Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0K012007.126ON2022029621e-134
Smik_9.1847.126ON2141686364e-84
Suva_9.1947.126ON2151656357e-84
Skud_9.1627.126ON2171536261e-82
KNAG0G010207.126ON2071516233e-82
SAKL0F05368g7.126ON2311636236e-82
NDAI0H013107.126ON2611586232e-81
YIL010W (DOT5)7.126ON2151516131e-80
Kpol_1062.577.126ON2191536096e-80
KLLA0D14333g7.126ON2051495946e-78
ADL018W7.126ON2441695979e-78
TDEL0H028807.126ON3541576043e-77
Ecym_83517.126ON2241695811e-75
ZYRO0C05214g7.126ON2701465763e-74
TBLA0A009407.126ON2881555662e-72
CAGL0C03850g7.126ON2091675504e-71
NCAS0F008107.126ON2311725454e-70
TPHA0C043307.126ON2091675183e-66
Kwal_55.208397.126ON3051645254e-66
KLTH0F12562g7.126ON2931985021e-62
Ecym_46877.388ON252105820.032
SAKL0F12320g7.388ON248105820.036
KLLA0E20285g7.388ON249107800.060
NCAS0E026307.388ON23171760.17
Kpol_1004.598.300ON176139730.36
Smik_2.527.388ON261138701.1
Suva_2.537.388ON261132701.1
YBL064C (PRX1)7.388ON261132701.2
Skud_2.407.388ON261136691.3
Kwal_27.108617.388ON249107672.8
KAFR0A042308.745ON23381663.1
KLTH0C06798g7.388ON24973663.4
NDAI0E042007.388ON25448654.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0K01200
         (202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   375   e-134
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   249   4e-84
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   249   7e-84
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   245   1e-82
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   244   3e-82
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   244   6e-82
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   244   2e-81
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   240   1e-80
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   239   6e-80
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   233   6e-78
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   234   9e-78
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   237   3e-77
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   228   1e-75
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   226   3e-74
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   222   2e-72
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   216   4e-71
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   214   4e-70
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   204   3e-66
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   206   4e-66
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   197   1e-62
Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON...    36   0.032
SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly ...    36   0.036
KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} simil...    35   0.060
NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON...    34   0.17 
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    33   0.36 
Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON} YB...    32   1.1  
Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON} YB...    32   1.1  
YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}  P...    32   1.2  
Skud_2.40 Chr2 complement(84030..84815) [786 bp, 261 aa] {ON} YB...    31   1.3  
Kwal_27.10861 s27 complement(530889..531638) [750 bp, 249 aa] {O...    30   2.8  
KAFR0A04230 Chr1 (846003..846704) [702 bp, 233 aa] {ON} Anc_8.74...    30   3.1  
KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {O...    30   3.4  
NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON...    30   4.1  

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  375 bits (962), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 186/202 (92%)

Query: 1   MQLRNSTRIKAKVLFXXXXXXXXXXXXXXXXVTISKEETVESSGNVSSSELQIGDIMPDI 60
           MQLRNSTRIKAKVLF                VTISKEETVESSGNVSSSELQIGDIMPDI
Sbjct: 1   MQLRNSTRIKAKVLFEDIEDDKERRPEKKRRVTISKEETVESSGNVSSSELQIGDIMPDI 60

Query: 61  TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA 120
           TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA
Sbjct: 61  TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA 120

Query: 121 DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV 180
           DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV
Sbjct: 121 DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV 180

Query: 181 SPERSISESKKEVMELAEKNSR 202
           SPERSISESKKEVMELAEKNSR
Sbjct: 181 SPERSISESKKEVMELAEKNSR 202

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  249 bits (636), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 145/168 (86%)

Query: 32  VTISKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKAS 91
           V +S+ E    +   +S+EL+IGD +PD++L+++DN  ISL+++A+ NKI+V F YPKAS
Sbjct: 44  VKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKAS 103

Query: 92  TPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGIL 151
           TPGCTRQACGFRDNYD++KKH+AVFGLS+DSV SQKRFQ KQNLP+ LLSDPKRE IG+L
Sbjct: 104 TPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLL 163

Query: 152 GAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           GAKKTP SG IRSH+VF+DGKLRF+ +K+SPE S++++KKE++ELAEK
Sbjct: 164 GAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEK 211

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  249 bits (635), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 112/165 (67%), Positives = 143/165 (86%), Gaps = 2/165 (1%)

Query: 37  EETV--ESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPG 94
           EE V  E   ++ ++EL++GD +PD++L+N+DN  +SL+E+AK NKI+V F YPKASTPG
Sbjct: 47  EEPVKREDHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPG 106

Query: 95  CTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAK 154
           CTRQACGFRDNY+++K+HAAVFGLSADSV+SQK+FQ KQ LP+ LLSDPKRE IG+LGAK
Sbjct: 107 CTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAK 166

Query: 155 KTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           KTP SG IRSH+VF+DGKLRF+ +K+SPE S+ ++KKEVMELAEK
Sbjct: 167 KTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  245 bits (626), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 107/153 (69%), Positives = 138/153 (90%)

Query: 47  SSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNY 106
           +++EL+IGD +PD++L+++DN  ISL+E+AK NKI+V F YPKASTPGCTRQACGFRDNY
Sbjct: 59  AATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNY 118

Query: 107 DEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHW 166
           +++KKHAAVFGLSAD V SQK+FQ KQNLP+ L+SDPKRE IG+LGAKKTP SG IRSH+
Sbjct: 119 EDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHF 178

Query: 167 VFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           VF++GKLRF+ IK+SPE S+S++KKEV+E+AE+
Sbjct: 179 VFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  244 bits (623), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 108/151 (71%), Positives = 132/151 (87%)

Query: 46  VSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDN 105
           V +  L+IGD +PD+TL++Q+ + +SL EVA NNKILV+FAYP+ASTPGCTRQACGFRDN
Sbjct: 53  VDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDN 112

Query: 106 YDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSH 165
           Y E+KKHAAV+GLSAD+V SQK+FQ KQNLP+ LLSDPKRE IG+LGAKKT QSGIIRS+
Sbjct: 113 YAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSY 172

Query: 166 WVFLDGKLRFRNIKVSPERSISESKKEVMEL 196
           W+F +GKLR + IKVSPE S++ESK EV+EL
Sbjct: 173 WIFFNGKLRIKKIKVSPEASVAESKAEVLEL 203

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  244 bits (623), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 141/163 (86%), Gaps = 1/163 (0%)

Query: 35  SKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPG 94
           S++E  E   N +SSEL++GD +PD+ L NQD++ ISL+E+AK N+I+V FAYPKASTPG
Sbjct: 59  SEDEPTEEP-NPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPG 117

Query: 95  CTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAK 154
           CTRQ CG+RDNY+++K+HAAVFGLSAD+  +QK FQ KQ+LP++LLSDPKRE IG+LGAK
Sbjct: 118 CTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAK 177

Query: 155 KTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197
           KTPQSG+IRSHWVF +GKLRF+ +K+SPE S+++ KKEV+ELA
Sbjct: 178 KTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELA 220

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  244 bits (623), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 109/158 (68%), Positives = 142/158 (89%)

Query: 42  SSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACG 101
           S+ N S  EL+IGD +PDITL NQ+ ++ISL+E+AK NKI+V+FA+P+ASTPGCTRQACG
Sbjct: 100 SANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACG 159

Query: 102 FRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGI 161
           FRDNYDE+KK+A VFGLSAD++ SQK+F+EKQ+LP++LLSDPKR+LIG+LGAKKTPQSG 
Sbjct: 160 FRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGT 219

Query: 162 IRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           +RS+W+F++GKL  + IKVSPE S++ESKKEV+E A+K
Sbjct: 220 VRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKK 257

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  240 bits (613), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 136/151 (90%)

Query: 49  SELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDE 108
           +EL+IGD +PD++L+N+DN  ISL+++ +NN+++V F YP+ASTPGCTRQACGFRDNY E
Sbjct: 61  NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE 120

Query: 109 IKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVF 168
           +KK+AAVFGLSADSV SQK+FQ KQNLP+ LLSDPKRE IG+LGAKKTP SG IRSH++F
Sbjct: 121 LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF 180

Query: 169 LDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           +DGKL+F+ +K+SPE S++++KKEV+E+AEK
Sbjct: 181 VDGKLKFKRVKISPEVSVNDAKKEVLEVAEK 211

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  239 bits (609), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 135/153 (88%)

Query: 50  ELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEI 109
           E++IGD +PD+ L NQD  KISL+++AK+N ILV FAYP+A TPGCTRQACGFRD YD++
Sbjct: 67  EVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDTYDDL 126

Query: 110 KKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFL 169
           KKHAAVFGLSADS  SQK+FQ+K +LP++LLSDPKRE IG+LGAKKTPQSGIIRSH++F+
Sbjct: 127 KKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSHFIFV 186

Query: 170 DGKLRFRNIKVSPERSISESKKEVMELAEKNSR 202
           DGKLRF+ IK+SPE S+++ KKEV+E+ E+ S+
Sbjct: 187 DGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  233 bits (594), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 127/149 (85%)

Query: 49  SELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDE 108
           +ELQIGD +PD+TL+NQD++ ISL+EVA  NK++V FAYPKASTPGCTRQACG+RDNY E
Sbjct: 54  AELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSE 113

Query: 109 IKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVF 168
           +K+HAAVFGLSAD+  SQK FQ KQ LPF+LLSDPKRE IG LGAKKT  SG++RSHW+F
Sbjct: 114 LKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIF 173

Query: 169 LDGKLRFRNIKVSPERSISESKKEVMELA 197
            +GKL  + ++VSPE SI E KKEV+ELA
Sbjct: 174 KNGKLEVKRVQVSPEVSIEEGKKEVLELA 202

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  234 bits (597), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 131/169 (77%)

Query: 32  VTISKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKAS 91
           V   K+     +      ELQ+GD++P+ITL NQD   + L +V K NKI+VLFAYPKAS
Sbjct: 68  VETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKAS 127

Query: 92  TPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGIL 151
           TPGCTRQACGFRDNY E++KHA VFG+SADSV SQK FQ+KQ LPF+LLSDPKRELIG L
Sbjct: 128 TPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGAL 187

Query: 152 GAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEKN 200
           GA+KT Q+G+IRSHWVF+DGKL  + IK+SPE SI++   EV+  A+K+
Sbjct: 188 GARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKS 236

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  237 bits (604), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 131/157 (83%)

Query: 41  ESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQAC 100
           +S     S+EL IGD +PD+TL NQD + +SL++VAK +KI+++FAYPKASTPGCTRQAC
Sbjct: 192 DSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQAC 251

Query: 101 GFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSG 160
           G+RDNYDE+K+HAAVFGLS D+  +QK+FQ KQ+LPF+LL DP R LIG LGAKKT QSG
Sbjct: 252 GYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSG 311

Query: 161 IIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197
            +RSHWVF DGKL+++ +KVSPE SI + KKEV+ELA
Sbjct: 312 TLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  228 bits (581), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/169 (60%), Positives = 141/169 (83%), Gaps = 1/169 (0%)

Query: 32  VTISKEETVESSGNVSS-SELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKA 90
           V + K ++V  S  V    EL++GD +P+I L NQD+++++L++VAK NKI+++FAYPKA
Sbjct: 51  VGVLKADSVLKSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKA 110

Query: 91  STPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGI 150
           +TPGCTRQACGFRDNY+E++KHA +FG+S+DSV SQK FQ KQ+LPF+LLSDP RELIG+
Sbjct: 111 NTPGCTRQACGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGM 170

Query: 151 LGAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199
           LGAKKT Q+G+IRSHW+F +GKL+++ +KVSPE SISE  +EV+ L +K
Sbjct: 171 LGAKKTAQAGVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  226 bits (576), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%)

Query: 54  GDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHA 113
           GD +PDI L NQD ++ISL++V+  +KI+V+F YPKASTPGCTRQACGFRDNY++IK+HA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 114 AVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKL 173
           AVFGLSAD+V +QK+FQEKQ+LPF+LLSDP+R L+G+LGAKK+P+SGIIRSHWVF DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 174 RFRNIKVSPERSISESKKEVMELAEK 199
           + + +K+SPE SI E KKEV+EL ++
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQ 240

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  222 bits (566), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 97/155 (62%), Positives = 131/155 (84%)

Query: 47  SSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNY 106
           S  EL++GD +PD  L NQ+N+ ISL++V + N+I+V+FAYPKA+TPGCTRQACG RDNY
Sbjct: 123 SVKELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNY 182

Query: 107 DEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHW 166
           +++KK+A VFG+SADSV +QK FQEKQNLP++LLSD  RELIG LG KKTP SGIIRSH+
Sbjct: 183 NDLKKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHF 242

Query: 167 VFLDGKLRFRNIKVSPERSISESKKEVMELAEKNS 201
           + ++GKL+F+ +K+SPE S+S+ KKEV+E+++  S
Sbjct: 243 IIVNGKLKFKRVKISPEVSVSDCKKEVLEISKSES 277

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  216 bits (550), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 133/167 (79%), Gaps = 4/167 (2%)

Query: 35  SKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPG 94
           +KEE V S   +    L++GD +PDITL NQD + +SL+ +AK NK++++F YPKASTPG
Sbjct: 46  TKEEKVSSDEAI----LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPG 101

Query: 95  CTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAK 154
           CTRQACGFRDN+D++K+H  V GLS D+  +Q +F+EK +LP++LL DP RE IG+LGAK
Sbjct: 102 CTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAK 161

Query: 155 KTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELAEKNS 201
           KTP SG IRSH+VF DGKL+F+ +K+SPE S+++ KKEV+ELA++ S
Sbjct: 162 KTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQYS 208

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  214 bits (545), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 98/172 (56%), Positives = 134/172 (77%), Gaps = 10/172 (5%)

Query: 36  KEETVESSGNVSSS----------ELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLF 85
           KEE V+S   + S+          ELQIGD +PDI L +++   +SL++V + NKI+V F
Sbjct: 58  KEEIVKSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFF 117

Query: 86  AYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKR 145
           A+PKA+TPGCTRQACGFRDNY E+K+HAAV+G+SAD V +QK+F+ KQNLP+ LLSD KR
Sbjct: 118 AFPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKR 177

Query: 146 ELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197
           + IG+LGAKKTPQSG+IRS+++F+DGKL+ + +K+SPE S+ E++KEV   A
Sbjct: 178 DFIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  204 bits (518), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 136/167 (81%), Gaps = 2/167 (1%)

Query: 32  VTISKEET-VESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKA 90
           +++SK ET ++ +      E+Q+GD +PD+TL NQ+ +++SL+++A+ NKI+ +F YP+A
Sbjct: 41  LSVSKIETDLKETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRA 100

Query: 91  STPGCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGI 150
           STPGCTRQACGFRDN+D++KK++ + GLS DS+ +QK F+ KQNLP++LL D +++LI I
Sbjct: 101 STPGCTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITI 160

Query: 151 LGAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197
           LG KK P SGIIRS+++F+DGKL+ + +KVSPE SI+ESKKE+++L 
Sbjct: 161 LGCKKKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLV 206

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  206 bits (525), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 95/164 (57%), Positives = 131/164 (79%), Gaps = 2/164 (1%)

Query: 34  ISKEETVESSGNVSSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTP 93
           + K +T +SS + S  EL++GD +PD+ L NQD +++SL++VA+ NK++++F+YPKASTP
Sbjct: 31  VKKPKTAKSS-DSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTP 89

Query: 94  GCTRQACGFRDNYDEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGA 153
           GCT QACGFRDNY+++K+  AVFGLSAD+  +Q++FQ+  +LPF+LLSDPKRELIG+LGA
Sbjct: 90  GCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGA 149

Query: 154 KKTPQSGIIRSHWVFLDGKLRFRNIKVSPERSISESKKEVMELA 197
           KK+P SG  RSHWVF +GKL  + I VSPE SI ++K E  E A
Sbjct: 150 KKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  197 bits (502), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 142/198 (71%), Gaps = 9/198 (4%)

Query: 1   MQLRNSTRIKAKVLFXXXXXXXXXXXXXXXXVTISKEETVESSGNVSSSELQIGDIMPDI 60
           ++LR STR K+                    V  +  ET ++  N S  EL+ GD +PD+
Sbjct: 2   VELRRSTRKKS--------SDAPKRAPEEEEVAPNAPETKKAKTNGSKGELEEGDEVPDV 53

Query: 61  TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA 120
            L NQ+ +++SL+ V + NK++V+FAYPKASTPGCT+QACGFRDNY+E+KK+AAVFGLS 
Sbjct: 54  VLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAAVFGLST 113

Query: 121 DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV 180
           D+  +Q++F+EK +LPF+LLSDP+R+LIG LGA K+P SG  RS+WVF+ GKLR + I V
Sbjct: 114 DTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRTKRISV 172

Query: 181 SPERSISESKKEVMELAE 198
           SPE S+SE+KKE +E A+
Sbjct: 173 SPEASVSEAKKEAIEAAQ 190

>Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON}
           similar to Ashbya gossypii AGR368W
          Length = 252

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 10/105 (9%)

Query: 51  LQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEI- 109
           L++  + P+ T    D  K++L E    N   +LF++P   TP CT +   F     E  
Sbjct: 40  LRVNSVAPNFTAETTDG-KLNLYEYF-GNSWGILFSHPADFTPVCTTELGAFAKLKPEFE 97

Query: 110 KKHAAVFGLSADSVVSQKRF-------QEKQNLPFELLSDPKREL 147
           K+   + GLSA+ V    ++        E     F +++D  RE+
Sbjct: 98  KRDVKLIGLSAEGVEKHHKWVKDIEEVSELDKFTFPIIADVDREV 142

>SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 248

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 10/105 (9%)

Query: 51  LQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEI- 109
           L+I  + P+ T  N    KI   E    +   VLF++P   TP CT +   F     E  
Sbjct: 37  LRINSLAPNFT-ANTTQGKIDFHEYI-GDSWTVLFSHPADFTPVCTTELGAFAKLKPEFD 94

Query: 110 KKHAAVFGLSADSVVSQKRF-------QEKQNLPFELLSDPKREL 147
           K++  + GLSA+ V   K +        +     F ++ D +RE+
Sbjct: 95  KRNVKLIGLSAEGVEKHKEWVKDIEEVSQLDKFTFPIIGDVEREV 139

>KLLA0E20285g Chr5 (1803791..1804540) [750 bp, 249 aa] {ON} similar
           to uniprot|P34227 Saccharomyces cerevisiae YBL064C PRX1
           Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin
           peroxidase activity has a role in reduction of
           hydroperoxides induced during respiratory growth and
           under conditions of oxidative stress
          Length = 249

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 14/107 (13%)

Query: 51  LQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGF---RDNYD 107
           L+I  + P+ T  +    K++  E    N   VLF++P   TP CT +   F   +  +D
Sbjct: 38  LRINSVAPNFT-ADTTAGKVNFHEYI-GNSWAVLFSHPADFTPVCTTELGAFAKLKPEFD 95

Query: 108 EIKKHAAVFGLSADSVVSQKRF-------QEKQNLPFELLSDPKREL 147
           +  ++  + GLSA+ + S +++        +     F +++D  RE+
Sbjct: 96  Q--RNVKLIGLSAEGIESHQKWIKDIEEVSQLDKFTFPIIADVDREV 140

>NCAS0E02630 Chr5 complement(526821..527516) [696 bp, 231 aa] {ON}
           Anc_7.388
          Length = 231

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 83  VLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRF----QE------ 131
           +LF++P   TP CT +   F     E  K++  + GLS +SV S  ++    QE      
Sbjct: 45  ILFSHPADFTPVCTTEMGAFAQLKPEFDKRNVKLVGLSLESVESHDKWIKDIQEVAKLPS 104

Query: 132 KQNLPFELLSD 142
           KQ  PF ++ D
Sbjct: 105 KQPFPFPIIGD 115

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 13/139 (9%)

Query: 64  NQDNQK----ISLQEVAKNNKILVLFAYPKASTPGCT-RQACGFRDNYDE-IKKHAAVFG 117
           NQD  K    I   +  K NK +V+   P A +P C+     G+ +  DE +KK   +  
Sbjct: 29  NQDACKMPVTIDWTQFVKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIV 88

Query: 118 LSADSVVSQKRFQEKQNLP----FELLSDPKRELIGILGAKKTPQSGIIRS-HWVFL--D 170
           L+ D+  +Q+ +  +  +      +  SD     I  LG +    +G+  S  W  +  D
Sbjct: 89  LTVDNPFAQQAWARQLGVTDTTKLKFASDAGAHFIKSLGLELDVGNGVFWSGRWALVVKD 148

Query: 171 GKLRFRNIKVSPERSISES 189
           G + +   + +P   ++ S
Sbjct: 149 GIVTYAGKEENPATDVTVS 167

>Smik_2.52 Chr2 complement(94285..95070) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 64/138 (46%), Gaps = 22/138 (15%)

Query: 79  NKILVLFAYPKASTPGCTRQACGF---RDNYDEIKKHAAVFGLSADSVVSQKRFQEK--- 132
           N   VLF++P   TP CT +   F   +  +D  K++  + GLS + V S +++ +    
Sbjct: 75  NSWGVLFSHPADFTPVCTTEVSAFAKLKPEFD--KRNVKLIGLSVEDVESHEKWIQDIKE 132

Query: 133 ----QNLPFELLSDPKR------ELIGILGAKKTPQSGI--IRSHWVFLDGKLRFRNIKV 180
               +N+ F ++ D  R      +++   G K      +  +RS +V +D K + R I  
Sbjct: 133 IAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFV-IDPKKKIRLIFT 191

Query: 181 SPERSISESKKEVMELAE 198
            P  ++  +  EV+ + +
Sbjct: 192 YPS-TVGRNTSEVLRVID 208

>Suva_2.53 Chr2 complement(97422..98207) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 18/132 (13%)

Query: 83  VLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRFQEK-------QN 134
           VLF++P   TP CT +   F     E  K++  + GLS + V S +++ +        +N
Sbjct: 79  VLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHQKWIQDIKEIAKVKN 138

Query: 135 LPFELLSDPKR------ELIGILGAKKTPQSGI--IRSHWVFLDGKLRFRNIKVSPERSI 186
           + F ++ D  R      +++   G K      +  +RS +V +D K + R I   P  ++
Sbjct: 139 VGFPIIGDTFRNVAFLYDMVDADGFKNINDGSLKTVRSVFV-IDPKKKIRLIFTYPS-TV 196

Query: 187 SESKKEVMELAE 198
             +  EV+ + +
Sbjct: 197 GRNTSEVLRVID 208

>YBL064C Chr2 complement(100371..101156) [786 bp, 261 aa] {ON}
           PRX1Mitochondrial peroxiredoxin (1-Cys Prx) with
           thioredoxin peroxidase activity, has a role in reduction
           of hydroperoxides; reactivation requires Trr2p and
           glutathione; induced during respiratory growth and
           oxidative stress; phosphorylated
          Length = 261

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 18/132 (13%)

Query: 83  VLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRFQEK-------QN 134
           VLF++P   TP CT +   F     E  K++  + GLS + V S +++ +        +N
Sbjct: 79  VLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKN 138

Query: 135 LPFELLSDPKR------ELIGILGAKKTPQSGI--IRSHWVFLDGKLRFRNIKVSPERSI 186
           + F ++ D  R      +++   G K      +  +RS +V +D K + R I   P  ++
Sbjct: 139 VGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFV-IDPKKKIRLIFTYPS-TV 196

Query: 187 SESKKEVMELAE 198
             +  EV+ + +
Sbjct: 197 GRNTSEVLRVID 208

>Skud_2.40 Chr2 complement(84030..84815) [786 bp, 261 aa] {ON}
           YBL064C (REAL)
          Length = 261

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 18/136 (13%)

Query: 79  NKILVLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRFQEK----- 132
           N   VLF++P   TP CT +   F     E  K++  + GLS + V S +++ +      
Sbjct: 75  NSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEVA 134

Query: 133 --QNLPFELLSDPKR------ELIGILGAKKTPQSGI--IRSHWVFLDGKLRFRNIKVSP 182
             +N+ F ++ D  R      +++   G K      +  +RS +V +D K + R I   P
Sbjct: 135 KVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFV-IDPKKKIRLIFTYP 193

Query: 183 ERSISESKKEVMELAE 198
             ++  +  EV+ + +
Sbjct: 194 S-TVGRNTSEVLRVID 208

>Kwal_27.10861 s27 complement(530889..531638) [750 bp, 249 aa] {ON}
           YBL064C - 1:1 [contig 33] FULL
          Length = 249

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%), Gaps = 14/107 (13%)

Query: 51  LQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGF---RDNYD 107
           L++  + P+ T  +    K++L E    +   VLF++P   TP CT +   F   +  +D
Sbjct: 38  LRVNSLAPNFT-ADSTQGKLNLHEYL-GDSWGVLFSHPADFTPVCTTELGAFAKLKPEFD 95

Query: 108 EIKKHAAVFGLSADSVVSQ----KRFQEKQNL---PFELLSDPKREL 147
           +  ++  + GLSA+ V       K  +E  +L    F ++ D +RE+
Sbjct: 96  Q--RNVKLIGLSAEKVDKHQAWIKDIEEISSLDKFSFPIIGDAEREV 140

>KAFR0A04230 Chr1 (846003..846704) [702 bp, 233 aa] {ON} Anc_8.745
           YOR283W
          Length = 233

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 13/81 (16%)

Query: 128 RFQEKQNLPFELLSDPKRELIGIL-GAKKTPQSGIIRSHWVFLDGKLRFRNIKVSPE--- 183
           RF  ++++P EL SD +   +GI+ G   T        H     GK  FR+    PE   
Sbjct: 87  RFSGQEDVPVELDSDLRERFMGIIEGMHITDAEKYANKH-----GKGSFRDFGEDPEEFT 141

Query: 184 ----RSISESKKEVMELAEKN 200
               R I++S KE +E   +N
Sbjct: 142 ARLHRGINKSIKESLEKDYRN 162

>KLTH0C06798g Chr3 complement(590991..591740) [750 bp, 249 aa] {ON}
           similar to uniprot|P34227 Saccharomyces cerevisiae
           YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx)
           with thioredoxin peroxidase activity has a role in
           reduction of hydroperoxides induced during respiratory
           growth and under conditions of oxidative stress
          Length = 249

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 8/73 (10%)

Query: 83  VLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRF----QEKQNL-- 135
           VLF++P   TP CT +   F     E  K++  + GLSA+ V   +++    +E  +L  
Sbjct: 68  VLFSHPADFTPVCTTELGAFAQLKPEFEKRNVKLIGLSAEEVDKHQKWIKDIEEISSLDK 127

Query: 136 -PFELLSDPKREL 147
             F ++ D  RE+
Sbjct: 128 FAFPIVGDADREV 140

>NDAI0E04200 Chr5 complement(949094..949858) [765 bp, 254 aa] {ON}
           Anc_7.388
          Length = 254

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 83  VLFAYPKASTPGCTRQACGFRDNYDEI-KKHAAVFGLSADSVVSQKRF 129
           VLF++P   TP CT +   F     E  K++  + GLS + V S  ++
Sbjct: 58  VLFSHPADFTPVCTTEMSAFAKLKPEFDKRNVKLIGLSVEDVESHNKW 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,340,884
Number of extensions: 720087
Number of successful extensions: 1649
Number of sequences better than 10.0: 50
Number of HSP's gapped: 1645
Number of HSP's successfully gapped: 50
Length of query: 202
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 98
Effective length of database: 41,556,135
Effective search space: 4072501230
Effective search space used: 4072501230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)