Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J028803.567ON55555523050.0
YGL244W (RTF1)3.567ON55853815350.0
Suva_7.173.567ON56954915240.0
NCAS0E002603.567ON55854015210.0
Smik_7.173.567ON56554515160.0
NDAI0I032403.567ON56354715110.0
Skud_7.233.567ON56454915100.0
ZYRO0E09526g3.567ON56054115050.0
TPHA0A060003.567ON54953514550.0
Kpol_507.103.567ON46146214200.0
SAKL0F00814g3.567ON57448114170.0
KLTH0G00726g3.567ON56147914000.0
Ecym_25973.567ON56247913940.0
Kwal_47.192653.567ON56753813830.0
AFR266W3.567ON56254913790.0
KNAG0I002303.567ON57132413570.0
TDEL0D063503.567ON56532112661e-169
CAGL0H07711g3.567ON56632211761e-155
TBLA0E002203.567ON57032211281e-148
KLLA0A00737g3.567ON58232310961e-143
TPHA0A022001.355ON37054705.5
Kpol_1054.581.530ON40161696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J02880
         (555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   892   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   595   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   591   0.0  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   590   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   588   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   586   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   586   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   584   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   565   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   551   0.0  
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   550   0.0  
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   543   0.0  
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   541   0.0  
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   537   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   535   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   527   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   492   e-169
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   457   e-155
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   439   e-148
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   426   e-143
TPHA0A02200 Chr1 complement(454420..455532) [1113 bp, 370 aa] {O...    32   5.5  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   6.8  

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/555 (82%), Positives = 456/555 (82%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXVLTTSKRTKQSGDSSANKKRRIXXXXXXXXXXYNPAAID 60
           MSDI                 VLTTSKRTKQSGDSSANKKRRI          YNPAAID
Sbjct: 1   MSDIDEDLLALAGADEEEEEEVLTTSKRTKQSGDSSANKKRRIESDSDEDEDDYNPAAID 60

Query: 61  GGDGAXXXXXXXXXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRER 120
           GGDGA             PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRER
Sbjct: 61  GGDGAYNENDDEEEYEENPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRER 120

Query: 121 QFFKDRNKNLKRQKERNEDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQ 180
           QFFKDRNKNLKRQKERNEDDEALKTRSSGRATHATGHTD            REKKNKSRQ
Sbjct: 121 QFFKDRNKNLKRQKERNEDDEALKTRSSGRATHATGHTDLKASKLSQLKKQREKKNKSRQ 180

Query: 181 YSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTEL 240
           YS                                 RKTAYK              RDTEL
Sbjct: 181 YSDYEEEEEEDEEEFEDEYREGSEYEEEEDYNPYERKTAYKDEEDEEVEWAEDTDRDTEL 240

Query: 241 NDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPY 300
           NDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPY
Sbjct: 241 NDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPY 300

Query: 301 SMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSK 360
           SMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSK
Sbjct: 301 SMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSK 360

Query: 361 SKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVA 420
           SKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVA
Sbjct: 361 SKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVA 420

Query: 421 KYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPIDK 480
           KYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPIDK
Sbjct: 421 KYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPIDK 480

Query: 481 SDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGL 540
           SDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGL
Sbjct: 481 SDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGL 540

Query: 541 EKMISGLNIEFDLGI 555
           EKMISGLNIEFDLGI
Sbjct: 541 EKMISGLNIEFDLGI 555

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 389/538 (72%), Gaps = 11/538 (2%)

Query: 22  VLTTSKRTKQSGDSSANKKRRI---XXXXXXXXXXYNPAAIDGGDGAXXXXXXXXXXXXX 78
           + TTS +  ++ D S +KKRRI             YNP ++   D               
Sbjct: 24  LTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNPYSVGNADYGSEEEEEAN----- 78

Query: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE 138
           PFPLEGKYK+E DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R +++K Q++R +
Sbjct: 79  PFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 138

Query: 139 DDE-ALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXX 197
           +DE + KTR+S R+THATGH+D            R +KN+    +               
Sbjct: 139 NDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYREEDYK 198

Query: 198 XXXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKFC 257
                             R T  K              R+ E++DFNKLRIGRSFVAKFC
Sbjct: 199 DDEGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAKFC 258

Query: 258 FYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGK 317
           FYP F + VKGCYGRVNVG DKRTG+TSYRMV+IER+FLQKPY+MGKF+TNQYFGVTQGK
Sbjct: 259 FYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGK 318

Query: 318 DRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLT 377
           DRKVFQM++FSDGL    EY+RY+R+L++S + KP++++L +K+KE++ FV+ PLT+K T
Sbjct: 319 DRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTT 378

Query: 378 NEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYE 437
           +E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQLRNFEKRM++YE
Sbjct: 379 DEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYE 438

Query: 438 KHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPFSRLKTRTKIYY 495
           KHHENDQ+  KKLG LTSKN+K+NM  +RNAEHVKKED      KSDPFSRLKTRTK+YY
Sbjct: 439 KHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKVYY 498

Query: 496 QEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDL 553
           QEIQKEEN +AK +AQQ+K++E+++A  ++EKELL+AQFRRLGGLE+M+  L+I+FDL
Sbjct: 499 QEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKFDL 556

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/549 (56%), Positives = 393/549 (71%), Gaps = 21/549 (3%)

Query: 22  VLT-TSKRTKQSGDSSANKKRRIXXXXXXXXXX-------YNPAAI-DGGDGAXXXXXXX 72
           VLT TS +  ++ D S +KKRRI                 YNP ++ + G G+       
Sbjct: 23  VLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYGSEEEEEVE 82

Query: 73  XXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKR 132
                 PFPLEGKYK+E DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R K++K 
Sbjct: 83  PN----PFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKE 138

Query: 133 QKERN---EDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXX 189
           Q++R    +D+++ KTR+S R+THATGH+D            R +KN+    S       
Sbjct: 139 QQQRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQ 198

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXXRKTAY---KXXXXXXXXXXXXXXRDTELNDFNKL 246
                                     RK  Y   +              RD E++DFNKL
Sbjct: 199 EEYREDDYKNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKL 258

Query: 247 RIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFF 306
           RIGRSFVAKFCFYP F ++VKGCYGRVNVG DKRTG+TSYRMV+IERIFLQKPY+MGKFF
Sbjct: 259 RIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFF 318

Query: 307 TNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVS 366
           TNQYFGVTQGKDRKVFQM++FSDGL T  EY+RY ++L+ SH+ KP+++TL +K+KE++ 
Sbjct: 319 TNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVID 378

Query: 367 FVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQL 426
           FV+ PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQL
Sbjct: 379 FVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQL 438

Query: 427 RNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPF 484
           RNFEKRM++YEKHHENDQ+  K LG LTSKN+K+N+  +RNAEHVKKED      KSDPF
Sbjct: 439 RNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPF 498

Query: 485 SRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMI 544
           SRLKTRTK+YYQEIQKEEN +AK +AQQ+K++E+ E+ +R+EKELLLAQFRRLGGLE+MI
Sbjct: 499 SRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMI 558

Query: 545 SGLNIEFDL 553
             L+I+FD 
Sbjct: 559 GELDIKFDF 567

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 389/540 (72%), Gaps = 10/540 (1%)

Query: 22  VLTTS-KRTKQSGDSSANKKRRIXXXXXXXXXXYNPAAIDGGDGAXXXXXXXXXXXXXPF 80
           VLTTS KR K    +S+ +K+            Y+P    G  GA             PF
Sbjct: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDP----GNFGAGNISEEEEEMEQNPF 78

Query: 81  PLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE-D 139
           PLEGKYK+E DR+ LESLPEMERET+L++RSQTMRKY+ER+ F++R +NLK Q++RN   
Sbjct: 79  PLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPS 138

Query: 140 DEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQ--YSXXXXXXXXXXXXXXX 197
           +E  KTR+S R THATGH+D            RE+K   R+                   
Sbjct: 139 EEGTKTRTSTRTTHATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEEEEEEYDEE 198

Query: 198 XXXXXXXXXXXXXXXXXXRKTAY-KXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKF 256
                             RK  Y +              R+TEL+DFNK++IGRSFVAK+
Sbjct: 199 EYKKDEDSEYEEEYNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKY 258

Query: 257 CFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQG 316
           CFYP F E++KGCYG+VNVG D+RTG TSYRMVKIE+IFLQKPY MG+FFTNQYFGVTQG
Sbjct: 259 CFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQG 318

Query: 317 KDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKL 376
            +RKVFQM+FFSDGL TP E+ERY+RSL++SHI KP++YTLK+K+KE+ SF+SEPLTE+L
Sbjct: 319 SNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQL 378

Query: 377 TNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMY 436
            + IVRNRM+FNKKLSGTNAVLEKTVL++KL+YA+E NNERDVAKYS+QLRN EKR+++Y
Sbjct: 379 MDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVY 438

Query: 437 EKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIYY 495
           EKHHENDQ GS KLGALTSKN+KVNMDK++N  H KKE++  D KSDPFSRLKTRTKIYY
Sbjct: 439 EKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYY 498

Query: 496 QEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLGI 555
           QE+Q+EENE+AKALA +K+++EN EA  RKE ELLLA+FRRLGGLE MI+ LN++ +  I
Sbjct: 499 QEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/545 (55%), Positives = 389/545 (71%), Gaps = 18/545 (3%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXX--------YNPAAIDGGDGAXXXXXXXX 73
           + TTS +  ++ D S +KKRRI                  YNP ++              
Sbjct: 24  LTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYSV-----GNASYGSEE 78

Query: 74  XXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQ 133
                PFPLEGKYKNE DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R +++K Q
Sbjct: 79  VEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQ 138

Query: 134 KERNEDDE-ALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXX 192
           ++R ++DE + KTR+S R+THATGH+D            R +KN+    +          
Sbjct: 139 QQRAKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDEY 198

Query: 193 XXXXXXXXXXXXXXXXXXXXXXXRKTAY--KXXXXXXXXXXXXXXRDTELNDFNKLRIGR 250
                                  R   Y  +              R+ E++DFNK+RIGR
Sbjct: 199 REDDYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPEISDFNKVRIGR 258

Query: 251 SFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQY 310
           SFVAKFCFYP F ++VKGCYGRVNVG DKRTG+TSYRMV+IER+FLQKPY+MGKF+TNQY
Sbjct: 259 SFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQY 318

Query: 311 FGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSE 370
           FGVTQGKDRKVFQM++FSDGL    EY+RY+R+L++S I KP++++L +K+KE++ FV+ 
Sbjct: 319 FGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNT 378

Query: 371 PLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFE 430
           PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQLRNFE
Sbjct: 379 PLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFE 438

Query: 431 KRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPFSRLK 488
           KRM++YEKHHENDQ+  KKLG LTSKN+K+NM  +RNAEHVKKED+     KSDPFSRLK
Sbjct: 439 KRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLK 498

Query: 489 TRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLN 548
           TRTK+YYQEIQKEEN +AK +AQQ+K++E++ A +++EKELLLAQFRRLGGLE+MI  L+
Sbjct: 499 TRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELD 558

Query: 549 IEFDL 553
           I+FD 
Sbjct: 559 IKFDF 563

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/547 (54%), Positives = 387/547 (70%), Gaps = 22/547 (4%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXX---YNPAAIDGGDGAXXXXXXXXXXXXX 78
           +LTTS +  ++ D   +K+++I             YNP    GG+ +             
Sbjct: 24  LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDDYNPY---GGNQSEEEEIDEPN---- 76

Query: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE 138
           PFPLE KYK+E+DR++LESLPEMERET+L++RSQ MRKY+ER+ F++R +N+K Q+ERNE
Sbjct: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNE 136

Query: 139 -DDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXX 197
            ++E  KTRSS RATHATGH+D            RE+K + + Y+               
Sbjct: 137 LEEEGKKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDD 196

Query: 198 XXXXXXXXXXXXXXXXXXR------KTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRS 251
                                    + +Y               R+ EL+DFNK+++GRS
Sbjct: 197 NYKHEDSEYEEEGEEDEEDYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRS 256

Query: 252 FVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYF 311
           F+AK+CFYP F +++KGCYGRVNVG D+RTG +SYRMVKIE++FL+ PY MG FFTNQY 
Sbjct: 257 FIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYL 316

Query: 312 GVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEP 371
           GVTQG DRKV QM+ FSDGL T  E++RY R+LE+SH+ KP+++ L+ KSKE+ +FVSEP
Sbjct: 317 GVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEP 376

Query: 372 LTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEK 431
           LT K+T+ IVRNRM+FNKKLSGTNAVLEKTVLK+KL+YARE NNERDVAKYS+QLRN EK
Sbjct: 377 LTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEK 436

Query: 432 RMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTR 490
           RM++YEKHHENDQ G  KLGALTSKN+KVNMDK+RNAEH+KKED  +D KSDPFSRLKTR
Sbjct: 437 RMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTR 496

Query: 491 TKIYYQEIQKEENERAKALAQ--QKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGL- 547
           TKIYYQE+QKEENE+A+A+A+  QK+++EN+   + KEKELLLA+F+RLGGLE +I  L 
Sbjct: 497 TKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQNLD 556

Query: 548 -NIEFDL 553
            N+ FD+
Sbjct: 557 INVTFDI 563

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/549 (55%), Positives = 392/549 (71%), Gaps = 26/549 (4%)

Query: 22  VLT-TSKRTKQSGDSSANKKRRIXXXXXXXXXX-------YNPAAI-DGGDGAXXXXXXX 72
           VLT TS +  ++ D S +KKRRI                 YNP ++ + G G+       
Sbjct: 23  VLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYGSEGEEAN- 81

Query: 73  XXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKR 132
                 PFPLEGK+K+E DR++LESLPEMERET+L++RSQ M+KY+ER+ F+ R +++K 
Sbjct: 82  ------PFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKE 135

Query: 133 QKERNEDDE-ALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXX 191
           Q++R +D E + KTR+S R+THATGH+D            R +KN  RQYS         
Sbjct: 136 QQQRAKDKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKN--RQYSDNEDEEDDE 193

Query: 192 XXXXXXXXXXXXXXXXXXXXXXX--XRKTAY---KXXXXXXXXXXXXXXRDTELNDFNKL 246
                                     RK  Y   +              R+ E++D+NKL
Sbjct: 194 DEYREDNYKNEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKL 253

Query: 247 RIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFF 306
           RIGRSFVAKFCFYP F ++VKGCYGRVN+G DKRTG+TSYRMV+IER+FLQKPYSMGKF+
Sbjct: 254 RIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFY 313

Query: 307 TNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVS 366
           TNQYFGVTQGKDRKVFQM++FSDG     EY RY ++L++SH+ KP++++L +K+KE++ 
Sbjct: 314 TNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMD 373

Query: 367 FVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQL 426
           FV+ PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+AKYSAQL
Sbjct: 374 FVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQL 433

Query: 427 RNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP--IDKSDPF 484
           RNFEKRM++YEKHHENDQ+  K LG LTSKN+K+NM  +RNAEHVKKED      KSDPF
Sbjct: 434 RNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPF 493

Query: 485 SRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMI 544
           SRLKTRTK+YYQEIQKEEN +AK +AQQ+K++E++EA  ++EKELLLAQFRRLGGLE+MI
Sbjct: 494 SRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMI 553

Query: 545 SGLNIEFDL 553
             L+I+FD 
Sbjct: 554 GELDIKFDF 562

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/541 (55%), Positives = 379/541 (70%), Gaps = 10/541 (1%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXX-----YNPAAIDGGDGAXXXXXXXXXXX 76
           VL +S +     D +++KKRRI               YNPAA   G G            
Sbjct: 23  VLASSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDYNPAASGAGTG---DYDDEEEEE 79

Query: 77  XXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKER 136
             PFPLEGKYK+E DRDYL  LPEMERET+L++RSQ M+KY++R+ F+ R KNLK Q++R
Sbjct: 80  ENPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQR 139

Query: 137 N-EDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXX 195
           + + +E  KTRSS R+T ATGH+D            REKK+++R YS             
Sbjct: 140 SKQQEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDY 199

Query: 196 XXXXXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAK 255
                               R++ ++              R+  + DFNK +IGRSFVA 
Sbjct: 200 GYEDKKYSDEEDEEEYDPYSRRSRFEEDEDEVQWAEEALDREANVADFNKAKIGRSFVAN 259

Query: 256 FCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQ 315
           FCFYP F +IV+G YGRVNVG DKR+G+T YRMVKIE++FLQKPY+MGKF TNQYFGVTQ
Sbjct: 260 FCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQ 319

Query: 316 GKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEK 375
           GKDRKVFQM +FSDG IT QE+ERY+ +LE  HI  P+VY+L++K+KE+ SFVS+PLTE+
Sbjct: 320 GKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQ 379

Query: 376 LTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNM 435
           LTN+IVRNRMVFNKKLSG NAVLEKTVLKEKLQYA ET NERD+AKYS+QLR+FEKRM+ 
Sbjct: 380 LTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMST 439

Query: 436 YEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIY 494
           YEK HEND+ G  KL ALT+KN++VN+D+L+NAE VKKED   D KSDPFSRLKTRTK Y
Sbjct: 440 YEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFY 499

Query: 495 YQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLG 554
           YQEIQKEENE+AK  A+QK++EE+E  T+RK+ ELL A+FRRLGGL+++I  ++ +F + 
Sbjct: 500 YQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSID 559

Query: 555 I 555
           I
Sbjct: 560 I 560

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/535 (54%), Positives = 373/535 (69%), Gaps = 12/535 (2%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXXYNPAAIDGGDGAXXXXXXXXXXXXXPFP 81
           V++++ +  +S + S +KKR I          YNPA+   G                PFP
Sbjct: 24  VISSTSKRGRSNEDSVSKKRHINVGEDDEDD-YNPASAGLG-----DDDDNDDEEEAPFP 77

Query: 82  LEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNEDDE 141
           LEGKY++E DRDYLESLPEMERET+L++RSQ M+KY++R  F++R + LKRQ+E +E+  
Sbjct: 78  LEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESSEN-- 135

Query: 142 ALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXXXXXX 201
             K RSS R++  TGH+D            RE+KN                         
Sbjct: 136 -RKVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEEENIYEDKYE 194

Query: 202 XXXXXXXXXXXXXXRKTAY-KXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKFCFYP 260
                         RK+ Y +              R++ +NDFNK++IGRSFVAK+CFYP
Sbjct: 195 EGSEYEDESYDPYKRKSTYAEESEEEDVKWADDTDRESNVNDFNKIKIGRSFVAKYCFYP 254

Query: 261 DFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGKDRK 320
            F +IVK CYGRVNVGV+K T Q  YRMVKIE++FLQKPYSMG FFTNQYFGVTQGKDRK
Sbjct: 255 GFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVTQGKDRK 314

Query: 321 VFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLTNEI 380
           VFQM FFSDG IT  EYERY+R+LESS++  P+ Y L +K KE+  FV+EP+T KLT+E+
Sbjct: 315 VFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMTVKLTDEV 374

Query: 381 VRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYEKHH 440
           VRNRM+FNKKLSGTNAVLEKTVL+EKL +A++ N+ERD+AKYS+QLRN EKR+  YEKHH
Sbjct: 375 VRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLMTYEKHH 434

Query: 441 ENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKE-DLPID-KSDPFSRLKTRTKIYYQEI 498
           ENDQ G+KKLG LTSKN+K+NMDK++  E+VK++ D   D K+DPFSRLKTRTK+YYQEI
Sbjct: 435 ENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRLKTRTKVYYQEI 494

Query: 499 QKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDL 553
           Q+EENE+AK LA+QKKM+EN+EA ++KE+ELLLA+FRRLGGLE ++  L+I   L
Sbjct: 495 QEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNLDINIKL 549

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/462 (61%), Positives = 347/462 (75%), Gaps = 10/462 (2%)

Query: 101 MERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNED-DEALKTRSSGRATHATGHTD 159
           MERET+L++RSQ M+KY++R+ F++R +NLKRQ+  N    E  KTR+S R+T ATGH+D
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 160 XXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXX 214
                       RE KNK+RQYS                                     
Sbjct: 61  VKASKLSQLKRQRE-KNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDPY 119

Query: 215 XRKTAYKXXXXXXXXXXXXXXRDTE--LNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGR 272
            RK  Y+               + E  ++DFNK++IGRSFVA++CF+PDF EIVKGCYGR
Sbjct: 120 SRKPRYREEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCYGR 179

Query: 273 VNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLI 332
           VNVGVD+RT QT+YRMVKIE++FLQKPY+MGKFFTNQYFGVTQGKDRKVFQM+FFSDG I
Sbjct: 180 VNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPI 239

Query: 333 TPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLS 392
           T +E++RY RSL++S+  KP+VY+L  K KE+  FVSEP+T+KLT+EIVRNRMVFNKKLS
Sbjct: 240 TIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKKLS 299

Query: 393 GTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGA 452
           GTNAVLEKTVL+ KLQYA+E NNERD+AKYS QLRN EKR++ YEKHHENDQ G++KLGA
Sbjct: 300 GTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKLGA 359

Query: 453 LTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQ 511
           LTSKN+KVNMDK +N EHVK+ED+  D K+DPFSRLKTRTKIYYQE+QKEENE+AK LAQ
Sbjct: 360 LTSKNRKVNMDKAKNVEHVKEEDINFDSKADPFSRLKTRTKIYYQEVQKEENEKAKELAQ 419

Query: 512 QKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDL 553
           QKK+EE+ EA  +KE+ELLLA+FRRLGGLE +IS ++IE  +
Sbjct: 420 QKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/481 (58%), Positives = 356/481 (74%), Gaps = 4/481 (0%)

Query: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLK-RQKERN 137
           PFPLEGKYK+E+DR  LESLPEMERE++L++RSQ M++Y+ER+F K R KN++ +Q++R 
Sbjct: 94  PFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKRQ 153

Query: 138 EDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXX 197
           +  E  + RSS R T ATGH+D            R KK+ +  YS               
Sbjct: 154 QQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKSGTYDYSEDEEGDGDDHKYDDY 213

Query: 198 XXXXXXXXXXXXXXXX--XXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAK 255
                               R                   RDT L DFNK++IGRSFVAK
Sbjct: 214 YDEGGEDDDEDDYDPYYRKNRHEEDDDDEEVKWAETEDFDRDTGLADFNKVKIGRSFVAK 273

Query: 256 FCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQ 315
           FCFYP F E+V+  YGRVNVG+DK TGQT+YRMVKIE++FLQKPY+MGKFFTNQYFGVTQ
Sbjct: 274 FCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQ 333

Query: 316 GKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEK 375
           GKDRKVFQM+FFSDG IT  EYERY++SLE   I KP+VY L +KSKE+  FVS+P+T K
Sbjct: 334 GKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNKSKEISEFVSQPMTSK 393

Query: 376 LTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNM 435
           LT++IVRNRMVFNKKLSGTNAVLEKTVLKEKLQYA+ET+NERD+AKYS+QL+N EKR++ 
Sbjct: 394 LTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIAKYSSQLKNLEKRISS 453

Query: 436 YEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIY 494
           YEKHHENDQ G KKLG LTSKN+K+N+D++++AE V+K+D+  D KSDPFSRLKTRTKIY
Sbjct: 454 YEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKDDVNFDAKSDPFSRLKTRTKIY 513

Query: 495 YQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLG 554
           Y+E+Q++ENE+AK  A+QK++EE++    RKE ELLLA+FR LGGLE++I G++++ ++ 
Sbjct: 514 YKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSLGGLEEIIGGIDLQINVN 573

Query: 555 I 555
           +
Sbjct: 574 L 574

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/479 (59%), Positives = 359/479 (74%), Gaps = 4/479 (0%)

Query: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLK-RQKERN 137
           PFPLEGKYKNEEDR YLESLPEMERET+L++RSQTM+KY+ER+  K+R KN++ +Q++R 
Sbjct: 85  PFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKRQ 144

Query: 138 EDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXX 197
              E  KTRSS R+T  TGH+D            R KK  +  Y                
Sbjct: 145 LQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKKGT--YEYSEEEEEEGQNEEDE 202

Query: 198 XXXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKFC 257
                             +K   +              R+ EL DFN+++IGRSFVAKFC
Sbjct: 203 YGYQDQEDESEDDYEPMYKKGKTEDEEELKWAEDEDLDREPELGDFNRIKIGRSFVAKFC 262

Query: 258 FYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGK 317
           FYP+F +++KGCYGRVNVGVDKR+GQT YRMVKIE++FLQKPY+MGKFFTNQYFGVTQGK
Sbjct: 263 FYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGK 322

Query: 318 DRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLT 377
           +RKVFQM+FFSDG IT  E+ERY+RSLE+S I KP++Y + +KS E+ SFVS+P+T KLT
Sbjct: 323 NRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFVSQPVTSKLT 382

Query: 378 NEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYE 437
           +E+VRNRM+FNKKLSGTNAVLEKT+LK+KLQYA+E+ +ERDVAKYS+QLRN EKR++ YE
Sbjct: 383 DELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLEKRLSSYE 442

Query: 438 KHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIYYQ 496
           KHHENDQ GSKKLGALTSKN++VN+DK +N E  KKED P D K+DPFSRLKTRTKIYYQ
Sbjct: 443 KHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRLKTRTKIYYQ 502

Query: 497 EIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLGI 555
           EIQ+EENE+AK LA+Q+++++++     KE++LLLA+F+ LGGLE +IS ++ +  L +
Sbjct: 503 EIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMDFQVSLDV 561

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/479 (56%), Positives = 351/479 (73%), Gaps = 9/479 (1%)

Query: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE 138
           P+PLEGKYK+EEDR+ ++ +PEMERET+L++RSQ M+KY+ER+  + R K+++ Q+++ +
Sbjct: 91  PYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQERKVLRQRAKSIRAQQQQRQ 150

Query: 139 DDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXXX 198
             +    RSSGR+T  TGH++            R KK+ +  YS                
Sbjct: 151 LQKDSTKRSSGRSTRTTGHSELRTSKLSELRKQRAKKSGNYDYSESEEDESDQSDNYAES 210

Query: 199 XXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKFCF 258
                             K  +               RD EL DFNK++IGRSFVAKFCF
Sbjct: 211 DNDDYDPHHG-------HKDGFSDHDNEVKWAEEDLDRDAELEDFNKVKIGRSFVAKFCF 263

Query: 259 YPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGKD 318
           YPDF E V+ CYGRVN+G+DK TG   YRMVKIER+FLQKPYSMGKFFTNQYFGVTQGKD
Sbjct: 264 YPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFLQKPYSMGKFFTNQYFGVTQGKD 323

Query: 319 RKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLTN 378
           RKVFQM++FSDG IT  E+ERY+  +    + KP++YTL +K+KEL +FVS+P+T KLT+
Sbjct: 324 RKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNNKAKELFNFVSQPMTMKLTD 383

Query: 379 EIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYEK 438
           +IVRNRMVFNKKL+GTNAVLEK+VLK+KLQYA++TNNE  VAKY+AQL+N EKRM+ YEK
Sbjct: 384 QIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAVAKYAAQLKNLEKRMSSYEK 443

Query: 439 HHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP-ID-KSDPFSRLKTRTKIYYQ 496
           HHENDQTG +KLGALTSKN+KVNMDK+R AE+V+KED   +D KSDPFSRLKTRTKIYYQ
Sbjct: 444 HHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSNVDAKSDPFSRLKTRTKIYYQ 503

Query: 497 EIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLGI 555
           EIQ+EENE+A  LA+QK  E+++E  + KE++LLLA+FRRLGGLE+++S +  + +LG 
Sbjct: 504 EIQQEENEKAMELAKQKHQEQDKETQENKERQLLLAKFRRLGGLEEIVSSIPFKIELGF 562

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/538 (54%), Positives = 375/538 (69%), Gaps = 10/538 (1%)

Query: 26  SKRTKQSGDSSANKKRRIXXXXXXXXXX-----YNPAAIDGGDGAXXXXXXXXXXXXXPF 80
           SK+  +S  +++NK+R +               YNP     GD +             PF
Sbjct: 30  SKKRSRSSQNASNKRRIVDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEEDEEEEENPF 89

Query: 81  PLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLK-RQKERNED 139
           PLEGKYK+E DR+YLESLPEMERET+L+DRSQ M+KYRER+  K+R +N++ +Q++R   
Sbjct: 90  PLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKRQLQ 149

Query: 140 DEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXXXXXXXXXXXXXX 199
            E+ KTRSS R+T  TGH+D            R KK+ +  YS                 
Sbjct: 150 QESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKSGTYDYSEDEDDGGRDEEDDYGYD 209

Query: 200 XXXXXXXXXXXXXXXXRKTAY-KXXXXXXXXXXXXXXRDTELNDFNKLRIGRSFVAKFCF 258
                           +K    +              RD EL+DFNK++IGRSFVAKFCF
Sbjct: 210 DQDEEEESEDDYQPGYKKDKIDEDDEEVKWAEEDDLDRDPELSDFNKVKIGRSFVAKFCF 269

Query: 259 YPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGKD 318
           YP+F ++++GCYGRVNVGVDKR  QT YRMVKIER+FLQKPY+MGKFFTNQYFGVTQGKD
Sbjct: 270 YPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVTQGKD 329

Query: 319 RKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLTN 378
           RKVFQM+FFSDG IT  E+ERY++SL++S I  P++YTL +KS E+  FVS+P+T KLT+
Sbjct: 330 RKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTPKLTD 389

Query: 379 EIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYEK 438
           E+VRNRM+FNKKLSGTNAVLEKT+L++KLQYA+ET +ERDVAKYS+QLR+ E+R+  YEK
Sbjct: 390 ELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLTSYEK 449

Query: 439 HHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIYYQE 497
           HHENDQ GSKKLGALTS+N++ NMDK +N +  KKED P D K+DPFSRLKTRTKIYYQE
Sbjct: 450 HHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKEDTPFDAKTDPFSRLKTRTKIYYQE 509

Query: 498 IQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLGI 555
           IQKEENE+AK LA+ +++E+       KE++LLLA+F+ LGGLE+++SG  I+F L I
Sbjct: 510 IQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSG--IDFKLSI 565

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/549 (51%), Positives = 371/549 (67%), Gaps = 32/549 (5%)

Query: 23  LTTSKRTKQSGDSSANKKRRIXXXXXXXXXX---------------YNPAAIDGGDGAXX 67
           +T+ KR+K   DSS +KKRR+                         YNP    G D    
Sbjct: 26  VTSQKRSKH--DSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHE 83

Query: 68  XXXXXXXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRN 127
                      P+PL GKY+++ DR+++E++PEMERET+L++RSQ M+KY+ER+  ++R 
Sbjct: 84  ASEDEVEEEN-PYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERA 142

Query: 128 KNLKRQKERNEDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYSXXXXX 187
           KN++ Q++R +  +    RSSGR+T  TGH+D            R KK+ +  YS     
Sbjct: 143 KNIRAQQQRRQQKDGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKKSGNYDYSAGEDD 202

Query: 188 XXXXXXXXXXXXXXXXXXXXXXXXXXXXRKTAYKXXXXXXXXXXXXXXRDTELNDFNKLR 247
                                        +  Y+              RD EL+DFNK++
Sbjct: 203 SDHSDDYVDSDNEDDYDPHDG--------RQLYREEADEVKWAEDDLDRDAELDDFNKIK 254

Query: 248 IGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFT 307
           +GRSFVAKFCFYP+F + V+GCYGRVN+GVDK TGQ  YRMVKIE++FLQKPY+MGKFFT
Sbjct: 255 VGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMGKFFT 314

Query: 308 NQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSF 367
           NQYFGVTQGKDRKVFQM+FFSDG I   EYERY+  +    I KP++YTL +K+K+L +F
Sbjct: 315 NQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAKDLTNF 374

Query: 368 VSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLR 427
           VS+P+T KLT++IVRNRM FNKKL+GTNAVLEKTVL++KLQYAR+TNNE+D+AKYS+QL+
Sbjct: 375 VSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQLK 434

Query: 428 NFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKED---LPIDKSDPF 484
           N EKRM+ YEKHHENDQTG +KL ALTSKN+KVN+DK+R+ E+VKKED   L + K+DPF
Sbjct: 435 NLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNV-KTDPF 493

Query: 485 SRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMI 544
           SRLKTRTKIYYQEIQ+EENE+A+ LA+QK+ ++ EE   RK++  LLA+FRRLGGLE  +
Sbjct: 494 SRLKTRTKIYYQEIQQEENEKAQELAKQKQQQDKEEKHDRKQQ--LLAKFRRLGGLEDAL 551

Query: 545 SGLNIEFDL 553
           S L+    L
Sbjct: 552 SKLDFRIKL 560

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/324 (77%), Positives = 292/324 (90%), Gaps = 4/324 (1%)

Query: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295
           R +EL DFNKLRIGRSFVAKFCFYP F ++V GCYGRVNVGVDKR+GQT YRMVKIE++F
Sbjct: 248 RVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVF 307

Query: 296 LQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVY 355
           LQKPY+MGKF+TNQYFGVTQGKDRKVFQM+FFSDG  T  EYERY+RSLE+++I +P+ +
Sbjct: 308 LQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAH 367

Query: 356 TLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNN 415
            L +KSKE+VSF++EPLTEKLT+EIVRNRM+FNKKLSGTNAVLEKTVL+ KLQYARE+NN
Sbjct: 368 ILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNN 427

Query: 416 ERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKED 475
           ERDVAKYSAQLRNFEKRMN YEKHHEND TG+KKLGALTSKN+KVNM K +N +H KKED
Sbjct: 428 ERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKED 487

Query: 476 LP---ID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLL 531
                +D KSDPFSRLKTRTKIYYQE+QKEENE+AKALAQQK++E+N+EA +RKEKELLL
Sbjct: 488 SAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLL 547

Query: 532 AQFRRLGGLEKMISGLNIEFDLGI 555
           AQFRRLGGLE MIS +N+ FD+ +
Sbjct: 548 AQFRRLGGLENMISKINVNFDIDL 571

 Score =  118 bits (295), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 95/167 (56%), Gaps = 32/167 (19%)

Query: 24  TTSKRTKQSGDSSANKKRRIXXXXXXX------------XXXYNPAAI---DGGDGAXXX 68
           T SKR+KQS D++A+KKRRI                      YNP  +   D GD     
Sbjct: 27  TVSKRSKQS-DATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGD----- 80

Query: 69  XXXXXXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNK 128
                     PFPL+GKYK+E+DR+YLESLPE+ERETVL+DRSQTMRKY+ER+ F++R  
Sbjct: 81  -DEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRER-- 137

Query: 129 NLKRQKERNEDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKK 175
             KRQ+      EA  TRSSGR  H+TGH+D            R+KK
Sbjct: 138 --KRQQ------EAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKK 176

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  492 bits (1266), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/321 (70%), Positives = 283/321 (88%), Gaps = 1/321 (0%)

Query: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295
           R+ ++ DFNK++IGRSFVAKFCFYP F ++VKG YGRVNVGVDKR+GQT YRMVKIE++F
Sbjct: 245 READITDFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVF 304

Query: 296 LQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVY 355
            QKPY+MG FFTNQYFGVTQGKDRKVFQM+FFSDG  T  EY+RY+R+L+  HI KP++Y
Sbjct: 305 FQKPYNMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMY 364

Query: 356 TLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNN 415
           +L +K+KE+ +FVS+PLT+KLT++IVRNRM+FNKKLSG+NAVLEKTVLKEKL+YA+ET N
Sbjct: 365 SLDNKAKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGN 424

Query: 416 ERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKED 475
           +RD+AKYS+QLRN  KRM+ YEKHHE DQ+G KKLGALTSKN+KVNMD++RNAEH+KKED
Sbjct: 425 DRDIAKYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKED 484

Query: 476 LPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQF 534
           +  D KSDPFSRLKTRTK+YYQEIQKEENERA+ +A+QK+++E+EEA  R+EKELL + F
Sbjct: 485 VNFDAKSDPFSRLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDF 544

Query: 535 RRLGGLEKMISGLNIEFDLGI 555
           +RLGGLE++I  + + F   +
Sbjct: 545 KRLGGLERVIGQMQLPFTFDV 565

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 94/163 (57%), Gaps = 9/163 (5%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXX--------YNPAAIDGGDGA-XXXXXXX 72
           VLTTS +  ++ D++++K+R+I                  YNPAA+    G         
Sbjct: 23  VLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEED 82

Query: 73  XXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKR 132
                 PFPLEGKYK++ DR +LE LPEMERET+L++RSQ M+KY +R+ F++R +N+K 
Sbjct: 83  EEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKE 142

Query: 133 QKERNEDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKK 175
           Q++  +  E  KTRSS R THATGH+D            RE+K
Sbjct: 143 QQKNRQLREGNKTRSSARTTHATGHSDLKASKLSQLRKQREQK 185

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  457 bits (1176), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/322 (70%), Positives = 279/322 (86%), Gaps = 2/322 (0%)

Query: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295
           RD E+ DFNK+RIGRSFVAK+CFYP F E+++GCYGRVNVGVDKRTG  +YRMVKIE++F
Sbjct: 245 RDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVF 304

Query: 296 LQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVY 355
           LQKPY+MGKFFTNQYFGVTQGKDRKVFQM+FFSDG    QE+ERY+++L+SS+IPKP+ Y
Sbjct: 305 LQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPY 364

Query: 356 TLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNN 415
            +K+K KE+  F+S+PLTEKLT+EIVRNRMV NKKLSGTNAVLEKT+LK+KL+YA+E  N
Sbjct: 365 NIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGN 424

Query: 416 ERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKK-E 474
           E D+AKYS QLRNFEKRM MYEKHHENDQ   KKL  LTSKN+K+NM+++RNAE +KK E
Sbjct: 425 EHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEE 484

Query: 475 DLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQ 533
           D+  D KSDPFSRLKTRTK+YYQEIQKEENE+AK  A Q++++ +EE  K KEK+L+LA+
Sbjct: 485 DVNFDSKSDPFSRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAE 544

Query: 534 FRRLGGLEKMISGLNIEFDLGI 555
           FRRLGGL+K+I  +N++  L I
Sbjct: 545 FRRLGGLQKIIGSINVDIKLDI 566

 Score =  130 bits (328), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 77/161 (47%), Positives = 100/161 (62%), Gaps = 4/161 (2%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXXYNPAAIDGGDGAXXXXXXXXXXXXXPFP 81
           + TT+KRTK S +S   KKRRI          YNP   DG +               PFP
Sbjct: 23  LTTTNKRTKGSSNSQV-KKRRIEVDSEDEEDDYNPD--DGYEPVDVSDKEEEEEEENPFP 79

Query: 82  LEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNEDDE 141
           LEGKYK+  DRD+LESLPEMERET+L++RSQ MRKY+ER+ F++R +NLK+QK +  +D 
Sbjct: 80  LEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGED- 138

Query: 142 ALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYS 182
           + KTRSS R+T ATGH+D            RE+K+K R+ S
Sbjct: 139 SQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSS 179

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  439 bits (1128), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 211/322 (65%), Positives = 261/322 (81%), Gaps = 4/322 (1%)

Query: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295
           R++ + DFNK++IGRSF  KFCFYPDF +IVK CY +VNV  D+   +  YRMVKIE++F
Sbjct: 251 RESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVF 308

Query: 296 LQK-PYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTV 354
           L K P+ MGKFFTNQ FGVTQG +RKV+ M +FSD  IT  E++RYIR+LE  HI +P+V
Sbjct: 309 LDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSV 368

Query: 355 YTLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETN 414
           Y + +K KE+ +F +EPLT+KLT++IVRNRM FNKKLSGTNAVLEKTVL+ KLQ+A+ET 
Sbjct: 369 YAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETG 428

Query: 415 NERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKE 474
           NERDV KYSAQLRN EKR+++YEKHHENDQTG+KKLG LTS+N+K+NMDK RN EH K E
Sbjct: 429 NERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE 488

Query: 475 DLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQ 533
               D K+DPFSRLKTRTKIYYQEIQKEENE+A+ LA +K++EE+ EA  + EKE LLA+
Sbjct: 489 LAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAE 548

Query: 534 FRRLGGLEKMISGLNIEFDLGI 555
           F+ LGGLEKM+  LN +FD  I
Sbjct: 549 FKCLGGLEKMVGSLNFKFDFDI 570

 Score = 97.8 bits (242), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 92/160 (57%), Gaps = 4/160 (2%)

Query: 22  VLTTSKRTKQSGDSSANKKRRIXXXXXXXXXX--YNPAAIDGGDGAXXXXXXXXXXXXXP 79
           ++ +SK+  ++ DSS+ K+R+I            YNP   +  + +             P
Sbjct: 23  LMVSSKKRARNNDSSS-KRRKIEVDNEDEEEEDDYNPVFNEDNNQSTYNTMDGEREEPNP 81

Query: 80  FPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNED 139
           FPLEGKYK+E+DR+ +ES+PEMERET+L++RSQ M+KY+ER+ F++R++  +     N +
Sbjct: 82  FPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRK-QMSLNNNSN 140

Query: 140 DEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSR 179
               KTR+S R TH TG +D            RE++NK +
Sbjct: 141 LTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQ 180

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 268/323 (82%), Gaps = 4/323 (1%)

Query: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295
           R++ L+D+NK++IGRSFVAKFCFYP F +IV+GCYGRVN+G DK TG + YRMVKIER+F
Sbjct: 261 RESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVF 320

Query: 296 LQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVY 355
           LQKPY+MGKFFTNQYFGVTQGKDRK+FQMS+FSD  +T  EYERY+ SLE   I +P+ Y
Sbjct: 321 LQKPYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPY 380

Query: 356 TLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNN 415
            L +KSK +  FV EPLT KL ++IVRNRMVFNKKLSGTNAV+EK VLKEKLQ+++++ +
Sbjct: 381 ILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGD 440

Query: 416 ERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKED 475
               +KY+ QL+  EKR++ YEKHHENDQ   K LGALTSKN+K+N+D++R+AE +K+E+
Sbjct: 441 IESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREE 500

Query: 476 L--PID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLA 532
               +D KSDPFSRLKTRTKIYYQEIQ+EENE+A+  A ++++E ++EA ++K+KELLLA
Sbjct: 501 GVNKVDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEA-KRQLEVDQEAEEQKKKELLLA 559

Query: 533 QFRRLGGLEKMISGLNIEFDLGI 555
           +FRRLGGLE++I  L+++  + I
Sbjct: 560 KFRRLGGLEEIIGSLDLKLHIDI 582

 Score = 91.7 bits (226), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 92/171 (53%), Gaps = 15/171 (8%)

Query: 23  LTTSKRTKQSGDSSANKKRRIXXXXXXXXXX-----------YNPAAIDGGDGAXXXXXX 71
           L+TSK+   S +SS +K+RRI                     Y PA  D  D        
Sbjct: 25  LSTSKK-HASKESSGSKRRRIMKDDEDEDEDEDDNDEEDDDGYMPA--DSFDNDEEEEEE 81

Query: 72  XXXXXXXPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLK 131
                  PFPLEGKYK+E+DR+ LE LPEMERE++L++RSQ M+KY+ER+  +   K++K
Sbjct: 82  EEETDSIPFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIK 141

Query: 132 RQKERNEDDEALKTRSSGRATHATGHTDXXXXXXXXXXXXREKKNKSRQYS 182
           +Q++   +  +  TR+S R++  TGH+D            R KK+ + ++S
Sbjct: 142 QQQQLQREG-SKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKSGNYEFS 191

>TPHA0A02200 Chr1 complement(454420..455532) [1113 bp, 370 aa] {ON}
           Anc_1.355 YHR017W
          Length = 370

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 98  LPEMERETVL--------YDRSQTMRKYRERQFFKDRNKNLKRQKERNEDDEAL 143
           LP++ERE VL          R Q M  YR R      +K+ K+ KE+ E+D+ +
Sbjct: 111 LPQLERECVLVFGDVRDPIVRGQVMDLYRRRYIVFVCSKHAKQYKEKEEEDDFM 164

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 367 FVSEPLTEKL--TNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSA 424
            +S+ LTE+    +E+V+ R +  KK++    + E   L+EKL Y  E N  R    Y  
Sbjct: 78  LISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPAYIW 137

Query: 425 Q 425
           Q
Sbjct: 138 Q 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,661,486
Number of extensions: 2163683
Number of successful extensions: 14476
Number of sequences better than 10.0: 515
Number of HSP's gapped: 14323
Number of HSP's successfully gapped: 667
Length of query: 555
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 440
Effective length of database: 40,294,809
Effective search space: 17729715960
Effective search space used: 17729715960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)