Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J028903.569ON70670637270.0
NCAS0E002503.569ON70870833190.0
NDAI0I032503.569ON70970932790.0
Suva_7.163.569ON70870832430.0
Kpol_507.83.569ON70770732220.0
YGL245W (GUS1)3.569ON70870832130.0
KNAG0I002203.569ON70770732040.0
Skud_7.223.569ON70870831950.0
Smik_7.163.569ON70870831870.0
CAGL0C01947g3.569ON70570731830.0
TDEL0D063703.569ON70670631590.0
SAKL0F00748g3.569ON70770731490.0
TPHA0A060203.569ON70770730900.0
KLLA0A00682g3.569ON70870830660.0
Kwal_47.192723.569ON70470530440.0
ZYRO0E09570g3.569ON70670430160.0
AFR264W3.569ON70770729900.0
KLTH0G00682g3.569ON70470529850.0
TBLA0E001903.569ON70770829220.0
ZYRO0C07018g6.51ON8034865942e-65
TDEL0G041906.51ON8093755932e-65
YOR168W (GLN4)6.51ON8093755905e-65
Smik_15.3486.51ON8103755844e-64
KAFR0G026106.51ON7943775819e-64
Skud_15.3326.51ON8094195773e-63
SAKL0E02134g6.51ON8015475758e-63
Kwal_56.225596.51ON8003845722e-62
Kpol_1037.386.51ON8083755712e-62
KNAG0M011006.51ON7993345713e-62
Suva_8.2236.51ON8213755704e-62
AGR259C6.51ON7983785661e-61
NCAS0F002406.51ON8114505652e-61
CAGL0L04532g6.51ON7953405633e-61
TBLA0G004506.51ON8083845633e-61
KLTH0C10340g6.51ON8003755624e-61
NDAI0K028606.51ON8143755617e-61
TPHA0J005506.51ON8083345484e-59
Ecym_31356.51ON8043785466e-59
KLLA0F20449g6.51ON8043215404e-58
KNAG0L006207.100ON5172481894e-14
NDAI0A084607.100ON5292621805e-13
NCAS0I005607.100ON5272191752e-12
TPHA0L005907.100ON5582751681e-11
Suva_15.1347.100ON5353521611e-10
YOL033W (MSE1)7.100ON5362341573e-10
Skud_15.1227.100ON5323271555e-10
Kpol_1044.127.100ON5362311555e-10
TBLA0E021807.100ON5312341512e-09
TDEL0H035007.100ON5342281484e-09
CAGL0F01133g7.100ON5322151467e-09
KAFR0D013207.100ON5142331441e-08
Smik_15.1327.100ON5353441432e-08
AEL338C7.100ON5332351395e-08
Kwal_26.72027.100ON5672411386e-08
KLLA0F07975g7.100ON5422491378e-08
Ecym_26267.100ON5732341361e-07
SAKL0B09548g7.100ON5542511351e-07
KLTH0D02794g7.100ON5462261306e-07
ZYRO0D05808g7.100ON5332471226e-06
TPHA0C006808.347ON69977790.68
Smik_12.4694.236ON89565781.1
Kpol_480.208.810ON54666771.2
Ecym_61644.116ON29897742.1
Kwal_27.108527.389ON1046184733.6
NDAI0J017304.136ON154688725.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J02890
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1440   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1283   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1267   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1253   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1245   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1242   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1238   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1235   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1232   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1230   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1221   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1217   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1194   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1185   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1177   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1166   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1156   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1154   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1130   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   233   2e-65
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   233   2e-65
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   231   5e-65
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   229   4e-64
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   228   9e-64
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   226   3e-63
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   226   8e-63
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   224   2e-62
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   224   2e-62
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   224   3e-62
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   224   4e-62
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   222   1e-61
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   222   2e-61
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   221   3e-61
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   221   3e-61
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   221   4e-61
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   220   7e-61
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   215   4e-59
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   214   6e-59
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   212   4e-58
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    77   4e-14
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    74   5e-13
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    72   2e-12
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    69   1e-11
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    67   1e-10
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    65   3e-10
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    64   5e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    64   5e-10
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    63   2e-09
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    62   4e-09
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    61   7e-09
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    60   1e-08
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    60   2e-08
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    58   5e-08
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    58   6e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    57   8e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    57   1e-07
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    57   1e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    55   6e-07
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    52   6e-06
TPHA0C00680 Chr3 complement(128269..130368) [2100 bp, 699 aa] {O...    35   0.68 
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    35   1.1  
Kpol_480.20 s480 (47609..49249) [1641 bp, 546 aa] {ON} (47609..4...    34   1.2  
Ecym_6164 Chr6 complement(301696..302592) [897 bp, 298 aa] {ON} ...    33   2.1  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    33   3.6  
NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa] ...    32   5.5  

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1440 bits (3727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/706 (98%), Positives = 698/706 (98%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  AAFPDAFRNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADI 120
           AAFPDAFRNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADI
Sbjct: 61  AAFPDAFRNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADI 120

Query: 121 AAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKK 180
           AAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKK
Sbjct: 121 AAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKK 180

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 240
           KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 240

Query: 241 TNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEK 300
           TNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEK
Sbjct: 241 TNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEK 300

Query: 301 MREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY 360
           MREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY 360

Query: 361 RCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420
           RCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK
Sbjct: 361 RCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKK 540
           QGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKK
Sbjct: 481 QGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKK 540

Query: 541 NPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDF 600
           NPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDF
Sbjct: 541 NPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDF 600

Query: 601 KKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK
Sbjct: 601 KKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 661 EMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           EMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 EMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1283 bits (3319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/708 (85%), Positives = 659/708 (93%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MSATLVINGKAPVVAY  LIAAR+VN  +P++I IEFVDDKK+APATFNG ++ +F KIV
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  AAFPDAFRNANVA--SEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
           A F D F N+     ++W+ +ASEE ++KNFQKL++SL KLDA+LNLRTFI GGL+YSAA
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           DIA WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG+VHEFLTKSLQELKK A+AG
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDLELLGIKGDR+T+SSDYFQEMYD C+Q+IKEG AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           EKMREERMDGIASARRDR+VEENL+IFTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWML AL+L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTA+VNPVKIHL G+D P+TPKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPAVGEKKVIY+KDIV+DK+DAD++E NEEVT+MDWGN+IIT+KNADGS+  K+HLEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HKLTWLADT DVVPVDLVDFDHLI+KDKLEEDESFEDFLTP TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MKVGD+IQFERKGY+RLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1267 bits (3279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/709 (84%), Positives = 654/709 (92%), Gaps = 3/709 (0%)

Query: 1   MSA-TLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKI 59
           MSA TLVINGKAPVVAY  LIAAR++N A+P +I I+FVDDKKSAP+ FNGSS+ +F KI
Sbjct: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60

Query: 60  VAAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSA 117
           +  FP+ F  +N    +EW  +A+EE +VKNFQKL++SL KLDA LNLRTFI GGL+YSA
Sbjct: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120

Query: 118 ADIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASA 177
           ADIA WGALRSNGM GSI+KNKV VNVSRWYSLLEMDP FG+VHE LTKSLQELKK +++
Sbjct: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180

Query: 178 GKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 237
           GKKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240

Query: 238 FDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTP 297
           FDDTNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQ+MY+LCV++IKEG AYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300

Query: 298 TEKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDP 357
           TEKMREERMDGIASARRDR+VEENLRIF EEMKNGTEEGLKNCVRAKIDY ALNKTLRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360

Query: 358 VIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALH 417
           VIYRCNLTPHHRTG TWKMYPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+A++
Sbjct: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420

Query: 418 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 477
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 478 VLSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPK 537
           VLSQGPSRNVINLEWN+IWAFNKKVIDPVA RHTA+V+PVKIHL G+D P+TPK EMKPK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540

Query: 538 HKKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLE 597
           HKKNPAVGEKKVIYYKDIV+DK DAD+IE NEEVT+MDWGN+IITKKNADGSM  K+HL+
Sbjct: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600

Query: 598 GDFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADL 657
           GDFKKT HKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTP TEFHTSAIADL
Sbjct: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660

Query: 658 NVKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           NVK+MKVGD+IQFERKGY+RLD++ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1253 bits (3243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/708 (83%), Positives = 643/708 (90%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           M +TL INGKAP VAY  LIAAR+VNA  P++I +EFVDDKK+  A  + ++E  FNKI 
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  AAFPDAFRNANV--ASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
             F   F N      ++W+ +A EE +VKNF KL+QSLE LD  LNLRTFI GGL+YSAA
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  HEFLTKSLQE+KKNA+ G
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQEMYD CVQ+IK+G AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           EKMREERMDGIASARRDR+VEENLRIFTEEMKNGTE GLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKKVIDP+APRHTAVVNPVKIHL G +AP+ PKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPAVGEKKVIYYKDIVVDK+DADVI+V+EEVTLMDWGN++ITKKNADGSM AK+HLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HKLTWLADT+D+VPVDLVDFDHL++KDKLEEDESFEDFLTPETEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MKVGD++QFERKGYFRLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1245 bits (3222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/707 (83%), Positives = 647/707 (91%), Gaps = 1/707 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MSATLVI GKAPVVAY  LIAAR+VN+++PD+IKIEFV+DKK++PAT NG S    +KIV
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  AAFPDAF-RNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
            A  D F   A  ++EWI +ASEE +VKNFQ+L +SLEKLDA+LNLRT+I+GGL ++ AD
Sbjct: 61  TANSDVFPEGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVAD 120

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           IA WGALRSNGMVGSIIKNKV VNVSRWY+LLE + LFG VHEFLTKSLQELKK ++AGK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKE  EFQDSILEDLELLGIKGDR+T+SSDYFQEMYD CVQLIK+G AYCDDTPTE
Sbjct: 241 DTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTE 300

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           KMR+ERM+GIAS RRDR+VEENL+IFTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPVI
Sbjct: 301 KMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVI 360

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           +RCNLTPHHRTG+ WKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL LR
Sbjct: 361 FRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNW+DPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IW+FNKKVIDPV PR TAVV+PVKIHL GEDAP++ K+EMKPKH 
Sbjct: 481 SQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHP 540

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNP VGEKKV++YKDIV+D+EDAD IE  EE+TLM+WGN IITKKNADGS+ AK+HLEGD
Sbjct: 541 KNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGD 600

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT HK+TWLADTEDVV VDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV
Sbjct: 601 FKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 660

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K+MKVGD+IQFERKGY+RLDSL  DGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/708 (82%), Positives = 645/708 (91%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           M +TL INGKAP+VAY  LIAAR+VNA  P++I I+ VDDKK+  A  + ++E  FNKI 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  AAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
           + F   F N +    ++W+N+A +E ++KNF KL+QSLE LD+ LNLRTFI GGL+YSAA
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  H+FL+KSL ELKK+A+ G
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDL+LLGIKGDR+TYSSDYFQEMYD CVQ+IK+G AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           EKMREERMDG+ASARRDR+VEENLRIFTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKKVIDP+APRHTA+VNPVKIHL G +AP+ PKIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPAVGEKKVIYYKDIVVDK+DADVI V+EEVTLMDWGN+IITKKN DGSM AK++LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MK+GD+IQFERKGY+RLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1238 bits (3204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/707 (82%), Positives = 641/707 (90%), Gaps = 4/707 (0%)

Query: 2   SATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVA 61
           +ATLVINGKAP+VAY  LIAAR+ N+A+  ++ IEFVDDK +APA FNG SE   +KI A
Sbjct: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62

Query: 62  AFPDAFRNANVA--SEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
            FP+ F     A  + W+  A++EF+VKNF KLA+SL KLDA+LNLRTF+ GGL+YS AD
Sbjct: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           IA WGALRSNGMVGSIIKNKVYVNVSRWY+L EM P F   HEFLTKS+QELKK ++AGK
Sbjct: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKEK EFQDSILEDL LLGIKGDRVTYSSDYFQ+MYD+C+QLIKEGGAYCDDTPTE
Sbjct: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           KMREERMDGIASARRDR+VEENL+IFTEEMKNGTEEGLKNCVRAKIDYAA NKTLRDPVI
Sbjct: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           YRCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLNALHLR
Sbjct: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVL
Sbjct: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVL 482

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVV+PVK+H+ G  APETPK EMKPKHK
Sbjct: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNPAVGEKKVI+Y+++V+DKEDA  +E +EEVTLMDWGN+IITK++ DGS+E K+HLEGD
Sbjct: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT HKLTWLADTEDVVPVDLVDFDHLI+KD+LEE ESFEDFLTP+TEF T AIADLNV
Sbjct: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K MKVGD+IQFERKGY+RLDSLPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/708 (81%), Positives = 643/708 (90%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           M +TL +NGKAP VAY  LIAAR+VNA  P++I I+FVDDKK+  A  + ++EG FNKI 
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  AAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
             F   F N +    S W ++A +E +VKNF KL+QSLE LD+ LN+RTFI GGL+YSAA
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  H+FLTKSLQELKK+A+ G
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYFQEM+D CVQ+IK+G AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           E+MREERMDGIASARR+R+VEENLR+FTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKKVIDP+APRHTA+VNPVKIHL G +AP+ PK+EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPAVGEKK+IYYKDIVVD+EDADVI V+EEVTLMDWGN+IITKKN DGSM AK+HLEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MKVGD+IQFERKGY+RLD+LPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1232 bits (3187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/708 (81%), Positives = 643/708 (90%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           M +TL INGKAP+VAY  LIAAR+VNA  P++I I FVDDKK+  A  + ++E  F+KI 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  AAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
             F   F N +    ++W+++A +E +VKNF KL+QSLE LD+ LNLRTFI GGL+YSAA
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  H+FL+KSLQELKK+A+ G
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYFQEMYD C+Q+IK+G AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           EKMREERMDGIAS+RRDR+VEENLRIFTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKK+IDP+APRHTA+VNPVKIHL G +AP+ PK E KPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPAVGEKKVIYYKDIVVDK+DADVI V+EE+TLMDWGN+IITKKN DGSM AK++LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MK+GD+IQFERKGY+RLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/707 (84%), Positives = 648/707 (91%), Gaps = 3/707 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDA-IKIEFVDDKKSAPATFNGSSEGSFNKI 59
           MS+TLVINGKAPVVAY  LIAARLVN ++ DA + +EFVDDKKSA ATF+G S+ +   I
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  VAAFPDAFRNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
           VA FP+       +  WI +A+EE ++KNFQKLAQSLEKLDA LN RT+I+GGL++ +AD
Sbjct: 61  VAKFPEILGANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSAD 120

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           IA WGALRSNGMVGSIIKNKVYVNVSRWY LLE +P FG  HEFLTKSLQELKK A+AGK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAGK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKEKTEFQDSILEDLELLGIKGDR+TYSSDYFQEMY+LCV+LIKEG AYCDDTPTE
Sbjct: 241 DTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPTE 300

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           KMREERMDGIASARR+R+VEENL+IFTE+MKNGTEEGLKNCVRAKIDYAALNKTLRDPVI
Sbjct: 301 KMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 360

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           YRCNLTPHHRTG+ WKMYPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+W L+ L+LR
Sbjct: 361 YRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTA+VNPVKIH+ G  APE+PK EMKPKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPKHK 538

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNPAVGEKKVIYY+++V+DKEDAD IE NEEVTLMDWGNIIITKKNADGSMEAK+HLEGD
Sbjct: 539 KNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEGD 598

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT HKLTWLADT+D V VDLVDFDHLISKDKLEEDESFEDFLTP+TEFHT AIADLNV
Sbjct: 599 FKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLNV 658

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K+M VGD+IQFERKGY+RLD+  KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 659 KDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/706 (82%), Positives = 639/706 (90%), Gaps = 3/706 (0%)

Query: 3   ATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAA 62
           A L+INGKAPVVAY  LIAAR+VN   P++I +EFVDDKK+APA  +G SEG F KI+ A
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  FPDAFRNANVA--SEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADI 120
           FP  F        + W+  AS ++++KNFQKL+ SLEKLDA LNLRT+I GGL+YSAADI
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 121 AAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKK 180
           A WGALRSNGMVGSIIKNKV VNVSRWY+LLE D  FG  HEFLTKS+Q+LKK ++ GKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 240
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 241 TNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEK 300
           TNPSKEK EFQDSI+EDL+LLGI+GDR+T+SSDYFQEMYDLCV++IKEG AYCDDT TEK
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 301 MREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY 360
           MREERMDGIASARRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 361 RCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420
           RCNLTPHHRTG T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WMLNA++LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 480
           VHIWDFARVNFVRTLLSKRKLQWMVDK+LVSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 481 QGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKK 540
           QGPSRNVINLEWN+IWAFNKKVIDPVAPR TAVVNPVK+HL GEDAP++PK EMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 541 NPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDF 600
           NP VGEKKVI+YKD+V+DK+DADV+E NEEVTLMDWGN+IITKKNADGS+E K++L+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 601 KKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660
           KKT HKLTWLADTEDV PVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 661 EMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           ++KVGD+IQFERKGY+RLD+L KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1217 bits (3149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/707 (83%), Positives = 637/707 (90%), Gaps = 1/707 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MSA LVINGKAPVVAY  LIAAR+VNA++ DAIKIEFVDDKK+APATFNG ++ +F+KI+
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  AAFPDAF-RNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
            A+ D F      +SEW  +ASEEFI+KNFQKL+ SL KLD+ LNLRT+I      + AD
Sbjct: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           IA WGALRSNGMVGSIIKNKVYVNVSRWY++LE+DPLF   HEFLTKSLQELKK +++ K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYF+EMY LCVQLIKEG AYCDDTPTE
Sbjct: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           KMREERMDGIASARRDR+VEENLRIF EEMKNGTEEGLKNCVRAKIDY ALNK LRDPVI
Sbjct: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           +RCNLTPHHRTG TWKMYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML+ALHLR
Sbjct: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVV PVK+HL G+D P+ PKIEMK KHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNP VGEKKVIYYKD+++D+EDADV+   EE+TLMDWGN+IITKKN+DGS+  K+HLEGD
Sbjct: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT  KLTWLADTED V VDLVDFDHLISKDKLEE ++FEDFLTPETEFHT AIADLNV
Sbjct: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K+MKVGDVIQFERKGY+RLDSL KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1194 bits (3090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/707 (80%), Positives = 636/707 (89%), Gaps = 1/707 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           M ATL+I GK+ VVAY  LIAAR+VN+ +PD+I IEFV+DKK+A A+ NG ++   +KIV
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  AAFPDAFRNANVASE-WINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
           +A  D F      SE W+ +A  E ++KNFQKLA SL+KLDA+LNLRTFI+GGL YS AD
Sbjct: 61  SANADVFPEGVTGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIAD 120

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           IA WGALRSNGMVGSIIKNKV VNVSRWY+L E +P+FG  +EFLTKSLQELKK +SAGK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFD 240

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKEK EFQ+SILEDL LLGIKGDR+T+SSDYFQEMYD C+QLIKEG AYCDDTP +
Sbjct: 241 DTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVD 300

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           KMREERMDGIASARR+R+VEENL+IFTEEM+NGTEEGL+NCVRAKIDY ALNKTLRDPVI
Sbjct: 301 KMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVI 360

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           YRCNL PHHRTG  WKMYPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYEWMLNA++LR
Sbjct: 361 YRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MT+EGLRNFV+
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVI 480

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPR T V+NP+KIHL+G DAPETP++EMKPKH 
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHP 540

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNPAVGEK+VI+ KDIV+DK+DADVIE  EE+TLM+WGN II KKNADGS++A +HLEGD
Sbjct: 541 KNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGD 600

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT HK+TWLA+TEDV  VDLVDFDHLI+KDKLEEDESFE+FLTP TEFHT AIAD+NV
Sbjct: 601 FKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNV 660

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K+MKVGD+IQFERKGY+RLD+LPKDGKPY+FFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/708 (79%), Positives = 626/708 (88%), Gaps = 2/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPD-AIKIEFVDDKKSAPATFNGSSEGSFNKI 59
           MSA+L+I  KAPV+AY  LIAAR VNA++ D  I+I FV+DKK+A A+FNG +E    K+
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  VAAFPDAFR-NANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
            AA+PD    N++ ++EWI   +++ ++KNFQ+LA+SL KL+A+LNLRT+I   LE S A
Sbjct: 61  SAAYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           DIA WG LRSNGMVGSIIKNKVY+NVSRWYS  E+ P FG  HEFLTKSLQELKK ++  
Sbjct: 121 DIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVN 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EFQDSILEDLELLGIKGDR+TYSSDYFQEMYD CVQ+IKEG AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           E+MREER +GI S+RR+RTVEENL+IFTEEMKNGTEEGLKNCVRAKIDY ALNK +RDPV
Sbjct: 301 ERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHHRTG  WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRN QY+WMLNALHL
Sbjct: 361 IYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           RKVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IW+FNKKVIDPVAPRHTA+V+PVK+HL G+D P+TP +EMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNPA+GEKKVIYYKDIV+D+EDA ++   EEVTLMDWGN IITKKN DGS  AK+HLEG
Sbjct: 541 KKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEG 600

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFK T  KLTWLADT+D V  DLVDFDHLISKDKLEE E+FEDFLTP+TEFHT+A ADLN
Sbjct: 601 DFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLN 660

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MKVGD+IQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1177 bits (3044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/705 (79%), Positives = 619/705 (87%), Gaps = 3/705 (0%)

Query: 3   ATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAA 62
           A L +  KAPVVAY  LIAARL NA +P  I+I+FV+DKK++PATF G+S      IV +
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  FPDAFRNANVASE-WINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADIA 121
           FP+AF+      E W   ASEE +VKNFQKL+ SL+KLDA LNLRTF+ GG  YS ADIA
Sbjct: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121

Query: 122 AWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKK 181
            WG+LRSNGMVGSIIKN+VYVNVSRWY+LLE  P FG+ HEFLTK++QELKK ++  KKK
Sbjct: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 241
           ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 242 NPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKM 301
           NPSKEK EFQDSILEDLELLGIKGDRVTYSSDYFQEMY+LCV++I+EG AYCDDT TE+M
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301

Query: 302 REERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYR 361
           REERMDGIASARRDR+VEENLRIFT EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIYR
Sbjct: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361

Query: 362 CNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKV 421
           CNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLNALHLRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 482 GPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKKN 541
           GPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVVNPVK H+ G  AP+TP ++MK KHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539

Query: 542 PAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDFK 601
           PAVGEKKVIYY D+++D++DA +IE  EE+TLMDWGN+I+TKKNADGS+  K+HLEGDFK
Sbjct: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599

Query: 602 KTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKE 661
           KT  K+TWLADT D V VDLVDFDHLISKDKLEE E F DFLTP+TEFH  AIADLNVK+
Sbjct: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659

Query: 662 MKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           MK GD+IQFERKGY+RLD++    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/704 (78%), Positives = 620/704 (88%), Gaps = 3/704 (0%)

Query: 5   LVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAAFP 64
           LVINGKAPVVAY  LIA+R+VNAA  DAI +EFVD+K +AP  FNGSS+ +F KI++ +P
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 65  DAF--RNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADIAA 122
           D F   ++   + WI VA E+ +VKNFQ+L+QSLE+LDA LNLRTFI GGL+ SAADI  
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 123 WGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKKE 182
           WGALRSNGMVGSIIKNKVYVNVSRWY+LLE++P FG  HE+LTKS+Q +KK  +AGKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 183 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 242
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 243 PSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMR 302
           PSKE+ EFQD+ILEDLEL+GIKGD++TYSSDYFQEMYDLCVQLIKEG AYCDDT  EKMR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 303 EERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRC 362
           EERM+GI SA+RD +VEENLRIFTEEMKNGTE G KNCVRAKIDY A NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 363 NLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVH 422
           NLTPHHRT   WKMYPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL LRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 423 IWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 482
           IWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 483 PSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKKNP 542
           PS+NVINLEWN+IWA NKK+IDPVAPRHTAVV+PV+I L GE APETPK+E+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 543 AVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDFKK 602
           AVGEKKVIY   I++DKEDA V+EV EE+TLMDWGNIIIT KNADGS+ AK +L GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 603 TAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKEM 662
           T HK+TWLA+T D VPV++VDFDHLI+KDKLEEDE+F DF+TP+TEFHT A+ D+NVK+M
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 663 KVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           KVGD+IQFERKGY RLDS  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1156 bits (2990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/707 (76%), Positives = 615/707 (86%), Gaps = 1/707 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MS+TL+I  K+P VAY  LIAAR VN A+ DA+ I+F + K++A A+F+G S+ +  ++V
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  AAFPDAFRNA-NVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119
             +PD   +    A+ WI  A  + +VK+F+KL+ SLEKLDA+LNLRTF+ GG++ + AD
Sbjct: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120

Query: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179
           +A WGALRSNG VGSIIKNKVYVNVSRWY+ LE+ P FG  HEFL KSL+ELK   +  K
Sbjct: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180

Query: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239
           KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299
           DTNPSKE+ EFQDSILEDLELLGIKGDR+T+SSDYFQEMYD CVQ+IKEG AYCDDTPTE
Sbjct: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 300

Query: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359
           +MREERM+GIASARR+R+VEENL+IFTEEMKNGTEEGLKNCVRAK DYAALNKTL+DPV+
Sbjct: 301 RMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360

Query: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419
           YRCNLTPHHRTG  WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL LR
Sbjct: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 479
           KVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPT        MT+EGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480

Query: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539
           SQGPSRNVINLEWN+IWAFNKKVIDP+APRHT V NPVK+HL G D P+TP  EMKPKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540

Query: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599
           KNPAVGEKKVIYYKD+++  EDA ++   EEVTLMDWGN II  KN DGS+ A ++LEGD
Sbjct: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600

Query: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659
           FKKT  KLTWLADT D VPVDLVDFDHLISKD+LEE+++FEDFLTPETEFHT+AIADLNV
Sbjct: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660

Query: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           K+MKVGDVIQFER GY+RLD++    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1154 bits (2985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/705 (79%), Positives = 620/705 (87%), Gaps = 3/705 (0%)

Query: 3   ATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAA 62
           A L+I  KAPVVAY  LIAARLVN+A+ DAI+IEFV+DKKS+PATF  S +    +IV  
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  FPDAFRNA-NVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADIA 121
           +P+ F++      EW  +ASEE  VKNFQKL+ SL KLDA LN RTFI GG  +SAADIA
Sbjct: 62  YPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADIA 121

Query: 122 AWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKK 181
            WG+LRSNGMVGSIIKNKVYVNVSRWY+LLE  P FG+ HEFL K+LQELKK +++ KKK
Sbjct: 122 CWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKKK 181

Query: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 241
           ETHKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 242 NPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKM 301
           NPSKEK EFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCV++I+EG AYCDDTPT+KM
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDKM 301

Query: 302 REERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYR 361
           REERMDG+ASARRDR+VEENLRIFT+EMKNGTEEGLKNCVRAKIDY ALNKTLRDPVIYR
Sbjct: 302 REERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 361

Query: 362 CNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKV 421
           CNLTPHHRTG+TWK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML+ALHLRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRKV 421

Query: 422 HIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 481
           HIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 482 GPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKKN 541
           GPSRNVINLEWN+IWAFNKKVIDPVAPRHTA+V PVK H+ G  AP+TP +++K KHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKKN 539

Query: 542 PAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDFK 601
           PAVGEKKVIYY DI++D++DAD +   EE+TLMDWGN I+TKKNADGS+  K+HLEGDFK
Sbjct: 540 PAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFK 599

Query: 602 KTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKE 661
           KT  KLTWLADT+D V VDLVDFDHLI+KDKLEE E F D+LTP+TEFH SA+ADLNVK+
Sbjct: 600 KTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKD 659

Query: 662 MKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           MK GD+IQFERKGY+RLDS     KPYVFF IPDGKSVNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/708 (78%), Positives = 626/708 (88%), Gaps = 3/708 (0%)

Query: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60
           MS  L+++GKA  VAY  LIAAR+VN +  +A+ I FV+DKK+APAT +GSS+    KIV
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  AAFPDAFRNANV--ASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118
           A  P +F +A+    + W  +A E+ +VKNFQ+LAQ+LE LDA LNLR+F+ GGL +SAA
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178
           D+A WGALRSNGMVGSIIKNKVYVNVSRWYS LE++P FG  HEFLTKSLQELKK A+AG
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238
           KKKE+HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298
           DDTNPSKEK EF++SI+EDL LLGIKGDRVT+SSDYFQEMYD C+Q+IKEG AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358
           EKMREERM+G  SARR+R+VEENL+IFTE+M NGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418
           IYRCNLTPHH TG  WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYEWML+AL L
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 478
           R VHIWDFARVNFVRTLLSKRKLQWMVDK LVSNWDDPRFPT        M++EGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538
           LSQGPSRNVINLEWN+IWAFNKKVIDP APRHTAVVNP K+HL G + P+T KIEMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598
           KKNP VGEKKV++ K+I++DKEDADV+E  EE TLMDWGN IITKK+A+ S+ AK+HLEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEG 599

Query: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658
           DFKKT HK+TWLADT+DVV VDLVDFDHL++KD++EE ESFEDFLT +TEFHTSAIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706
           VK+MK+GD IQFERKGY+RLDSLPK+G PYVFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  233 bits (594), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 254/486 (52%), Gaps = 47/486 (9%)

Query: 172 KKNASAGKKKETHKANFEIDL----------PD-------AKIGEVVTRFPPEPSGYLHI 214
           KK+A+AG K+      F  DL          P+       A  G V TRFPPEP+GYLHI
Sbjct: 206 KKDATAGPKRTMFSEGFLGDLHTVEDNPQNNPEHLVNHLKATHGLVHTRFPPEPNGYLHI 265

Query: 215 GHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDY 274
           GH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI+  +  LG    ++TYSSDY
Sbjct: 266 GHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESIIRMVNWLGFHPWKITYSSDY 325

Query: 275 FQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDGI------ASARRDRTVEENLRIF 325
           F ++Y+L  +LI +G  Y  +   E+++  R    DG       A   R R+VEENL  F
Sbjct: 326 FDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPGGERHACKHRSRSVEENLTEF 385

Query: 326 TEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVP 385
             +MK+G  +  +  +R K D ++ +  + D + YR    PH RTG  W++YPTYDF   
Sbjct: 386 -RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGNKWRIYPTYDFTHC 444

Query: 386 IVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWMV 445
           +VD+ E +TH+L T E+      YEW+ + + + +    ++ R+N   T+LSKRK+  +V
Sbjct: 445 LVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQREYGRLNITGTVLSKRKIAKLV 504

Query: 446 DKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNIIWAFNKKVIDP 505
           D+  V  WDDPR  T        +    + +F+ + G + +V N++     +  +K ++ 
Sbjct: 505 DEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSVTNIQLVRFESAIRKYLED 564

Query: 506 VAPRHTAVVNPVKIHLTGEDAPET-PKIEMKPKHKKNPAVGEKKVIYYKDIVVDKEDADV 564
             PR   +++PV++ +  ++ P++   +   P     P  GE++V + K + +D+ D   
Sbjct: 565 TTPRLMFILDPVEVVV--DNVPDSFEDVVSIPFRPGTPEFGEREVPFTKRVFIDRSDFSE 622

Query: 565 IEVNEE---------VTLMDWGNIIITK---KNADGSMEAKVHL----EGDFKKTAHKLT 608
              ++E         V L+   + +I K   K++DG +  K+H+    EG  KK    + 
Sbjct: 623 NASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKI-TKIHVHYDTEGKIKKPKTYIQ 681

Query: 609 WLADTE 614
           W+  +E
Sbjct: 682 WVPLSE 687

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  233 bits (593), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/375 (35%), Positives = 211/375 (56%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDG------ 308
           +  LG K  ++TYSSDYF ++Y+L   LIK G  Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 309 IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RDR++EE L  F  +M+NG  +  +  +R K D ++ +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++PV++ L    ED  E  KI  +P    +P  GE
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRP---GSPEFGE 607

Query: 547 KKVIYYKDIVVDKED 561
           ++V + K   +++ D
Sbjct: 608 REVPFTKRFFIERSD 622

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  231 bits (590), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 208/375 (55%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDGI----- 309
           +  LG K  ++TYSSDYF E+Y L   LIK G AY      E+++  R    DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RD+++E+NL+ F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  W++YPTYDF   +VD++E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++PV++ +    +D  E   I  +P     P  GE
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRP---GTPEFGE 605

Query: 547 KKVIYYKDIVVDKED 561
           + V +     +++ D
Sbjct: 606 RTVPFTNKFYIERSD 620

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  229 bits (584), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 206/375 (54%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDG------ 308
           +  LG    ++TYSSDYF E+Y L   LIK G  Y      E+++  R    DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 309 IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RD+++E NL+ F  +M++G  +  +  +R K D ++ +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD++E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++PV++ +    +D  E   I  +P     P  GE
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRP---GTPEFGE 606

Query: 547 KKVIYYKDIVVDKED 561
           + V +     +++ D
Sbjct: 607 RTVPFTNRFYIERSD 621

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  228 bits (581), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 136/377 (36%), Positives = 207/377 (54%), Gaps = 18/377 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++YDL   LIK    Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A A R R +EE+L  F  +MK+G  E  K  +R K D  + N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  W++YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ H V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++        +K ++   PR   +++P++I +    ED  E   I   P  KK    G+
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNLAEDYEEIVSI---PYSKK---FGD 599

Query: 547 KKVIYYKDIVVDKEDAD 563
           + V + K I ++++D D
Sbjct: 600 RTVPFTKRIYIERKDFD 616

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  226 bits (577), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 137/419 (32%), Positives = 222/419 (52%), Gaps = 22/419 (5%)

Query: 154 DPLFGTVHEFLTKSLQELKKNASAGKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLH 213
           DP     +E   K L ++ +N  A    E  K + E+       G+V TRFPPEP+GYLH
Sbjct: 213 DPKRTMFNEGFLKDLHKVGENPQA--YPELMKKHLEVTG-----GKVRTRFPPEPNGYLH 265

Query: 214 IGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSD 273
           IGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   +  LG K  ++TYSSD
Sbjct: 266 IGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRMVSWLGFKPWKITYSSD 325

Query: 274 YFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDG------IASARRDRTVEENLRI 324
           YF E+Y L   LI  G  Y   C     ++ R  + DG       A   RD+++E NL+ 
Sbjct: 326 YFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGERFACKHRDQSIELNLKE 385

Query: 325 FTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCV 384
           F  +M++G  +  +  +R K D ++ +  + D + YR    PH RTG  WK+YPTYDF  
Sbjct: 386 F-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGTKWKIYPTYDFTH 444

Query: 385 PIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWM 444
            +VD++E +TH+L T E+      YEW+ + +H+ +    ++ R+N   T+LSKRK+  +
Sbjct: 445 CLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAQL 504

Query: 445 VDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNIIWAFNKKVID 504
           VD+  V  WDDPR  T        +    + +F+ + G + +  N++     +  +K ++
Sbjct: 505 VDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVIRFESAVRKYLE 564

Query: 505 PVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGEKKVIYYKDIVVDKED 561
              PR   V++P+++ +    +D  E   I  +P   +    GE+ V +     +++ D
Sbjct: 565 DTTPRLMFVLDPIEVVVDNLPDDYEELAIIPFRPGTSE---FGERTVPFTNKFYIERSD 620

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  226 bits (575), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 164/547 (29%), Positives = 273/547 (49%), Gaps = 63/547 (11%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDG------ 308
           +  LG +  ++TYSSDYF ++YDL   LIK G AY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 309 IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
           +A   RDR +EENL  F  +M++G  +  +  +R K D ++ +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++    R   V++PV+I +    ED  E   I  +P     P  G+
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTIPYRPG---TPEFGD 601

Query: 547 KKVIYYKDIVVDKED----ADVIEVNEEVTLMDWGNIII--------TKKNADGSMEAKV 594
           + V + K   +++ D    AD  E          G I +          +++DG +  ++
Sbjct: 602 RTVPFTKKFFIERSDFSEAADDKEFFRLTPTQPVGLIKVPYTVSFQSVDRDSDGKI-VRI 660

Query: 595 HLEGD-----FKKTAHKLTWLA-DTEDVVPVDLVD---FDHLI-SKDKLEEDESFEDFLT 644
           H++ D      KK    + W+    +   PV + +   ++ L  S++     E + + + 
Sbjct: 661 HVKYDNDQAKAKKPKAYIQWVPFSAKHNSPVTISETRVYNQLFNSENPSSHPEGYLNDIN 720

Query: 645 PETEF-HTSAIADLNV----------------------KEMKVGDVIQFE--RKGYFRLD 679
           PE+E  +T ++ + N                       +E    +V +F+  R GYF LD
Sbjct: 721 PESEIVYTKSLVEHNFDHVIKNSPWVVNSVKESPFYVEEEKDRKEVCRFQAMRVGYFTLD 780

Query: 680 SLPKDGK 686
              +DGK
Sbjct: 781 KDSEDGK 787

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  224 bits (572), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/384 (34%), Positives = 208/384 (54%), Gaps = 15/384 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKNM 304

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++Y+L   LI    AY   C     ++ R  + DG      
Sbjct: 305 VAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPGGER 364

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   R R+VEENL  F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 365 RACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNAPHP 423

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++H V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   +++PV++ +    +D  E  KI  +P     P  GE
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRP---GTPEFGE 600

Query: 547 KKVIYYKDIVVDKEDADVIEVNEE 570
           + V + K   +++ D      N+E
Sbjct: 601 RSVPFTKKFYIERSDFSEATGNKE 624

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  224 bits (571), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 205/375 (54%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI----- 309
           +  LG K  ++TYSSDYF ++Y+L   LI+    Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RDR VEE+L+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++P+++ +    ED  E   I  +P     P  GE
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYEEIASIPYRP---GTPEFGE 606

Query: 547 KKVIYYKDIVVDKED 561
           + V + K   +++ D
Sbjct: 607 RNVPFTKKFYIERSD 621

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  224 bits (571), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 191/334 (57%), Gaps = 10/334 (2%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSI 254
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDG--- 308
              +  LG +  ++TYSSDYF ++Y+L   LIK G  Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 309 ---IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLT 365
                   R+ ++E+NL  F E MK G  +  +  +R K D+++ +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 366 PHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
           PH RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 426 FARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 486 NVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKI 519
           +V N++     +  +K ++   PR   V++P+++
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEV 578

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  224 bits (570), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 204/375 (54%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDG------ 308
           +  LG +  ++TYSSDYF E+Y L   LI     Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 309 IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RD+ +E NL+ F   M++G  +  +  +R K D ++ +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD++E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++P+++ +    +D  E   I  +P     PA GE
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYRP---GTPAFGE 605

Query: 547 KKVIYYKDIVVDKED 561
           + V +     +++ D
Sbjct: 606 RTVPFTNKFYIERSD 620

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  222 bits (566), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/378 (34%), Positives = 205/378 (54%), Gaps = 15/378 (3%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSI 254
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDG--- 308
              +  LG    ++TYSSDYF ++Y+L   LIK G  Y      E++R  R    DG   
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 309 ---IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLT 365
              +  A R+R +EENL  F   M++G     +  +R K D ++ +  + D V YR    
Sbjct: 362 GERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 366 PHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
           PH RTG+ W++YPTYDF   +VD+LE +TH+L T E+      YEW+ + +H+ +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 426 FARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 486 NVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPA 543
           +  N++     +  +K ++    R   V++P+++ +    ED  E   I  +P     P 
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSIPYRP---GTPE 597

Query: 544 VGEKKVIYYKDIVVDKED 561
            GE+ V + K   +++ D
Sbjct: 598 FGERTVPFSKRFYIERSD 615

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/450 (32%), Positives = 230/450 (51%), Gaps = 35/450 (7%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSI 254
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI-- 309
              +  LG    ++TYSSDYF ++YDL   LI     Y   C     ++ R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 310 ----ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLT 365
               A   R  ++E NL+ F   M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 366 PHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
           PH RTG  WK+YPTYDF   +VD+ E +TH+L T E+R     YEW+ + +H+ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 426 FARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +VD+H V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 486 NVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPA 543
           +  N++        +K ++   PR   +++P++I +    ED  E   I   P     P 
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVDNLPEDYEEILSI---PYRAGTPE 606

Query: 544 VGEKKVIYYKDIVVDKED-ADVIEVNEEVTLMDWGNIIITK-----------KNADGSME 591
            G++ V + K   +++ D ++V +  E   L    N+ + K           K+++G + 
Sbjct: 607 FGDRTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQNVGLIKVPHTVSFKSVEKDSNGKI- 665

Query: 592 AKVHL-------EGDFKKTAHKLTWLADTE 614
            K+H+       EG  KK    + W+  +E
Sbjct: 666 TKIHVHYNNEAQEGKPKKPKTYIQWVPVSE 695

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 122/340 (35%), Positives = 193/340 (56%), Gaps = 12/340 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDGI----- 309
           +  LG K  +VTYSSDYF ++Y+L   LIK G  Y      E+++  R    DG      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RD++VE+NL  F   M++G  +  +  +R K +  + +  + D + YR    PH 
Sbjct: 361 HACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+H V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPE 528
           N++     +  +K ++   PR   +++P+++ +  E+ PE
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEVVV--ENLPE 577

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 204/384 (53%), Gaps = 15/384 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREERM---------DG 308
           +  LG K  ++TYSSDYF ++Y+L   LI     Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 309 IASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   R+R +EENL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   +++P+++ +    +D  E   I  +P     P  GE
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYRP---ATPEFGE 606

Query: 547 KKVIYYKDIVVDKEDADVIEVNEE 570
           + V +     +++ D      N+E
Sbjct: 607 RNVPFTNKFYIERSDFSEDSSNKE 630

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  221 bits (562), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 205/375 (54%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREER---MDGI----- 309
           +  LG K  ++TYSSDYF ++Y+L  +LI  G AY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   R R+VEENL  F  +M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V++H V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   V++PV++ +    ED  E   +  +P     P  GE
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTVPYRP---GTPEFGE 600

Query: 547 KKVIYYKDIVVDKED 561
           ++V +     +++ D
Sbjct: 601 RQVPFTGKFYIERSD 615

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  220 bits (561), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/375 (33%), Positives = 200/375 (53%), Gaps = 15/375 (4%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI----- 309
           +  LG    ++TYSSDYF ++YDL   LI  G  Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   RDR +EENL+ F   M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 489 NLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHL--TGEDAPETPKIEMKPKHKKNPAVGE 546
           N++     +  +K ++   PR   +++P+++ +    +D  E   I   P     P  GE
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTI---PYRAGTPEFGE 610

Query: 547 KKVIYYKDIVVDKED 561
           + V +     +++ D
Sbjct: 611 RTVPFTNKFFIERSD 625

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  215 bits (548), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 185/334 (55%), Gaps = 10/334 (2%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSI 254
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI-- 309
              +  LG K  +VTYSSDYF ++Y+L   LIK    Y   C     ++ R  + DG   
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 310 ----ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLT 365
               A   RDR +EE+L+ F   M+ G  +  +  +R K D  + +  + D + YR   +
Sbjct: 368 GERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 366 PHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
           PH RTG  WK+YPTYDF   +VD+ E ++H+L T E+      YEW+ + +H+ +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 426 FARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 486 NVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKI 519
           +  N++     +  +K ++   PR   +++P+++
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEV 580

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  214 bits (546), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 204/378 (53%), Gaps = 15/378 (3%)

Query: 195 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSI 254
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 255 LEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI-- 309
              +  LG K  ++TYSSDYF ++YDL   LI+    Y   C     ++ R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 310 ----ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLT 365
               + + R+R++ ENL  F  +M++G  +  +  +R K D  + +  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 366 PHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
           PH RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ + +H+ +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 426 FARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 485
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 486 NVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTG--EDAPETPKIEMKPKHKKNPA 543
              N++     +  +K ++    R   +++P+++ +    ED  E   I  +P     P 
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVVNNLPEDYQELVTIPYRP---GTPE 603

Query: 544 VGEKKVIYYKDIVVDKED 561
            G++ V + K   +++ D
Sbjct: 604 FGDRTVPFTKRFYIERTD 621

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  212 bits (540), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 119/321 (37%), Positives = 179/321 (55%), Gaps = 10/321 (3%)

Query: 198 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILED 257
           G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 249 GKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESIKSM 308

Query: 258 LELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGI----- 309
           +  LG K  + TYSSDYF E+Y L   LIK G AY   C     ++ R  + DG      
Sbjct: 309 VSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPGGER 368

Query: 310 -ASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHH 368
            A   R+R +EE+L  F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 369 KACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHP 427

Query: 369 RTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFAR 428
           RTG  WK+YPTYDF   +VD+LE +TH+L T E+      YEW+ + +H+ +    ++ R
Sbjct: 428 RTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 487

Query: 429 VNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 488
           +N   T+LSKRK+  +V    VS W+DPR  T        +    + +F+ + G + +  
Sbjct: 488 LNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 547

Query: 489 NLEWNIIWAFNKKVIDPVAPR 509
           N++     +  +K ++   PR
Sbjct: 548 NIQVVRFESAIRKYLEDTTPR 568

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 108/248 (43%), Gaps = 28/248 (11%)

Query: 167 SLQELKKNASAGKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYF 226
           SL+   +  +A  +     +   +D+    +  VVTRF P P+G LH+G  + AL N   
Sbjct: 10  SLRPHIRRYTAAARPTLVSSQLRVDI--HPVAPVVTRFAPSPTGLLHLGSLRTALYNYLL 67

Query: 227 AQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELLGIKGDRVTY-SSDYFQE-MYD-LCV 283
           A+   GK I+R +DT+  +   E + +IL+ L+   IK D   Y  SD  +E +Y     
Sbjct: 68  AKNTGGKFILRLEDTDRKRYHAEAEQNILDTLDWCHIKWDGPMYRQSDRAREGLYTRYAE 127

Query: 284 QLIKEGGAY---CDDTPTEKMREERMDGIASARRDRTVEEN------LRIFTEEMKNGTE 334
           QL+K G AY   C       +REE  D   +   D+ V         +R    E+ +  +
Sbjct: 128 QLVKGGFAYKCFCSKERLNNLREEGYDRHCTHLSDQEVNAFQGTPYVIRFKAPEVYDAVD 187

Query: 335 EGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVT 394
           + L   VR  I          DPV+ + +             +PTY     + D L GVT
Sbjct: 188 DLLHGSVR--IQPRRDRHGFDDPVLLKSD------------RFPTYHLANVVDDHLMGVT 233

Query: 395 HALRTIEY 402
           H +R  E+
Sbjct: 234 HVIRGEEW 241

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 108/262 (41%), Gaps = 35/262 (13%)

Query: 201 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLEL 260
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 261 LGIKGDRVTYSSDYFQEMYDLCVQLIKEGGA----YCDDTPTEKMREERMDGIASARRDR 316
            GI  D           +Y   ++++ + GA    +C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 317 TVEENLRIFTEEMKNGTEEGLKNCVRAKID--YAALNKTLRDPVIYRCNLTPHHRTGATW 374
                  + TE +++     L   +R K    Y      L   V  + N     +    W
Sbjct: 163 NC---YHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLN----QKERGVW 215

Query: 375 ---------KMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWD 425
                      YPTY F   + D L G+TH +R  E+     ++      + L ++  WD
Sbjct: 216 FDDPILIKSDGYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQLFGWD 269

Query: 426 FARVNFVRTL-------LSKRK 440
             +   +  L       LSKRK
Sbjct: 270 MPKFIHIPLLTSIDDKKLSKRK 291

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 99/219 (45%), Gaps = 26/219 (11%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 260 LLGIKGDRVTYSSDYFQEMYDLCV-QLIKEGGAYCDDTPTEKMREERMDGIA--SARRDR 316
              ++ D           +Y   + +L+K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 317 TVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIY-----RCNLTPHHRTG 371
                + +  E +K   ++G+   +R K          R P+I+       N+ P++R G
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG 215

Query: 372 ATW--------KMYPTYDFCVPIVDALEGVTHALRTIEY 402
             +          +PTY F   + D L  VTH +R  E+
Sbjct: 216 MWFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 120/275 (43%), Gaps = 48/275 (17%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +     ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 260 LLGIKGDR---------VTYSSDYFQEMYDLCVQLIKEGG----AYCDDTPTEKMRE--E 304
             GI+ D            +      ++Y   ++++ E G     +C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 305 RMDGIASARRDRTV----EE------------NLRIFTEEMKNGTEEGLKNCVRAKIDYA 348
           +++  +SA  DR      EE             +R+ + E     E+ L   +  +I Y 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQYN 225

Query: 349 ALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQ 408
              KT  DP++ + +              PTY F   + D L  +TH +R  E+     +
Sbjct: 226 PHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPK 273

Query: 409 YEWMLNALHLRK---VHIWDFARVNFVRTLLSKRK 440
           +  M NAL  +    +HI     +N  +  LSKRK
Sbjct: 274 HISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 139/352 (39%), Gaps = 62/352 (17%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYDLCVQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 313
              I  D         + +YD  V+ L+  G AY      E++ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 314 RDRTVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYAALNKTLRDPVIYRCNLTPHHRTG 371
            DR       +  EE+++   + +   VR K    Y      L   +    NL P  +  
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQYPTFTDVLHGEI----NLQP--QVN 215

Query: 372 ATWKMY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420
              + Y           PTY     + D L G+TH +R  E+     ++  + NA     
Sbjct: 216 YNDRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 421 VHIWDFARVNFVRTL-------LSKRKL---------QWMVDKHLVS-----NWDDPRFP 459
              WD+ +   +  L       LSKRK          Q ++ + LV+      W  PR  
Sbjct: 273 ---WDYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR-- 327

Query: 460 TXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNIIWAFNK-----KVIDPV 506
                     ++E L       G ++    ++   +W FNK     ++ DPV
Sbjct: 328 DLASKKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 100/234 (42%), Gaps = 24/234 (10%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYDLCVQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 313
              I  D         + +YD  V+ L+  G AY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 314 RDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHHRTGAT 373
            DR       +  EE+K+   +G+   VR K        T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFK--SPERYPTFTDLLHGQINLQP--QVNFN 217

Query: 374 WKMY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL 416
            K Y           PTY     + D L G+TH +R  E+     ++  + NA 
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAF 271

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 130/327 (39%), Gaps = 58/327 (17%)

Query: 140 VYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKKETHKANFEIDLPDAKIGE 199
           + + + R +  L + P  G     L KSL       S   K++ H ++            
Sbjct: 2   ILLRIPRRFYCLSLKPTKGVGPSSLNKSL------LSRKTKEDIHPSS-----------P 44

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 260 LLGIKGDRVTYSSDYFQEMYDLCVQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 313
              I  D         + +YD  V+ L+  G AY      E++ E R   +     + A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 314 RDRTVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYAALNKTLRDPVIYRCNLTPHHRTG 371
            DR       +  EE+ +   +G+   VR K    Y      L   +    NL P  +  
Sbjct: 165 YDRCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYPLFADLLHGEI----NLQP--QVN 215

Query: 372 ATWKMY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420
              + Y           PTY     + D L G+TH +R  E+     ++  + NA     
Sbjct: 216 FNDRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 421 VHIWD---FARVNFVRTL----LSKRK 440
              WD   F  +  + T+    LSKRK
Sbjct: 273 ---WDCPKFIHIPLLTTVGDKKLSKRK 296

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 99/231 (42%), Gaps = 31/231 (13%)

Query: 197 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILE 256
           I  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +   + +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 257 DLELLGIKGD-------------RVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKM-- 301
            L+  GI  D             R +  +  +Q+  D   +L+  G AY    P E++  
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYID---KLLDNGHAYRCFCPKERLDS 154

Query: 302 ---REERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKID--YAALNKTLRD 356
                +++    +   DR     L +  +E++N    G+   VR K    Y   +  L  
Sbjct: 155 LRDSAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHG 211

Query: 357 PVIYRCNLTPHHRTGATWKM-----YPTYDFCVPIVDALEGVTHALRTIEY 402
            +  +  +  + R      +      PTY F   I D L  +TH +R  E+
Sbjct: 212 HINIQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 99/234 (42%), Gaps = 43/234 (18%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +     +++I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 260 LL---------GIKGDRVTYSSDYFQEMYDLCV-QLIKEGGAY---CDDTPTEKMRE--E 304
            L         GI G    Y       +Y   + +L+  G AY   C       ++E  +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 305 RMDGIASARRDR--------TVEENL--------RIFTEEMKNGTEEGLKNCVRAKIDYA 348
           ++    +A  DR         +EENL        R+ + ++    E+ L   +  +  Y 
Sbjct: 164 KLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQPQYN 223

Query: 349 ALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEY 402
           ++++   DPV+ + +              PTY F   + D L  ++H +R  E+
Sbjct: 224 SIDRRFDDPVLMKSD------------NLPTYHFANVVDDHLMKISHVIRGEEW 265

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 101/228 (44%), Gaps = 31/228 (13%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++     +++I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 260 LLGIKGD-------------RVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMRE 303
             GI+ D             R +  ++ +Q+  D    L+K G AY   C     + +RE
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVD---GLLKSGHAYRCFCSKERLDGLRE 157

Query: 304 --ERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKID--YAALNKTLRDPVI 359
             +R+    +   DR  E    +   E++    + + + +R K    Y A +  L   V 
Sbjct: 158 SAKRLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVD 214

Query: 360 YRCNLTPHHRTGATWKM-----YPTYDFCVPIVDALEGVTHALRTIEY 402
            +  +  + R      +      PTY F   I D L  +TH +R  E+
Sbjct: 215 IQPQVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 91/215 (42%), Gaps = 16/215 (7%)

Query: 201 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLEL 260
           VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K    D+I   L+ 
Sbjct: 47  VTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLKW 106

Query: 261 LGIKGDRVTYSSDYFQEMYDLCV-QLIKEGGAY---CDDTPTEKMREE--RMDGIASARR 314
             +K D   Y      ++Y   +  LI+ G AY   C     + +R+   R+    +   
Sbjct: 107 CNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVSY 166

Query: 315 DRTVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYAALNKTLRDPVIYRCNLTPHH-RTG 371
           DR       +   E+K+  ++G+   VR K    Y      L   +  +    P   R  
Sbjct: 167 DRHCAH---LSEGEIKSKLDQGIPFTVRFKAPEKYPPFEDLLHGKIDLQPQQNPSDIRYD 223

Query: 372 ATWKM----YPTYDFCVPIVDALEGVTHALRTIEY 402
               M    YPTY     I D    ++H +R  E+
Sbjct: 224 DPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEW 258

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 95/233 (40%), Gaps = 31/233 (13%)

Query: 199 EVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDL 258
            VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K+  +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 259 ELLGIKGD-RVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERMDGIASARR 314
               +K D      SD      +   +L++ G AY   C       MR    D       
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 315 DRTVEE---------NLRIFTEEMKNGTEEGLKNCV--RAKIDYAALNKTLRDPVIYRCN 363
           D  V            LR+ +    +  ++ L   V  + + D    +    DP++ + +
Sbjct: 159 DNDVRRLFDAGHTRPVLRLKSPNKYDSFQDMLHGTVNIQERKDRVGFD----DPILMKSD 214

Query: 364 LTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL 416
                        +PTY F   + D L  VTH +R  E+     ++  +  AL
Sbjct: 215 ------------GFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 130/344 (37%), Gaps = 57/344 (16%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 260 LLGIKGDRVTYSSDYFQEMYDLCVQLIKEGG----AYCDDTPTEKMREERMD--GIASAR 313
              I+ D         + +YD  V+++   G     +C       +R   M+    + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 314 RDRTVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYAALNKTLRDPVIYRCNLTPHHRTG 371
            DR       +  EE+ +   +G+   VR K    Y      L   V    NL P  +  
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--QVN 215

Query: 372 ATWKMY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRK 420
              K Y           PTY     + D L G+TH +R  E+     ++  + NA     
Sbjct: 216 FNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 421 VHIW---DFARVNFVRTL----LSKR---------KLQWMVDKHLVS-----NWDDPRFP 459
              W    F  +  + T+    LSKR         K Q ++ + L++      W  PR  
Sbjct: 273 ---WVCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR-- 327

Query: 460 TXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNIIWAFNKKVI 503
                     ++E L N     G ++    ++   +W FNK  +
Sbjct: 328 DLASKRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 99/235 (42%), Gaps = 50/235 (21%)

Query: 202 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELL 261
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +  ++ + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 262 GIKGD------------RVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREERM 306
           GI+ D            R +  S  ++   D   +L+  G AY   C     E +R   M
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHAD---KLLASGHAYRCFCSKERLENLRTSAM 161

Query: 307 --------------DGIASARRDRTVEENLRIFTEEMKN-GTEEGLKNCVRAKIDYAALN 351
                           ++    D  +++N+  FT   K+    E  ++ +  ++D     
Sbjct: 162 ALQPPTNVSYDRECANLSQEHIDHKLDQNVP-FTLRFKSPAVYEPFEDLLHGRVDLQPQT 220

Query: 352 KT--LR--DPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEY 402
               +R  DPV+ + +              PTY F   + D L  +TH +R  E+
Sbjct: 221 NPNDIRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 98/241 (40%), Gaps = 33/241 (13%)

Query: 202 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELL 261
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 262 GI-----------------KGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMRE- 303
           G+                 + DR      Y  ++ DL V        +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 304 -ERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYAALNKTLRDPVIY 360
            +++    +   DR    +    TE+++   ++ +   VR K    Y      L   +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDM 226

Query: 361 RCNLTPH-HRTGATWKM----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNA 415
           +  + P+  R      M     PTY F   + D L  +TH +R  E+     ++  + NA
Sbjct: 227 QPQVNPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEWLPSTPKHIALYNA 286

Query: 416 L 416
            
Sbjct: 287 F 287

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 103/249 (41%), Gaps = 48/249 (19%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 260 LLGIKGD------------RVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMREE 304
              IK D            R +  +  +QE  +    L+++G AY   C     + +RE 
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYIN---TLVEKGDAYKCFCSKERLDALRES 167

Query: 305 ----------RMDGIASARRDRTVEENLRI---FTEEMKNGTE-EGLKNCVRAKIDYA-- 348
                       D   S   D+ VE NL+    FT   K+  +    ++ +  K+D    
Sbjct: 168 AQKLQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQ 227

Query: 349 --ALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRN 406
              L+    DP++ + +              PTY F   I D L  +TH +R  E+    
Sbjct: 228 VNPLDIRYDDPILMKSD------------NLPTYHFANVIDDHLMKITHVIRGEEWLPST 275

Query: 407 AQYEWMLNA 415
            ++  +  A
Sbjct: 276 PKHTALYEA 284

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 48/234 (20%)

Query: 202 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELL 261
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +  + L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 262 GIKGD------------RVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMREERMDGI 309
           GI+ D            R +  ++ +++  D   QLI  G AY      E+++  R   +
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSD---QLISTGHAYRCFCSKERLKGLRDSAM 178

Query: 310 A-----SARRDR----------------TVEENLRIFTEEMKNGTEEGLKNCVRAKIDYA 348
           A     +   DR                 V   +R+ + E+    E+ L N +  +    
Sbjct: 179 ALKPPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQIN 238

Query: 349 ALNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEY 402
            ++    DP++ + +              PTY F   I D L  +TH +R  E+
Sbjct: 239 PIDVRYDDPILIKSS------------GLPTYHFAHVIDDHLMEITHVIRGQEW 280

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 104/251 (41%), Gaps = 49/251 (19%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLE 259
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 260 LLGIKGDR---------VTYSSDYFQEMYDLCV-QLIKEGGAY---CDDTPTEKMRE--E 304
             G++ D            Y      E+Y   + QL+  G AY   C     + +R   +
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCSKERLDGLRSSAQ 180

Query: 305 RMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAK----------IDYAALNKTL 354
           ++    +A  DR   E   +  +E+    ++G+   VR K          + +  L+  +
Sbjct: 181 QLQPPTTASYDRHCTE---LTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLDMQI 237

Query: 355 R---------DPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDR 405
           +         DP++ + +              PTY F   + D L  +TH +R  E+   
Sbjct: 238 QINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEWLPS 285

Query: 406 NAQYEWMLNAL 416
             ++  + NA 
Sbjct: 286 TPKHIALYNAF 296

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 94/226 (41%), Gaps = 31/226 (13%)

Query: 202 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELL 261
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 262 GIKGD-------------RVTYSSDYFQEMYDLCVQLIKEGGAY---CDDTPTEKMRE-- 303
           GI  D             R +  ++ +Q+  +   +L+  G AY   C     + +RE  
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTN---KLLDSGHAYRCFCTKERLDGLRESA 163

Query: 304 ERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKID--YAALNKTLRDPVIYR 361
           +++    +A  DR       +   E++   ++ +   +R K    Y      L   +  +
Sbjct: 164 QKLQPPTTASYDRHCSH---LSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQ 220

Query: 362 CNLTPHHR-----TGATWKMYPTYDFCVPIVDALEGVTHALRTIEY 402
             + P+ R             PTY F   + D L  +TH +R  E+
Sbjct: 221 PQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEW 266

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 98/247 (39%), Gaps = 42/247 (17%)

Query: 200 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDL- 258
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+     +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 259 -------ELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGG----AYCDDTPTEKMRE--ER 305
                  E   + G    Y      E+Y   +  + E G     +C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 306 MDGIASARRDR--------TVEENL--------RIFTEEMKNGTEEGLKNCVRAKIDYAA 349
           +    +A  DR         +++NL        R+   E     ++ L   +  +    A
Sbjct: 160 LQPPTTASYDRHCAHMSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQVNA 219

Query: 350 LNKTLRDPVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY 409
            +    DP++ + +              PTY F   I D L  +TH +R  E+     ++
Sbjct: 220 NDVRYDDPILVKSD------------NLPTYHFANVIDDHLMEITHVIRGEEWLPSTQKH 267

Query: 410 EWMLNAL 416
             + NA 
Sbjct: 268 LAIYNAF 274

>TPHA0C00680 Chr3 complement(128269..130368) [2100 bp, 699 aa] {ON}
           Anc_8.347 YLR141W
          Length = 699

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 7/77 (9%)

Query: 159 TVHEFLTKSLQE-LKKNASAGKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHA 217
           T ++ L K+L E LK+N +A  K+E     +E+D    K+ E +TR  P+      IGHA
Sbjct: 128 TYYDLLKKNLDEMLKENKTALIKREDIPIAYEMDEFYIKVEERITRIIPD-----RIGHA 182

Query: 218 KAALLNQYFAQAYKGKL 234
           K  ++N  F +  K KL
Sbjct: 183 KKVVVNP-FVEKPKRKL 198

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 171 LKKNASAGKK--KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQ 228
           +KK  + GKK  ++T +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 229 AYKGK 233
            YK +
Sbjct: 80  FYKQR 84

>Kpol_480.20 s480 (47609..49249) [1641 bp, 546 aa] {ON}
           (47609..49249) [1641 nt, 547 aa]
          Length = 546

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 387 VDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWMVD 446
           +D LE     L+ ++ R     YE  L   HL+K+H++DF     V++  +   L+ M+ 
Sbjct: 131 IDKLE----VLQIMDIRLSQIFYELYLELTHLKKIHLFDFEDRVQVKSFANCNSLRLMLQ 186

Query: 447 KHLVSN 452
            H  SN
Sbjct: 187 NHTSSN 192

>Ecym_6164 Chr6 complement(301696..302592) [897 bp, 298 aa] {ON}
           similar to Ashbya gossypii AFL012C
          Length = 298

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 11/97 (11%)

Query: 285 LIKEGGAYCDDTPTEKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRA- 343
           L  EGG   D     ++ EE+   I +    R   E +R F+E+     ++GL N V A 
Sbjct: 133 LAAEGG---DGDGARRLEEEQSLFIETCNESRLTSEKVRAFSEDAV--LQQGLVNAVIAR 187

Query: 344 --KIDYAALNKTLRDPVIYRCNLTPHHRTGATWKMYP 378
             KI    + K+LR+   +   L+P  R GA +  YP
Sbjct: 188 YLKIGDYLMFKSLREQNYF---LSPGARFGARFIAYP 221

>Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa]
           {ON} YBL066C (SEF1) - putative transcription factor
           [contig 33] FULL
          Length = 1046

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 80/184 (43%), Gaps = 24/184 (13%)

Query: 183 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 242
           T + ++ I++  A++GE     P      + + + +A L N        G  I+  D   
Sbjct: 512 TSQTDYLIEM--ARLGEDENSVPNRFRQLICLANFQAKLCNMM------GSSIVSPDGLM 563

Query: 243 PSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMR 302
            ++E+      +  +L+ L IK   + +  D   EMY L V+L+    A+   TPTE   
Sbjct: 564 DARERAGALAILERELKRLNIK---LNFEKDTVVEMYYLYVKLMICCFAFLPGTPTEDQS 620

Query: 303 EERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRC 362
           +   +   S+ +  T      + T+ ++N     L   VR  + Y+AL       ++++ 
Sbjct: 621 KYVTEAYLSSTKVVT------LLTKLLENTKLIQLPIYVRQSVTYSAL-------ILFKL 667

Query: 363 NLTP 366
           +LTP
Sbjct: 668 HLTP 671

>NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa]
           {ON} Anc_4.136 YLR320W
          Length = 1546

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 376 MYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVHIWDFARV--NFVR 433
           ++ +Y   V IV  L+   H    +E +  ++Q   ++  L   +  IW   R+  +F+ 
Sbjct: 786 LFESYHILVTIVQLLDRKQHLWEALEKQSYSSQIALIILNLFPTRKTIWSLLRIEPSFIS 845

Query: 434 TLL-------SKRKLQWMVDKHLVSNWD 454
            +        S  +  W+VDK L+ N D
Sbjct: 846 LVYTFKFIGYSTSQCNWIVDKDLIINLD 873

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,891,224
Number of extensions: 3619766
Number of successful extensions: 10862
Number of sequences better than 10.0: 74
Number of HSP's gapped: 11059
Number of HSP's successfully gapped: 74
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)