+ + ++ ++   Q    +L FS  +K                L SA+  D  + 
Sbjct: 63  IRIYDLQKRKELGTLLAHQGSITTLRFSNSAKEKQEEGSEIKPSASKWLLSAS-EDNKII 121

Query: 267 LYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQV 322
           ++ +R+  +    + GH   + +L+ H S + I VS SED  I +W+LM +    V
Sbjct: 122 IWRVRDW-ENFGVLKGHTARINDLDIHPS-NRIAVSVSEDHSIRLWNLMTVKKAAV 175

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 20/136 (14%)

Query: 235 TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHD 294
           T+I       ++ F K ++ L      D  + ++DL  ++  L   +GH+  VT L   D
Sbjct: 68  TNISKPSVVTAMCFHKETE-LLCVGYEDGVIKVWDLL-SKSVLMQFNGHKSGVTVLRL-D 124

Query: 295 SVDGILVSSSEDRRIIIWDLM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSI 353
           S    LVS S+D  +IIWDL+ E+G               +M    H+ ++    ++ ++
Sbjct: 125 SEGTRLVSGSKDSDLIIWDLVGEVG---------------LMKLRSHKDAITGIWIDHNM 169

Query: 354 PWLIASTEEENIIQVW 369
            WLI S  ++ +I+VW
Sbjct: 170 DWLI-SVAKDGLIKVW 184

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 88/178 (49%), Gaps = 10/178 (5%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQSTDNC 198
           S+S +     H D+   L+++P    ++++AA+DG I ++D I+      +E   S+   
Sbjct: 322 SESYILKQQGHFDSLNALTYSP-DGSRVVTAAEDGKIKVWDVISGFCLVTLEGHTSSVTA 380

Query: 199 IINDIKWH-HFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFS 257
           +    +    F A+L GTV        +   R     T+ E  Q FN LA     + + +
Sbjct: 381 VQFAKRGQVLFSASLDGTV----RAWDLIRYRNFRVFTAAERIQ-FNCLAVDPSGECVCA 435

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
            +    +++++ ++ T + L ++SGHEGPV+ L F    + +L S+S D+ I IW + 
Sbjct: 436 GSVDSFDIHVWSVQ-TSQLLDTLSGHEGPVSCLSFSQE-NSVLASASWDKTIRIWSIF 491

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRYEDHEGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                T + +    GH   V     +  +PW+I++++++ I I  W++   +  I+    
Sbjct: 83  ----ETNKCLYTLDGHLDYVRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACITGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 76/172 (44%), Gaps = 23/172 (13%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L T   + +++    +    F         +A  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLETNKCLYTLDGHLDYVRTVFFHKELPWIISASDDQTIRIWNWQN-RKEIACIT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM--------------------EIGSEQ 321
           GH   V   +FH + D ++VS+S D  + +WD+                     +I ++Q
Sbjct: 135 GHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHSAPGRSAMPTSFEEKIAAQQ 193

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
              D       +  I  GH   VN  S + ++P LI S  ++  +++WK S+
Sbjct: 194 NLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMSA 244

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  + G D+ V L+ +  T+   L S  GH   V ++ FH + + IL S  ED+ + +WD
Sbjct: 227 LIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQNLIL-SVGEDKTLRVWD 285

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P + +  A H S +  F L+   P
Sbjct: 286 LDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 104/229 (45%), Gaps = 17/229 (7%)

Query: 157 LSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTV 216
           + F+P  K  L + A+D  I ++D++  ++  V T Q  +  I +   +   D  + G+ 
Sbjct: 384 VCFSPDGKF-LATGAEDKLIRIWDLS--TKRIVMTLQGHEQDIYSLDYFPSGDKLVSGS- 439

Query: 217 SEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKT 276
                T+ I+DLRT     ++ +E    ++A S       +A   D+ + ++D   T   
Sbjct: 440 --GDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWD-SETGFL 496

Query: 277 LHSM-------SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDA 329
           +  +       +GH+  V ++ F     G+ VS S DR + +W+L   GS   N D++  
Sbjct: 497 VERLDSENELGTGHKDSVYSVVFTRDGQGV-VSGSLDRSVKLWNLHNTGSSSKN-DSKPT 554

Query: 330 TPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRI 378
                + + GH+  V   +   +  ++++ +++  ++  W + S  P +
Sbjct: 555 AATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVL-FWDTQSGNPLL 602

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 213 FGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRN 272
           F     +   L +Y L +K  V S+++  P   +     S  L +  GTD +V + D+ N
Sbjct: 94  FLCFVSQAQLLRVYHLPSKKIVRSMKVSSPVYVMECDVTS-TLLAIGGTDGSVSIIDIEN 152

Query: 273 TRKTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
              T HS  GH G +++++FH  ++     L S      + IWDL++
Sbjct: 153 GYVT-HSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVK 198

>Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W
           (REAL)
          Length = 783

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 18/118 (15%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           N       D+ + +YD  N +K L  +SGH+G V  L++  S DGILVS S DR + +WD
Sbjct: 397 NYVITGADDKMIRVYDAIN-KKFLLQLSGHDGGVWALKY--SHDGILVSGSTDRTVRVWD 453

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSL-NSSIPWLIASTEEENIIQVWK 370
           + +     V                GH S+V    +        I +   +N + VWK
Sbjct: 454 IKKGCCTHV--------------FKGHNSTVRCLDIVEYKNNRYIVTGSRDNTLHVWK 497

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 85/191 (44%), Gaps = 25/191 (13%)

Query: 209 DATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ----PFNSLAFSKHS--------KNLF 256
           D     +++ +   L IY+L   +  T++  +Q    P  +L  S  S          L 
Sbjct: 74  DGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLKLSSPSYIMDCDSTSTLV 133

Query: 257 SAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWD 313
           +  GTD ++ + D+ N   T HS  GH G +++++F+ + D    +L S   +  + IWD
Sbjct: 134 AVGGTDGSIIVVDIENGFIT-HSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWD 192

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           L++       ++   A   L +     RS   +   N ++   + S   +NI+ +W+ + 
Sbjct: 193 LVKRSCIHTLQEHNSAVRGLDV-----RSVSKE---NDNVVLQLLSGSRDNIVNLWEFNL 244

Query: 374 R-LPRISNSKP 383
           R L ++  + P
Sbjct: 245 RKLCKLLKTLP 255

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 114/300 (38%), Gaps = 44/300 (14%)

Query: 122 IISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKG------QLLSAADDGY 175
           ++ + D NG V I+D     S + T   H     GL    +SK       QLLS + D  
Sbjct: 178 LLCSGDTNGMVKIWDL-VKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNI 236

Query: 176 IAMYDINAES------EDPVETWQSTDNCI--------INDIKWHHFDATLFGTVSEEKN 221
           + +++ N           PV   Q  ++C         + DI +      +F  +S  K 
Sbjct: 237 VNLWEFNLRKLCKLLKTLPVN--QQVESCGFIHDHDNELQDIIYTAGGEAIFQLISLSKG 294

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFS-AAGTDQNVYLYDLRNTRKTLH-- 278
           ++       K  V   E      +L F+  + +L S    +DQ + + +L          
Sbjct: 295 SV------IKRTVKPTEELFIIGTLPFTATNNDLNSYIVMSDQTLQMINLTKALSPTELS 348

Query: 279 --------SMSGHEGPVTNLEF--HDSVDGILVSSSEDRRII-IWDLMEIGSEQVNEDAQ 327
                    ++G+ G + +++F   D     L ++S   RII +   M+  ++   +D  
Sbjct: 349 NPIIEIESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNS 408

Query: 328 DATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINY 387
              P  M  + GH   +N  +      WL  ++++   I +WK SS   R      FI +
Sbjct: 409 ADLPINMETYEGHTDLLNSLAATEDGQWLATASKDHTSI-LWKYSSETSRFFAYAKFIGH 467

>CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa]
           {ON} similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009w CDC4 cell division control
          Length = 795

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 65/130 (50%), Gaps = 24/130 (18%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           N       D+ + +YD   T+K L  +SGH+G V  L++  + +GILVS S DR + IW+
Sbjct: 380 NYVITGADDKMIRIYD-SITKKFLIELSGHDGGVWALKY--AGNGILVSGSTDRSVRIWN 436

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVN--DFSLNSSIPWLIASTEEENIIQVWKS 371
           +  +G             +   +  GH S+V   D   +  + +++  +  +N + +WK 
Sbjct: 437 I-HLG-------------KCTHVFKGHTSTVRCLDIVEHEGVKYIVTGS-RDNTLHIWK- 480

Query: 372 SSRLPRISNS 381
              LP++S+S
Sbjct: 481 ---LPQMSDS 487

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 91/210 (43%), Gaps = 26/210 (12%)

Query: 166 QLLSAADDGYIAMYDINAESEDPVETWQS-----TDNCIINDIKWHHFDATLFGTVSEEK 220
           +LL+AA    + +YDIN  + +PV +++      T     ND +W           S E 
Sbjct: 45  KLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWM--------VTSSED 96

Query: 221 NTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSM 280
            T+ ++D+R+     + +   P N +A   +   L S    D N+ ++DL   + T    
Sbjct: 97  GTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELIS-CDRDGNIRIWDLGENQCTHQLT 155

Query: 281 SGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAG 339
              + PV +L    + DG +LV+++      +W++          DA +  P  +     
Sbjct: 156 PEDDTPVQSLSL--ATDGSMLVAANSKGNCYVWEMPN------RTDASNLKP--VTKFRA 205

Query: 340 HRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           H + +    L+S + +L A+   ++  ++W
Sbjct: 206 HDAYITRILLSSDVKFL-ATCSADHTARIW 234

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 118/259 (45%), Gaps = 39/259 (15%)

Query: 128 GNGTVSIFDRNSSD-SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G+  V ++D N+++ +PV ++  H+ N   LSF   ++  ++++++DG I ++D+ + S 
Sbjct: 51  GHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNR-WMVTSSEDGTIKVWDVRSPSV 109

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFN 244
               T++   N  +N++  H     L     +    + I+DL        +  E + P  
Sbjct: 110 P--RTYKH--NAPVNEVAIHPNQGELIS--CDRDGNIRIWDLGENQCTHQLTPEDDTPVQ 163

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS-VDGILVSS 303
           SL+ +    ++  AA +  N Y++++ N      + + +  PVT    HD+ +  IL+SS
Sbjct: 164 SLSLAT-DGSMLVAANSKGNCYVWEMPN-----RTDASNLKPVTKFRAHDAYITRILLSS 217

Query: 304 --------SEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPW 355
                   S D    IW +             D    L     GH+  V D + ++   +
Sbjct: 218 DVKFLATCSADHTARIWSI-------------DDNFNLHTTLDGHQRWVWDCAFSADSAY 264

Query: 356 LIASTEEENIIQVWKSSSR 374
           LI ++  ++ +++W  S+R
Sbjct: 265 LITAS-SDHYVRLWDLSTR 282

>TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6.177
           YPL183C
          Length = 1004

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%), Gaps = 5/61 (8%)

Query: 256 FSAAGTDQN-VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSS-SEDRRIIIWD 313
           ++ AGT  N V ++DL  T K  H+++GHEG + N+   D  DG L++S S+DR I +WD
Sbjct: 154 YAVAGTVMNGVIIWDLI-TEKMFHNLTGHEGAIFNVILSD--DGKLIASCSDDRSIKLWD 210

Query: 314 L 314
            
Sbjct: 211 F 211

>Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON}
           complement(17489..19777) [2289 nt, 763 aa]
          Length = 762

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 23/110 (20%)

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPEL 333
           +K L  +SGH+G V  L++ +  DGILVS S DR + +WD+       V           
Sbjct: 418 KKFLLELSGHDGGVWALKYDE--DGILVSGSTDRTVRVWDIKRGCCTHV----------- 464

Query: 334 MMIHAGHRSSVN--DFSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNS 381
                GH S+V   D     ++ +++  +  +N + VWK    LPR S+S
Sbjct: 465 ---FKGHTSTVRCLDIVEYKNVKYIVTGS-RDNTLHVWK----LPRESSS 506

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 21/151 (13%)

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLH 278
           +   L IY L +K  + S+++  P   +     S  L +  GTD +V + D+ N   T H
Sbjct: 80  QAQLLRIYKLSSKKIIRSMKVSSPVYVMD-CDSSSTLVALGGTDGSVTVVDIENGYVT-H 137

Query: 279 SMSGHEGPVTNLEFHDSVDGI---LVSSSEDRRIIIWDLMEIGSEQVNED---------- 325
           S  GH   +++++FH    G    L S      + +WDL+        ++          
Sbjct: 138 SFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDF 197

Query: 326 ----AQDATPELMMIHAGHRSSVNDFSLNSS 352
               A D   EL+    G    VN F LNS+
Sbjct: 198 RLSPADDGVLELLT--GGRDDIVNLFQLNST 226

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 91/184 (49%), Gaps = 22/184 (11%)

Query: 140 SDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINA--------ESEDPVET 191
           S+S +     H D    L+++P    ++++AA+DG I ++DI +        E    V +
Sbjct: 345 SESYILKQQGHFDALNALAYSP-DGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTS 403

Query: 192 WQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKH 251
            Q   N  I       F ++L GTV +  + +   + RT    T+ E  Q F+ LA    
Sbjct: 404 VQFAKNGQI------MFSSSLDGTV-KAWDLMRFRNFRT---FTATERIQ-FSCLAADPT 452

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311
            + + + +  + ++ ++ ++ T + L ++SGHEGPV+ L F    + IL S+S D+ I +
Sbjct: 453 GEVVCAGSLDNYDIQVWSVQ-TGQLLDTLSGHEGPVSCLSFSRE-NSILASASWDKTIRV 510

Query: 312 WDLM 315
           W + 
Sbjct: 511 WSIF 514

>Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON}
           (85899..87926) [2028 nt, 676 aa]
          Length = 675

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 54/111 (48%), Gaps = 20/111 (18%)

Query: 262 DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQ 321
           D+ + +YD  + R  L  +SGHEG V  L++ +  DGI+VS S DR + +WD+ +     
Sbjct: 310 DKMIRVYDSVDKRFLLE-LSGHEGGVWALKYDE--DGIIVSGSTDRSVRVWDIKQ----- 361

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSL--NSSIPWLIASTEEENIIQVWK 370
                         I  GH S+V    +    ++ ++I  +  +N + VWK
Sbjct: 362 ---------GRCTHIFKGHTSTVRCLEIVEYKNVKYIITGS-RDNTLHVWK 402

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV +++FH +   I VS  +D  I +W L          
Sbjct: 35  IQLWDYR-MGTLLHRFEDHEGPVRSVDFHPT-QPIFVSGGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSR 374
                T + +    GH   +     +  +PW+I++++++  I++W   +R
Sbjct: 83  ----ETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQT-IRIWNWQNR 127

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 258 AAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM-- 315
           +A  DQ + +++ +N RK +  ++GH   V   +FH + D ++VS+S D  I +WD+   
Sbjct: 112 SASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPT-DDLVVSASLDETIRVWDISGL 169

Query: 316 --------------EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361
                         ++ ++Q   D       +  I  GH   VN  S + ++P +++ ++
Sbjct: 170 RKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSD 229

Query: 362 EENIIQVWKSSS 373
           +   +++WK +S
Sbjct: 230 DRQ-VKLWKYNS 240

>SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} similar
           to uniprot|P07834 Saccharomyces cerevisiae YFL009W CDC4
           F-box protein required for G1/S and G2/M transition
           associates with Skp1p and Cdc53p to form a complex
           SCFCdc4 which acts as ubiquitin-protein ligase directing
           ubiquitination of the phosphorylated CDK inhibitor Sic1p
          Length = 773

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 22/116 (18%)

Query: 262 DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQ 321
           D+ +++YD R T K    ++GHEG V  L++    DG LVS S DR + +W++ E     
Sbjct: 409 DKMIHVYDSR-TEKFKTQLTGHEGGVWALKYDK--DGTLVSGSTDRSVRVWNIKE----- 460

Query: 322 VNEDAQDATPELMMIHAGHRSSVNDFSL-NSSIPWLIASTEEENIIQVWKSSSRLP 376
                     +   I  GH S+V    +        I +   +N + VW    RLP
Sbjct: 461 ---------GKCTHIFKGHTSTVRCLDIVEHKGKKFIVTGSRDNTLHVW----RLP 503

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 252 SKNLFSAAGTDQNVYLYDLRNTRKT-LHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRII 310
           S   F AA    NV LYD+R T    + S  GH G VT++ F    +  +VSSSED  I 
Sbjct: 42  SDKRFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQE-NKWMVSSSEDGTIK 100

Query: 311 IWDL 314
           +WD+
Sbjct: 101 VWDV 104

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 50/255 (19%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 128 GNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           G+  V ++D R ++ +PV ++  H+ N   ++F   +K  ++S+++DG I ++D+ A   
Sbjct: 51  GHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENK-WMVSSSEDGTIKVWDVRA--- 106

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFN 244
            P        +  +N++  H     L     ++   + I+DL     V  +  E + P  
Sbjct: 107 -PSVQRNYKHHAAVNEVVIHPNQGELISC--DQDGNIKIWDLGENQCVHQLAPEDDTPLQ 163

Query: 245 SLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS-VDGILVSS 303
           SL+ +    ++  A     N Y++ + +      + + +  PVT    H   +  +L+SS
Sbjct: 164 SLSVAS-DGSMLVAGNNKGNCYVWQMPH-----QTDAANPRPVTKFRSHAKYITRVLLSS 217

Query: 304 SEDRRIIIWDLMEIGSEQVNEDAQ----DATPELMMIHAGHRSSVNDFSLNSSIPWLIAS 359
                    D+  + +   +  A+    D   +L     GH+  V D + ++   +L+ +
Sbjct: 218 ---------DVKHLATCSADHTARVWSIDDNFQLETTLDGHQRWVWDCAFSADSAYLVTA 268

Query: 360 TEEENIIQVWKSSSR 374
              ++ +++W  S+R
Sbjct: 269 C-SDHYVRLWDLSTR 282

>ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {ON}
           highly similar to uniprot|Q04491 Saccharomyces
           cerevisiae YLR208W SEC13 Component of both the Nup84
           nuclear pore sub-complex and of the COPII complex (Sar1p
           Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p)
           which is important for the formation of ER to Golgi
           transport vesicles
          Length = 294

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 14/92 (15%)

Query: 256 FSAAGTDQNVYLYDLRN-TRKTLHSMSGHEGPVTNLEF-HDSVDGILVSSSEDRRIIIWD 313
            +   +D+ + ++++   T K + ++SGHEGPV  + + H     IL S S D +++IW 
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVETLSGHEGPVWRVAWAHPKFGTILASCSYDGKVLIW- 82

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVN 345
                        ++ + + + +HA H +SVN
Sbjct: 83  -----------KEENGSWDQIAVHAVHSASVN 103

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +L + AG D  V L+D+R TR  + ++ GH+GP+  +E    VD  +VSSS D  + +WD
Sbjct: 237 DLIATAGRDSVVKLWDIR-TRVPVITLVGHKGPINQVECA-PVDPQIVSSSTDATVRLWD 294

Query: 314 LM 315
           ++
Sbjct: 295 IV 296

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 17/124 (13%)

Query: 256 FSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLM 315
           F     D  + ++DL + +  + +++GH   V ++   D     L S SED+ +  WDL 
Sbjct: 155 FVTGSNDTTMKVWDLASGKLKV-TLTGHVMTVRDIAVSDR-HPYLFSVSEDKTVKCWDL- 211

Query: 316 EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSSRL 375
                + N+  +D        + GH S V   S++ ++  LIA+   ++++++W   +R+
Sbjct: 212 -----EKNQIIRD--------YHGHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDIRTRV 257

Query: 376 PRIS 379
           P I+
Sbjct: 258 PVIT 261

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           NL +    D  + ++DL  ++  L +++GH   +T L+F DS    L+S S D  II+WD
Sbjct: 92  NLLAVGYNDGVIKVWDLY-SKTVLCNLNGHSSAITVLKF-DSTGTRLISGSRDSNIIVWD 149

Query: 314 LM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           L+ E+G  ++    +DA   +      +    ++  L+    WLI ST ++ +I++W
Sbjct: 150 LVSEVGLYKLRS-HKDAITGIWCNEMQNNGEDDENELD----WLI-STSKDGLIKIW 200

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 208 FDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ-PFNSLAFSKHSKNLFSAAGTDQNVY 266
           FD+ L  T S +KN + I+ L   D   S+   Q    ++ F   S N FS +  D  + 
Sbjct: 595 FDSKLIITSSADKN-IKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCS-KDGLIK 652

Query: 267 LYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316
            +D  +  + +  ++GH+  V ++   +     +VSSS D  I IW+  E
Sbjct: 653 YWD-GDKFECIQKLAGHQSEVWSIAIANDA-SFIVSSSHDHSIRIWEETE 700

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 80/179 (44%), Gaps = 35/179 (19%)

Query: 138 NSSDSP-VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTD 196
           N  DSP V T+  H D    LS +P     L+S + D  I  +D+ +      +  Q+ D
Sbjct: 488 NHIDSPCVHTFEAHTDEVTALSLDP---SFLVSGSQDRTIRQWDLRSG-----KCLQTID 539

Query: 197 NCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLF 256
               N +       T    V   K+TL    L  +++  SI   Q F++           
Sbjct: 540 LSFANVL-------TTSTNVDLSKSTL----LTQRNERPSIGALQSFDAAL--------- 579

Query: 257 SAAGT-DQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
            A GT D  V L+DLR + K + ++ GH   +T+L+F  +    LV+ S DR + IWDL
Sbjct: 580 -ATGTKDGVVRLWDLR-SGKVIRTLKGHTDAITSLKFDSAC---LVTGSYDRTVRIWDL 633

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 89/235 (37%), Gaps = 44/235 (18%)

Query: 120 PNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMY 179
           PN +    G+G++ +FD      P+  +  H    Y  ++N +SK   +S++ DG + ++
Sbjct: 73  PNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQVKIW 132

Query: 180 DINAE------SEDPVETWQSTDN--------------------CIINDIKWHHFDATLF 213
             N +      S  P++  ++ DN                    CI       H D  + 
Sbjct: 133 SPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNRNCIYQATFSPHDDNLIL 192

Query: 214 GTVSEEKNTLSIYDLR----TKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYD 269
                   TL  +DLR       K       +   S  F+K+  N+ + +G D ++ ++D
Sbjct: 193 CCAGNSYVTL--FDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIGIWD 250

Query: 270 LRNTRKTLHSMSGHEGPVTN--LEFHDSV----------DGILVSSSEDRRIIIW 312
           +R    + +      G + N  +  HD              IL+S+S D    IW
Sbjct: 251 IRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLSTSYDMSCKIW 305

>Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247C -
           Hypothetical ORF [contig 164] FULL
          Length = 418

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 81/186 (43%), Gaps = 34/186 (18%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +N I    ++S++ D    ++D+  +S + V+T     +  + D+K+      LF +   
Sbjct: 173 WNKIDPNLIISSSIDTTCTVWDL--QSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGG 230

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQ--------------- 263
           +  ++ ++DLR+    T I  E    S A    S++   A+GT +               
Sbjct: 231 D-GSVRVFDLRSLAHSTII-YEPNGQSAATLSQSQDSGGASGTSRDGSNSDNALLRLEPS 288

Query: 264 ---------------NVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRR 308
                          NV + D+R     + ++ GH G V  +++H S   +L++ ++D +
Sbjct: 289 PFDPNVVATFAHDSSNVLILDMRYPGAAVLTLEGHSGAVNQIQWHQSRQNVLITCADDCQ 348

Query: 309 IIIWDL 314
            ++WDL
Sbjct: 349 ALLWDL 354

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 114/301 (37%), Gaps = 55/301 (18%)

Query: 121 NIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMY- 179
           N +    G+G++ +FD    D P++ ++ H+   +  S+N I+K    S++ DG + ++ 
Sbjct: 74  NQVLVAQGDGSLRLFDTTLKDYPIEIFNEHEREVFSCSWNLITKNTFTSSSWDGTVKIWS 133

Query: 180 ------------------------DINAESEDPVETWQSTDNCIINDIKWHHFDATLFGT 215
                                   DI   ++          NCI    ++   D  L   
Sbjct: 134 PLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIY-QAQFSPHDPNLVIC 192

Query: 216 VSEEKNTLSIYDLRTKDKVTSIEMEQPFN-------SLAFSKHSKNLFSAAGTDQNVYLY 268
            +    T +++DLR     TS   +  F+       +  F+K+  N+ +  G D  + ++
Sbjct: 193 CAGNSYT-TLFDLRQPS--TSNNQQNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRIW 249

Query: 269 DLRNTRKTLHSMS--------------GHEGPVTNLEFHDSVDGILVSSSEDRRIIIW-D 313
           DLR   K   + +              GHE  V  + +       L+S+S D    +W D
Sbjct: 250 DLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQD 309

Query: 314 LMEIGSEQVNE-DAQDATPELMMIHAGHRSSV--NDFSLNSSIPWLIASTEEENIIQVWK 370
           L   G     + ++ D     +     H   V   D+SL    P  IAST  +  + VW 
Sbjct: 310 LSSNGKAPTGKTNSTDFRRGCITRFNQHSEFVFGADWSLWGQ-PGFIASTAWDGNVFVWN 368

Query: 371 S 371
           +
Sbjct: 369 A 369

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 111/279 (39%), Gaps = 42/279 (15%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSY-HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG V + + +S     +T S+  +D  + +++N + + Q+L A  DG + ++D   + +
Sbjct: 36  GNGKVYLLEIDSKGQIHETNSFLTQDCLFDVAWNELHENQVLVAQGDGSLRLFDTTLK-D 94

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYD-LRTKDKVTSI-------- 237
            P+E +   +  + +   W+      F T S    T+ I+  LR    +T +        
Sbjct: 95  YPIEIFNEHEREVFS-CSWNLITKNTF-TSSSWDGTVKIWSPLRKASLLTLVPHPLKVMK 152

Query: 238 ---EMEQPFNS----------------LAFSKHSKNLFSAAGTDQNVYLYDLR-----NT 273
              +++ P ++                  FS H  NL      +    L+DLR     N 
Sbjct: 153 NFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNN 212

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPEL 333
           ++   S SG E      +F+     I+ +   D  I IWDL  + S+Q     Q     +
Sbjct: 213 QQNFFSHSGLE--ALTCDFNKYRPNIVATGGVDNTIRIWDLRML-SKQFQAGTQRDNSIM 269

Query: 334 MM--IHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWK 370
            +  I  GH  +V   S +      + ST  +    VW+
Sbjct: 270 CVNEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 58/133 (43%), Gaps = 6/133 (4%)

Query: 80  PNEVIDPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDR-- 137
           P +V+   +  D P+ +    T   K +  I ++++   DPN++    GN   ++FD   
Sbjct: 147 PLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQ 206

Query: 138 -NSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTD 196
            ++S++    +S+         FN      + +   D  I ++D+   S+   +     D
Sbjct: 207 PSTSNNQQNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRIWDLRMLSKQ-FQAGTQRD 265

Query: 197 NCI--INDIKWHH 207
           N I  +N+IK  H
Sbjct: 266 NSIMCVNEIKKGH 278

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 76/178 (42%), Gaps = 25/178 (14%)

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           +NP+    L+S++ D    ++D+  +S + V+T     +  + D+++      LF +   
Sbjct: 243 WNPVDTNILISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGG 300

Query: 219 EKNTLSIYDLRTKDKVTSI---------------------EMEQPFNSLAFSKHSKNLFS 257
           +  ++ ++DLR     T I                     E       L  S H  N+ +
Sbjct: 301 D-GSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLA 359

Query: 258 AAGTDQN-VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDL 314
                 N + + D+RN    L  ++GH   +  +++H +    L+S S+D +++ WD+
Sbjct: 360 TFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 118 QDPNIISTID-GNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYI 176
            DPN+++T    +  + I D  + DSP+   + H  +   + ++P  K  L+S +DD  +
Sbjct: 353 HDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQV 412

Query: 177 AMYDINA 183
             +DI++
Sbjct: 413 LFWDISS 419

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 18/117 (15%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +L ++AG D  V L+D+R ++K + ++ GH+ P+ +++     D  ++S S D  +I WD
Sbjct: 206 SLIASAGRDSVVKLWDIR-SKKAVITLVGHKSPINSVKC-TPADPQIISCSNDTTVITWD 263

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWK 370
           L+             A P  ++ H  HR +V D +++    + +AS    N I+ WK
Sbjct: 264 LVA------------AKPMKVITH--HRKAVRDIAVHPG-EFSVASC-STNDIRSWK 304

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 20/117 (17%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           +L +    D  + ++DL  ++  L + +GH+  +T L+F D     L+S S+D  II+WD
Sbjct: 92  DLLAVGYADGVIKVWDLM-SKTVLLNFNGHKAAITLLQF-DGTGTRLISGSKDSNIIVWD 149

Query: 314 LM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           L+ E+G  ++                 H+ S+  F       WLI ST ++ +I++W
Sbjct: 150 LVGEVGLYKLRS---------------HKDSITGFWCQGE-DWLI-STSKDGMIKLW 189

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 94/197 (47%), Gaps = 12/197 (6%)

Query: 119 DPNIISTIDGNGTVSIFD-RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIA 177
           D   + T   NG + I++  N S+SP  T + H++    + F+P  K  + SA+ D    
Sbjct: 236 DGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGK-YVASASFDMTWR 294

Query: 178 MYDINAESEDPVETWQSTD-NCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTS 236
           ++D+  + E  ++   + +  C+         D +L  +   +   L ++DLR+   + +
Sbjct: 295 LWDVEKQIELQLQEGHAKEVYCVA-----FQKDGSLLCSTGLDSVGL-VWDLRSGKSIMA 348

Query: 237 IEME-QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
           +E   +P   L +S +  ++ + +  D  + L+D+R     L ++  H   V+ ++F  +
Sbjct: 349 LEGHIKPIYGLDWSPNGYDIATGS-ADGTIRLWDVRKV-GILGALPAHNSIVSEVKFDKA 406

Query: 296 VDGILVSSSEDRRIIIW 312
               LVSSS D+ + I+
Sbjct: 407 NGHYLVSSSYDKTLNIY 423

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 219 EKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLH 278
           +   L I+ L +     S+++  P + +  S  +  L +  GTD ++ + D+ N   T H
Sbjct: 80  QAQQLKIFSLDSMKITRSMKISSP-SYVMDSDSTSTLIAIGGTDGSISVVDVENGYIT-H 137

Query: 279 SMSGHEGPVTNLEFHDSVDG---ILVSSSEDRRIIIWDLME 316
           S  GH G +++L+FH  ++G   +L S   +    +WDL++
Sbjct: 138 SFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVK 178

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 97/224 (43%), Gaps = 36/224 (16%)

Query: 128 GNGTVSIFDRNSSDSPVKTYSY-HKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE 186
           GNG + I D       V++ S+  KD  + +++N + + Q+L+A  DG + ++DIN + +
Sbjct: 37  GNGKLFILDITPQGKIVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDINLQ-K 95

Query: 187 DPVETWQSTDNCIINDIKWHHFDATLF------GTV-----SEEKNTLSIYDLRTKDKV- 234
            PV  +Q  +  + +   W+  D   F      GTV     + +++  ++    T + V 
Sbjct: 96  YPVAIFQEHEREVFS-CNWNLIDKQTFLSSSWDGTVKIWSPARKQSLRTLLPTPTNNTVL 154

Query: 235 ---TSIEMEQPFNSLA----------------FSKHSKNLFSAAGTDQNVYLYDLRNTRK 275
              T ++ + P ++ A                +S H  NL  +   +  V ++D+R    
Sbjct: 155 VDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVN 214

Query: 276 T-LHSMSGHEG-PVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI 317
           T   S   H G      +F+     I+ +   D+ I +WDL  +
Sbjct: 215 TEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKLIKVWDLRMV 258

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 97/240 (40%), Gaps = 34/240 (14%)

Query: 145 KTYSYHKDNGY-GLSFNPISKGQLLSAADDGYIAMYDINAESEDP-----VETWQSTDNC 198
           K+ S   D G+  +S NP  +  +L++    YI   D++     P     +  WQ     
Sbjct: 17  KSLSLKVDGGFNAVSINPSGRDVVLASRQGLYII--DLDDPFTPPRWLHHITPWQ----- 69

Query: 199 IINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEM-----EQPFNSLAFSKHSK 253
            + D++W    A  +  VS       I++L  K    +IE       +    + F+    
Sbjct: 70  -VADVQWSPHPAKPYWIVSTSNQKAIIWNL-AKSSANAIEFVLHGHSRAITDINFNPQHP 127

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           ++ +    D  V+ +D+R+  +  +S S      + +++ +  D  +++SS    I +WD
Sbjct: 128 DVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKW-NYKDPNVLASSHGNDIFVWD 186

Query: 314 LMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVWKSSS 373
           L            + +TP   +   GH SSVN    N      I S+  +  ++ W  S+
Sbjct: 187 LR-----------KGSTPLCSL--KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWDYST 233

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/81 (18%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 111 TRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSA 170
           ++ ++  +DPN++++  GN  + ++D     +P+ +   H  +   + FN     +++S+
Sbjct: 162 SQVKWNYKDPNVLASSHGN-DIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSS 220

Query: 171 ADDGYIAMYDINAESEDPVET 191
           ++DG +  +D +  + +   T
Sbjct: 221 SNDGTVKFWDYSTSTTESKRT 241

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 20/117 (17%)

Query: 254 NLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
            L +A   D  V ++DL  ++  L + +GH+  +T L+F DS    L+S S+D  II+WD
Sbjct: 88  KLLAAGYNDGVVKIWDLL-SKSVLINFNGHKSAITVLKF-DSTGTRLISGSKDSDIIVWD 145

Query: 314 LM-EIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           L+ E+G  ++                 H+ S+          WL+ ST ++ +I+VW
Sbjct: 146 LVGEVGLFKLRS---------------HKDSITGLWCEGE-DWLV-STSKDGLIKVW 185

>KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1212

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 17/122 (13%)

Query: 265 VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNE 324
           + L+D R     LH    HEGPV  ++FH +   + VS+ +D  I +W L          
Sbjct: 35  IQLWDYR-MGVLLHRFEDHEGPVRGIDFHPT-QPLFVSAGDDYTIKVWSL---------- 82

Query: 325 DAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTEEENI-IQVWKSSSRLPRISNSKP 383
                + + +    GH   V     +  +PW+I+S++++ I I  W++   +  ++    
Sbjct: 83  ----ESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNH 138

Query: 384 FI 385
           F+
Sbjct: 139 FV 140

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 4/94 (4%)

Query: 221 NTLSIYDLRTKDKVTSIE-MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHS 279
           +T+ ++D R    +   E  E P   + F   ++ LF +AG D  + ++ L  + K L +
Sbjct: 33  STIQLWDYRMGVLLHRFEDHEGPVRGIDFHP-TQPLFVSAGDDYTIKVWSLE-SNKCLFT 90

Query: 280 MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           + GH   V  + FH  +  I +SSS+D+ I IW+
Sbjct: 91  LDGHLDYVRTVFFHHELPWI-ISSSDDQTIRIWN 123

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 255 LFSAAGTDQNVYLYDLRNTRK-TLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313
           L  +   D+ V L+ +  T+   + +  GH   V ++ FH     +++S  ED+ + +WD
Sbjct: 223 LIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQ-QNLIISVGEDKTVRVWD 281

Query: 314 LMEIGSEQVNEDAQD------ATPELMMIHAGHRSSVNDFSLNSSIP 354
           L +    +  +   D      A P L +  A H S +  F L+   P
Sbjct: 282 LDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERP 328

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 40/214 (18%), Positives = 77/214 (35%), Gaps = 61/214 (28%)

Query: 222 TLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMS 281
           T+ ++ L +   + +++    +    F  H      ++  DQ + +++ +N RK +  ++
Sbjct: 76  TIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQN-RKEIACLT 134

Query: 282 GHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEI-------GSEQVNE---------D 325
           GH   V   +FH  V+ ++VS+S D  + +WD+  +       G++   E         D
Sbjct: 135 GHNHFVMCAQFH-PVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLD 193

Query: 326 AQDATPELMMIHAGHRSSVNDFSLNSSIP---------------------W--------- 355
                  +  I  GH   VN  S + ++P                     W         
Sbjct: 194 GGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHT 253

Query: 356 -------------LIASTEEENIIQVWKSSSRLP 376
                        LI S  E+  ++VW    R P
Sbjct: 254 NNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTP 287

>Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON}
           (69674..71074) [1401 nt, 467 aa]
          Length = 466

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 88/204 (43%), Gaps = 16/204 (7%)

Query: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESE---DPVETWQSTDNCII 200
           +  Y  H+     L F P +    +S  +D  I ++D   + E   D +   ++      
Sbjct: 166 IYVYQGHRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFYHKRELLRDYIGHSKAIKTTNF 225

Query: 201 NDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSAAG 260
           ND      D  +F + S +K  + I+D  T    + + +    N + F   + N +    
Sbjct: 226 ND------DGKMFISSSFDK-YVKIWDTETGKVRSKLRLNSTPNDVKFRPLNPNEYIVGL 278

Query: 261 TDQNVYLYDLRNTRKT--LHSMSGHEGPVTNLEFHDSVDGI-LVSSSEDRRIIIWD-LME 316
           ++  +  YD R + K   +     H+  + NL +    DG   +SSSED+ + IW+  + 
Sbjct: 279 SNSQIKHYDTRVSEKQGLIQVYDHHQSSILNLRYFP--DGTKFISSSEDKSVRIWENQIN 336

Query: 317 IGSEQVNEDAQDATPELMMIHAGH 340
           I  +Q+++ AQ + P + +   GH
Sbjct: 337 IPIKQISDTAQHSMPFINIHPQGH 360

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 39/96 (40%), Gaps = 14/96 (14%)

Query: 274 RKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPEL 333
           +K ++   GH    T+LEF      + VS   D  I IWD                  EL
Sbjct: 163 KKEIYVYQGHRHGTTSLEFFPKTGHLFVSGGNDNVIRIWDFYH-------------KREL 209

Query: 334 MMIHAGHRSSVNDFSLNSSIPWLIASTEEENIIQVW 369
           +  + GH  ++   + N      I+S+ ++  +++W
Sbjct: 210 LRDYIGHSKAIKTTNFNDDGKMFISSSFDK-YVKIW 244

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 84/197 (42%), Gaps = 20/197 (10%)

Query: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDI 203
           +  Y  HK+    L F P +   LLS  +D  I ++D   E E  + T++   +  I D+
Sbjct: 128 IAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERE-LLRTYEG-HSMTIKDL 185

Query: 204 KW----HHFDATLFGTVSEEKNT-LSIYDLRTKDKVTSIEMEQPFNSLAFSKHSKNLFSA 258
            +    H F +  F    +  NT   I D R       +      N + F    KN    
Sbjct: 186 NFTDNGHSFASASFDKWVKIWNTEKGIIDKR-------LRFNSVPNCITFHPKDKNQLVV 238

Query: 259 AGTDQNVYLYDLR--NTRKTLHSMSGHEGPVTNLEFHDSVDG-ILVSSSEDRRIIIWD-L 314
             ++  +  YDLR       +     H+G +  L++    DG  L+SSSED+ + IW+  
Sbjct: 239 GLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFP--DGKKLISSSEDKTVRIWENR 296

Query: 315 MEIGSEQVNEDAQDATP 331
           + I  +Q++  AQ + P
Sbjct: 297 INIPIKQISGTAQHSMP 313

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 98/210 (46%), Gaps = 11/210 (5%)

Query: 119 DPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAM 178
           D   ++T    G + + +  +     +    HK     + ++P S  Q++S A+DG+I  
Sbjct: 186 DDMTVATGSWAGDIRVLNSQTLQPLAQKLDPHKGKIGAVQWHPESNNQIISCAEDGHIKN 245

Query: 179 YDINA-ESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSI 237
           +  +  E E  +          ++D+K+H     L G+ S +  T  ++D  T  ++   
Sbjct: 246 FQYSKEEGEIKLLGDLVGHERRVSDVKYHP-SGKLIGSASHDM-TWRLWDASTYQELLLQ 303

Query: 238 E--MEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS 295
           E   E  F SL+F +   +L  + G D    ++D+R+  K + +++GH  PV  + +  S
Sbjct: 304 EGHTEGVF-SLSF-QCDGSLVCSGGMDTLSMIWDIRSGNKVM-TLTGHSKPVYTVAW--S 358

Query: 296 VDGILVSS-SEDRRIIIWDLMEIGSEQVNE 324
            +G  V++   D  I +WD+ +    QV++
Sbjct: 359 TNGYQVATGGGDGLINVWDIRQRDGGQVSQ 388

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 94/223 (42%), Gaps = 16/223 (7%)

Query: 99  RITKKFKLEKEITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLS 158
           ++ K F   K++  S    QD  ++   D  G VSI+D  +  + + T+       +   
Sbjct: 72  QVIKTFSRFKDVVYSASFRQDGKLLVAGDATGLVSIYDSYNPRNQLVTFQASSHPTHVTK 131

Query: 159 FNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSE 218
           F+P+    L +A DD  + ++DI+   +  +E   ++D   +  I +     T    VS 
Sbjct: 132 FHPMDSKSLTTANDDRVVRLWDISHAYQPILELTGASD--YVRSICF--LPGTPHMVVSG 187

Query: 219 E-KNTLSIYDLRTKDK--VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRK 275
                + +YD R +    VT++    P      S     L S  G+   V  +DL    K
Sbjct: 188 SYDGVIRLYDTRMESSQPVTTLNHGMPIED-TISMSQTQLISCGGSKFKV--WDLTGN-K 243

Query: 276 TLHSMSGHEGPVTNLEFHD-----SVDGILVSSSEDRRIIIWD 313
            L+S       VT L + +     ++D  L++SS D  + ++D
Sbjct: 244 LLYSRGNFAKTVTCLNYVNMPSDAAMDSCLLASSLDGHVKVFD 286

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 11/114 (9%)

Query: 249 SKHSKNLFSAAGTDQN-VYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILVSSSEDR 307
           S +  N+ +    D N + + D+RN    + ++ GH   V  +++H +   +L+S S+D 
Sbjct: 358 SPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDC 417

Query: 308 RIIIWDL----MEI-GSEQVNEDAQDATPE-----LMMIHAGHRSSVNDFSLNS 351
           + + WDL    MEI GS+  +  A  A+ E      +M   G +++  +  LNS
Sbjct: 418 QALYWDLNNSFMEINGSDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNS 471

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 101 TKKFKLEKEITRSRYMVQDPNIISTIDGNGT-VSIFDRNSSDSPVKTYSYHKDNGYGLSF 159
           T   K    + R      DPN+++T   +   + I D  + +SP+     H  +   + +
Sbjct: 343 TPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKW 402

Query: 160 NPISKGQLLSAADDGYIAMYDIN 182
           +P  +  LLS +DD     +D+N
Sbjct: 403 HPTKRNVLLSCSDDCQALYWDLN 425

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,612,212
Number of extensions: 2101005
Number of successful extensions: 8673
Number of sequences better than 10.0: 953
Number of HSP's gapped: 8039
Number of HSP's successfully gapped: 1476
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)