Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J028703.566ON38438420460.0
KNAG0I002403.566ON3913889971e-133
NCAS0E002703.566ON3883839841e-131
Kpol_380.73.566ON3853839731e-130
Skud_7.243.566ON3913859621e-128
NDAI0I032303.566ON3863829591e-127
ZYRO0E09504g3.566ON3773869501e-126
Smik_7.183.566ON3853849401e-125
KLTH0G00748g3.566ON3853889351e-124
SAKL0F00836g3.566ON3833779311e-123
YGL243W (TAD1)3.566ON4003839311e-123
Kwal_47.192633.566ON3833829131e-121
Ecym_25963.566ON3873859001e-119
Suva_7.183.566ON3853868871e-117
TDEL0D063403.566ON4023928881e-116
TPHA0G036403.566ON3963848841e-116
TBLA0E002303.566ON3943928711e-114
KLLA0A00759g3.566ON3803858361e-109
CAGL0H07733g3.566ON3853887801e-100
AFR267W3.566ON3853857488e-96
KLLA0A07579g5.689ON72085750.88
TDEL0A042605.561ON27457703.1
ADL108C7.214ON78165704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J02870
         (384 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   792   0.0  
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   388   e-133
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   383   e-131
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   379   e-130
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   375   e-128
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   374   e-127
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   370   e-126
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   366   e-125
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   364   e-124
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   363   e-123
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   363   e-123
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   356   e-121
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   351   e-119
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   346   e-117
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   346   e-116
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   345   e-116
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   340   e-114
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   326   e-109
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   305   e-100
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   292   8e-96
KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {...    33   0.88 
TDEL0A04260 Chr1 (758507..759331) [825 bp, 274 aa] {ON} Anc_5.56...    32   3.1  
ADL108C Chr4 complement(494813..497158) [2346 bp, 781 aa] {ON} S...    32   4.5  

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/384 (100%), Positives = 384/384 (100%)

Query: 1   MNDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIS 60
           MNDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIS
Sbjct: 1   MNDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIS 60

Query: 61  TGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGK 120
           TGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGK
Sbjct: 61  TGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGK 120

Query: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFK 180
           FRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFK
Sbjct: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFK 180

Query: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240
           RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT
Sbjct: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240

Query: 241 DKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIE 300
           DKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIE
Sbjct: 241 DKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIE 300

Query: 301 QAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRR 360
           QAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRR
Sbjct: 301 QAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRR 360

Query: 361 DLVENAKICLSHGSWIATLKDDCI 384
           DLVENAKICLSHGSWIATLKDDCI
Sbjct: 361 DLVENAKICLSHGSWIATLKDDCI 384

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  388 bits (997), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 267/388 (68%), Gaps = 7/388 (1%)

Query: 1   MNDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIS 60
           M D LG+EIA LVY EYD+L  SSKP  RSNGTKEWT+L+ +VA+  +   + L+LI+++
Sbjct: 1   MTDLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQ-LRLISLT 59

Query: 61  TGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GG 119
           TGVKA PN  L+RS GR+LHDCHAEILALRGFN+VLL+ MQ  +NN+    +    Q   
Sbjct: 60  TGVKATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTN 119

Query: 120 KFRWKSKWKLALYVSRLPCGDASMDHLEDASELDIE---MSEDDRLQYIDPGKSKILRGR 176
           KFR   +++LAL++SRLPCGD SM+ L++   L  +   + +DD +QYIDP    +LRGR
Sbjct: 120 KFRLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGR 179

Query: 177 MNFKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPE 236
            N+ +KG VRTKPGR+DS IT SKSCSDKLC  Q TS LN+ TW L+E  VY+ YL++P 
Sbjct: 180 FNYAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPN 239

Query: 237 LNDTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQE 296
           ++ +D+ AL RCF TRL S+   + + Q L+   SF DD+  + + PS+ S +K++ ++ 
Sbjct: 240 ISASDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEG 299

Query: 297 HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGL-SYLQFKAE 355
            T+EQA+L+G++NGF+TK+ KPLR  CE+ +SR SQW L+ +L  +  N   SY  FK++
Sbjct: 300 ETLEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSK 359

Query: 356 QEQRRDLVENAKICLSHG-SWIATLKDD 382
              R +L+   +  L++G  WI T  DD
Sbjct: 360 LVPRAELITRTRSLLTNGQPWIPTCSDD 387

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  383 bits (984), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 197/383 (51%), Positives = 266/383 (69%), Gaps = 9/383 (2%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           L D +AK+V EEY++LK SSKPV RSNG KEWTVLA+ + ++ N    +LK+I++STGVK
Sbjct: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMISLSTGVK 64

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNN-ETSSFLDKSAQGGKFRW 123
           A+P+  L RS G+++HDCHAEILALRGFN VLLK++ ++  N   S  L+ S   GK+  
Sbjct: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHL 124

Query: 124 KSKWKLALYVSRLPCGDASM---DHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFK 180
           ++KWKL LY+SRLPCGDASM    +    S     + + D  QYIDP    ILRGR+NF 
Sbjct: 125 RAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLNFS 184

Query: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240
           R G VRTKPGRLDS  TLSKSCSDKLC++Q+TS LN +TW L++TPV++ YL+IP+LN  
Sbjct: 185 RNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYD 244

Query: 241 DKKALIRCFHTRL-CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299
           +K  L+  F  RL CS ++     ++LT    F++DK   ++ PS+ S IK+F +Q  TI
Sbjct: 245 NKNDLLLSFQNRLKCSKVN-YRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETI 303

Query: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359
           E+A+LNGVKNG YTK +KPLR+ CESI+SRY+QW++YK +  +  +  SYL+FK  Q  R
Sbjct: 304 EEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNY-SATSYLEFKRSQTAR 362

Query: 360 RDLVENAKICLSHGSWIATLKDD 382
            +L++     LS   W+ T  DD
Sbjct: 363 LELIKYTNEILSSEGWLPTQPDD 385

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  379 bits (973), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 260/383 (67%), Gaps = 6/383 (1%)

Query: 4   SLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGV 63
           SLGD+I+ +++EEY +LK+SSKP TRSN  KEWTVLAA+VAI+   DE ++  I ISTGV
Sbjct: 5   SLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISN--DENEIIPITISTGV 62

Query: 64  KAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRW 123
           KA PN  L+RS G+ILHDCH+EIL+LR FN  LL+++Q +   + S F+  +   GK+ W
Sbjct: 63  KATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPAKADGKYNW 122

Query: 124 KSKWKLALYVSRLPCGDASMDHLEDA---SELDIEMSEDDRLQYIDPGKSKILRGRMNFK 180
              +K+ALY+S+LPCGDASMD L +    +E +  + ++D  Q+IDP    ++RGR+N+ 
Sbjct: 123 NENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLNYS 182

Query: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240
           +K  VRTKPGR DS++TLSKSCSDKLC+KQ  S LNSL W+L E P++L Y++IP L D 
Sbjct: 183 KKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPTLKDE 242

Query: 241 DKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIE 300
               L + F  RL      I    FLT    F DDKT     P+  S IK+   +EH IE
Sbjct: 243 LLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPREHQIE 302

Query: 301 QAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRR 360
           Q+I+NGV+NG YTK +KPL++ C+S +S+YSQW L+K+LK + +   SY+++K  Q  R 
Sbjct: 303 QSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEE-QLAKSYIEYKKSQTLRE 361

Query: 361 DLVENAKICLSHGSWIATLKDDC 383
           DL +  K  LS   WI+T +DDC
Sbjct: 362 DLKDIIKSKLSPDGWISTFQDDC 384

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 263/385 (68%), Gaps = 11/385 (2%)

Query: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62
           + L +EI+  V  EY +LK+  KP TR  G KEWT+LA VV IN +    ++++++++TG
Sbjct: 11  NELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATG 70

Query: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGG-KF 121
           VKA+P++ L RS G++LHDCHAEILALRG N VLLK+++D      S F++ + +   +F
Sbjct: 71  VKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEIPIRF 130

Query: 122 RWKSKWKLALYVSRLPCGDASMDHLEDA---SELDIEMSEDDRLQYIDPGKSKILRGRMN 178
             K  W+LALY+SRLPCGDASMD L D+   +E  I++ ++D  QY+DP    ILRGR+N
Sbjct: 131 NLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRLN 190

Query: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238
           F +K  VRTKPGR DS+ITLSKSCSDKL +KQI+S LNSL +EL E PVYLKY+VIP++ 
Sbjct: 191 FHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPDIE 250

Query: 239 DTDKKALIRCFHTRL-CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEH 297
           D  K  L R FH RL C       + +FL     F DD+T ++ +PS+   IK+F +   
Sbjct: 251 DKTKHILERSFHNRLPCDG----HKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306

Query: 298 TIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQE 357
           T E+AI NG+KNGFYTK  KPLR+ C+S +SR++QW L++ ++      +SYL FK++Q+
Sbjct: 307 T-EEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPK-HKSMSYLHFKSQQK 364

Query: 358 QRRDLVENAKICLSHGSWIATLKDD 382
           +R  L+  AK  LS   WI+T  DD
Sbjct: 365 ERNRLITTAKNALSPDGWISTRIDD 389

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  374 bits (959), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 260/382 (68%), Gaps = 5/382 (1%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           L D IA L+ ++YD LK+SSKPV RSNG KEWTV A +VAIN   D  DL++I+++TGVK
Sbjct: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAIN--TDTNDLRVISLATGVK 64

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRWK 124
           A+PN  L+RS G++LHD HAEI+ALRGFN V+L+ +  LKN E +  +  S     + +K
Sbjct: 65  ALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSFK 124

Query: 125 SKWKLALYVSRLPCGDASMDHLE--DASELDIEMSEDDRLQYIDPGKSKILRGRMNFKRK 182
           S  K+ALY+S+LPCGD SM  L+  D +  ++ + ++D +QYI+     ILRGR+NF +K
Sbjct: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184

Query: 183 GAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDK 242
           G VRTKPGRLDS +T SKSCSDKLC+KQ TS LN LT++L+E PVYL Y+++P +    K
Sbjct: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244

Query: 243 KALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIEQA 302
           + +  CF+ +    +       +L+    F D + +  Q PSA   IKVF  Q ++IEQ 
Sbjct: 245 EDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQT 304

Query: 303 ILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRRDL 362
           ILNGVKNG YTK +KPLR+ CE+++SR+SQW ++K ++      +SYL FK  Q +RR L
Sbjct: 305 ILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQ-MSYLDFKQSQHERRKL 363

Query: 363 VENAKICLSHGSWIATLKDDCI 384
           ++  +  +S   WI+T +DDC+
Sbjct: 364 IDYTRSKMSPDGWISTQEDDCL 385

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 267/386 (69%), Gaps = 13/386 (3%)

Query: 1   MND-SLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAI 59
           M+D SLG+ IA+ V E Y +L +S KP TRSNG KEWTVLA +VAI++     DL+LI+I
Sbjct: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKK--NSDLRLISI 58

Query: 60  STGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSS--FLDKSAQ 117
           +TGVKA+P+A L RS G+++HDCHAEILALR FN V+L  +  L +N  +    ++++++
Sbjct: 59  ATGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE 118

Query: 118 GGKFRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRM 177
              F +K  W+LA+Y+S LPCGDASMD L     + IEM +DD +Q++DP  + I+RGR 
Sbjct: 119 DQLFHFKDNWELAIYISTLPCGDASMDLLCQDESI-IEMQDDDPIQFVDPAVTSIVRGRF 177

Query: 178 NFKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPEL 237
           N+ R+  VRTKPGR DS ITL KSCSDKLC +Q+ S LN +TW+L+  PVYLKYLV P  
Sbjct: 178 NYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP-- 235

Query: 238 NDTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEH 297
           N TD   L + F+ R+    ++  +    +YQ  F  DK S  + PSA S IK++ + E 
Sbjct: 236 NTTD--LLHQSFYDRIKVLPNVPLKVLQCSYQ--FEHDKHSSEEEPSAMSSIKLYSTPES 291

Query: 298 TIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQE 357
           T+EQA+LNG+KNGFYTK +KPLRR CE  +SRY+QW L+K+L+ +  N  +YLQFKA  +
Sbjct: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNA-TYLQFKATIQ 350

Query: 358 QRRDLVENAKICLSHGSWIATLKDDC 383
            R  L+++ +  LS   WI+T +DDC
Sbjct: 351 DRNALIQDCRKLLSPKGWISTSRDDC 376

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  366 bits (940), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 258/384 (67%), Gaps = 9/384 (2%)

Query: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62
           D LGD I+  V  EY +LK   +PVTR  G KEWTVLA +VAIN   D  ++ +++++TG
Sbjct: 5   DELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATG 64

Query: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121
           VKAMP++ L RS G+ILHDCHAEILALRG N VLL ++++      S F+  + +   +F
Sbjct: 65  VKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDETPPRF 124

Query: 122 RWKSKWKLALYVSRLPCGDASMDHLEDASELDIE---MSEDDRLQYIDPGKSKILRGRMN 178
           + K  W+LALY+S+LPCGDAS+D L D  + D +   + +DD  QY++     ILRG +N
Sbjct: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184

Query: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238
           F RK  VRTKPGR DS+ITLSKSCSDKL +K+++S LN+L +EL   PV+LKY+VIP L 
Sbjct: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244

Query: 239 DTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHT 298
           +  K  L + FH RL ++        F++   SF DDK  +  +PS    IK+F   +HT
Sbjct: 245 NEVKHVLKQSFHDRLPNA---NHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLF-MNDHT 300

Query: 299 IEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQ 358
            E+AILNGVKNGFYTK  KPLR+ C+S++SR++QW L+K ++ + E G+SYLQFK+ Q++
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYE-GMSYLQFKSSQKR 359

Query: 359 RRDLVENAKICLSHGSWIATLKDD 382
           R  L+   K  LS   WI T  DD
Sbjct: 360 RTRLIIAIKDILSPDGWIPTKIDD 383

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  364 bits (935), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 260/388 (67%), Gaps = 11/388 (2%)

Query: 1   MNDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIS 60
           +N+ + D+IA+L  E Y +LK S+KP  RSNGTKEW VLA VVAIN  A+E DL+L++++
Sbjct: 3   VNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINR-ANE-DLRLVSLA 60

Query: 61  TGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLD----KSA 116
           TGVKA PN  L RS GRILHDCHAEILALRGFN VLLK +Q LK++++    D     S 
Sbjct: 61  TGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSD 120

Query: 117 QGGKFRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGR 176
             G +R   +W  ALY+SR PCGDASM  L D  E  I  ++DDR QY+D     I+RGR
Sbjct: 121 NSGIYRLNEEWSFALYISRAPCGDASMGLLYD--EGCISFTDDDRCQYVDDNNKTIIRGR 178

Query: 177 MNFKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPE 236
            N+ +KG VRTKPGR DS +TLSKSC+DKLC KQ+ S LNSLTW+L+E PV+L+Y+VIP+
Sbjct: 179 FNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQ 238

Query: 237 LNDTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKV-FPSQ 295
           L    +    R F TR+  S+ +  + Q L+    F DDKT ++Q PS  S I +     
Sbjct: 239 LPRVAEADFERAFDTRIKDSVPM-EKVQILSCSQRFDDDKTYENQPPSLMSSILLNIIEG 297

Query: 296 EHTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAE 355
           + T +Q+ILNGVK G + K   PL++ CE+++SR SQW+L+K +K  V++  +Y +FK++
Sbjct: 298 QVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQ-TYREFKSQ 356

Query: 356 QEQRRDLVENAKICLSHGSWIATLKDDC 383
           Q  R  L E  ++ LS   W+ T  DDC
Sbjct: 357 QTDRNALKERIRLALSKDGWVGTESDDC 384

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  363 bits (931), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 248/377 (65%), Gaps = 8/377 (2%)

Query: 10  AKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVKAMPNA 69
           +KL+ E Y +LK   KP  RSNG KEWTVLA ++AINE  +   ++L+++ TGVKA PN 
Sbjct: 12  SKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKN--TMRLVSLGTGVKATPNE 69

Query: 70  RLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKN--NETSSFLDKSAQGGKFRWKSKW 127
            L RS G+I+HDCHAEILALRGFN VLL  + +L    +E    ++K+  G  F+    W
Sbjct: 70  ELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDGLSFKVPDHW 129

Query: 128 KLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFKRKGAVRT 187
             ALY+S+LPCGD+SMD LE+       +   D  QY++     +LRGR N+++KG VRT
Sbjct: 130 SFALYISKLPCGDSSMDTLEEEDLNSFNIENTDACQYLEQNNHTLLRGRFNYQKKGFVRT 189

Query: 188 KPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDKKALIR 247
           KPGR DS ITLSKSCSDKL I+Q+TS LNS+ WEL +TP+YLKY++IP L++     L R
Sbjct: 190 KPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIPNLDEHALVGLER 249

Query: 248 CFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKV-FPSQEHTIEQAILNG 306
            F  RLC+     +  +FL+   +F DDK +  Q PS+ S I +   +     ++AILNG
Sbjct: 250 SFE-RLCNHPSF-NALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHNNGEEFQEAILNG 307

Query: 307 VKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRRDLVENA 366
           VKNGFY K  KPLR+ CESI+SR SQW LY ++ S+ E+  +YLQFK+ Q +R  L   A
Sbjct: 308 VKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHE-TYLQFKSTQVERNILKNEA 366

Query: 367 KICLSHGSWIATLKDDC 383
           K+CLS   WI T  DDC
Sbjct: 367 KLCLSPDGWIPTGVDDC 383

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  363 bits (931), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 255/383 (66%), Gaps = 8/383 (2%)

Query: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62
           D LG+EI+  V  EY +LK++ +P+ R +G +EWT+LA V AIN +     +++++I+TG
Sbjct: 21  DKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATG 80

Query: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121
           VKA+P++ L RS G+ILHDCHAEILALRG N VLL  +Q+   +    F+  + +   +F
Sbjct: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARF 140

Query: 122 RWKSKWKLALYVSRLPCGDASMDHLEDASELD--IEMSEDDRLQYIDPGKSKILRGRMNF 179
             K  W+LALY+SRLPCGDASM  L D  + D  I++ + D  QY+D     ILRGR+NF
Sbjct: 141 NLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNF 200

Query: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239
            R+  VRTKPGR DS+ITLSKSCSDKL +KQ +S LN L +EL E PV+LKY+VIP L D
Sbjct: 201 NRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLED 260

Query: 240 TDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299
             K  L + FHTRL    +L +  +FL     F DDK  +  +P     +K+F   + + 
Sbjct: 261 ETKHHLEQSFHTRLP---NLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLF-MDDFST 316

Query: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359
           E+AILNGV+NGFYTK  KPLR+ C+S +SR++QW L+K ++ + E G+SYL+FK+ Q++R
Sbjct: 317 EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYE-GISYLEFKSRQKKR 375

Query: 360 RDLVENAKICLSHGSWIATLKDD 382
             L+   K  LS   WI T  DD
Sbjct: 376 SQLIIAIKNILSPDGWIPTRTDD 398

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  356 bits (913), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 251/382 (65%), Gaps = 11/382 (2%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           L D+I+ L +  Y++LK S+KPV RSNG KEW VLA V+AI     ++ L+L++++TGVK
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAI---GPDQGLRLVSLATGVK 63

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLD----KSAQGGK 120
           + PN  L RS GRILHDCHAEILALRGFN VLLK +Q L + + +   D     S + GK
Sbjct: 64  STPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGK 123

Query: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFK 180
           F+    W  ALY+SR+PCGDASMD L+  SE D+E SED   QY++P    ILRGR N+ 
Sbjct: 124 FKLGDDWSFALYISRIPCGDASMDLLQ--SESDMEFSEDTSCQYVNPCNRTILRGRFNYN 181

Query: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240
           ++G VRTKPGR DS +TLSKSCSDKLC +Q+ S LN++TW+LME+P++LKY+V+P++++T
Sbjct: 182 KRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVSNT 241

Query: 241 DKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTIE 300
            ++     F  RL      I   + L     F DDK   +Q+PS+ S I +  +     +
Sbjct: 242 ARRGFESAFKDRL-REFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQPEQ 300

Query: 301 QAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQRR 360
           Q+ILNGVK+G Y +  KPLR+ CE+++SR +QW L+K +K D  +  SY  FK EQ  R 
Sbjct: 301 QSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVK-DYSDKKSYQAFKGEQVARN 359

Query: 361 DLVENAKICLSHGSWIATLKDD 382
            L    +  LS   WI+T  DD
Sbjct: 360 VLKNKVRSSLSSDGWISTGPDD 381

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  351 bits (900), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 246/385 (63%), Gaps = 10/385 (2%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           L + +++LV ++YD LK S+KP  +SNG KEWTVLA +VAI+EN +E  L+LI+++TGVK
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNE--LRLISVATGVK 65

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNN--ETSSFLDKSAQGGKFR 122
           A+PN  L+RS GR+LHD HAEILALR FN VLLK M  L  N  ET   +++      +R
Sbjct: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125

Query: 123 WKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNFKRK 182
            + +WK+ALY+SR PCGD SMD L +     ++ S DD  QYI+PG    LRGR N+  K
Sbjct: 126 MRKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCK 185

Query: 183 GAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN-DTD 241
           G  RTKPGR DS ITLSKSCSDKL  KQ+ S LNS  W+L+ETPV+L YLV+P+ + +  
Sbjct: 186 GVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKA 245

Query: 242 KKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATS--FIKVFPSQEHTI 299
               +R FH RL   L+ +   + +     F  DK  +SQ P   S  +I + P  E  I
Sbjct: 246 SDGCLRNFHYRLL-GLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKP-MEMDI 303

Query: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359
           E+ ILNGV NGFY K  +PLR+ CESILSR S W L+  L   V N  SYL FK++Q  R
Sbjct: 304 EEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYV-NSNSYLDFKSKQTSR 362

Query: 360 RDLVENAKICLSHGSWIATLKDDCI 384
             L E  ++ LS   WI T  DDC 
Sbjct: 363 NQLKEQVRLHLSSDGWIPTSADDCF 387

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  346 bits (887), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 259/386 (67%), Gaps = 13/386 (3%)

Query: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62
           D L ++I+  V  EY +LKA  +PVTR +G +EWT+LA V AIN NA   ++K+++I+TG
Sbjct: 5   DELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATG 64

Query: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121
           VK++P++ L RS G++LHDCHAEILALRG N V L +++D         ++ + +   KF
Sbjct: 65  VKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEIPPKF 124

Query: 122 RWKSKWKLALYVSRLPCGDASMDHLED---ASELDIEMSEDDRLQYIDPGKSKILRGRMN 178
           R K KW+LALY+S+LPCGDASMD L D   + +  +E+ +DD  QY+DP    ILRGR+N
Sbjct: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILRGRLN 184

Query: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238
           F +K  VRTKPGR DS+ITLSKSCSDKL ++Q +S LNSL   L   PV+L+Y+VIP L+
Sbjct: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVIPNLD 244

Query: 239 DTDKKALIRCFHTRL--CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQE 296
           +  +  L + FH RL  CS      RF+FL     F DDK  ++ +PS     K+F   +
Sbjct: 245 EKTRHTLEQSFHNRLPFCS-----HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLF-MND 298

Query: 297 HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQ 356
            T+E+AILNG+KNGFYTK  KPLR+ CES LSR++QW L+  +K + ++  SYLQFKA+Q
Sbjct: 299 STVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDT-SYLQFKAQQ 357

Query: 357 EQRRDLVENAKICLSHGSWIATLKDD 382
            +R  L+   K  LS   WI T  DD
Sbjct: 358 TERNQLITLIKGALSPDGWIPTKTDD 383

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  346 bits (888), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 259/392 (66%), Gaps = 14/392 (3%)

Query: 2   NDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIST 61
           +D LGD IAKL  +EY +L ++ KPV RSNG+KEWTVL+ +VAI+  + +K L+L++I T
Sbjct: 7   SDRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGT 66

Query: 62  GVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSF-LDKSAQGGK 120
           GVKA+P+A L+RS GR++HDCHAEILALRGFN VLL++M  +   +     L +    G 
Sbjct: 67  GVKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTAGV 126

Query: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELD------IEMSEDDRLQYIDPGKSKILR 174
              KSKWKLALY+S LPCGDASM  L+  +  D      +   E+  +Q+ID     ILR
Sbjct: 127 CILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILR 186

Query: 175 GRMNFKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVI 234
           GR N+ R G VRTKPGR DS IT SKSCSDKLCIKQ+TS LNSLTW LM  PV+L YLVI
Sbjct: 187 GRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVI 246

Query: 235 PELNDTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVF-- 292
           P L     + +   F  RL   L   S  + L     F D+K+S S+ PS+ S +K+F  
Sbjct: 247 PNLAVDRCQGVHHSFQDRL-GRLPQKS-LELLECNVPFFDNKSSKSEEPSSMSSVKLFLD 304

Query: 293 -PSQEHTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQ 351
            P ++ T EQAILNG+KNGFYTK +KPLR+ CES +SR +QW +Y +++ D +   +YL+
Sbjct: 305 LPERKCT-EQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQ-TYLE 362

Query: 352 FKAEQEQRRDLVENAKICLSHGSWIATLKDDC 383
           FKA   +R  +++  K  LS   WI+T  DDC
Sbjct: 363 FKAGLSERNRIIQEVKKVLSPDGWISTRNDDC 394

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/384 (44%), Positives = 249/384 (64%), Gaps = 8/384 (2%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           + ++++  V+ EY +L+ SSKPV +SN   EWTVLA ++AIN    E   + IAI+TGVK
Sbjct: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGE--FETIAITTGVK 73

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRWK 124
           A P+A LDRS G+I+HDCHAEILALR FN  LL  +  + N++ +S   +  +   + W 
Sbjct: 74  ATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEWN 133

Query: 125 SKWKLALYVSRLPCGDASMDHLEDASEL-DIEMSEDDRLQYIDPGKSKILRGRMNFKRKG 183
            KW LALY+S+LPCGDASMD L    +  + E+++D+ LQYIDP     +RGR+N+K++ 
Sbjct: 134 KKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKRD 193

Query: 184 AVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDKK 243
            +RTKPGR DS ITLSKSC+DKLC+KQ+   L+S    LM+ P++L+Y++IP ++  +  
Sbjct: 194 VIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGKE-S 252

Query: 244 ALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDK--TSDSQLPSATSFIKVFPSQEHTIEQ 301
            L   F  RL      +  F+F++ +  F DD   T+  + P+  + IK+F      +EQ
Sbjct: 253 ILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVMEQ 312

Query: 302 AILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVEN--GLSYLQFKAEQEQR 359
           +I+NGVKNGFY+K  KPLR+ CE I+SRYS+WNL K ++ +      +SYL+FK+   +R
Sbjct: 313 SIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLTKR 372

Query: 360 RDLVENAKICLSHGSWIATLKDDC 383
             L +  +  LS   WI T KDDC
Sbjct: 373 MTLQQEVRSLLSPDGWITTKKDDC 396

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  340 bits (871), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/392 (44%), Positives = 264/392 (67%), Gaps = 15/392 (3%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           LGD+IA L++ EY++LK S+KP+ +SNG KEWT+++ +VA++ N D   +K+I+++TGVK
Sbjct: 6   LGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVS-NKDTNIIKVISLATGVK 64

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSS----FLDKSAQGGK 120
           A P++ L RS G I+HDCHAEILA+RGFN  LL+ +++ + ++T+S    +  ++++  K
Sbjct: 65  ATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKK 124

Query: 121 FRWKSKWKLALYVSRLPCGDASMDHLEDASELD--IEMSEDDRLQYIDPGKSKILRGRMN 178
           + W  ++ L LY+S+LPCGD+SM+  E++ E +  I+  E+D  QY+DP    ILRGR+N
Sbjct: 125 YSWNDEYDLGLYISKLPCGDSSMEE-ENSLESNSLIQFQENDLTQYVDPTIRTILRGRIN 183

Query: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238
           + + G VRTKPGR+DS+IT SKSCSDK+CIKQ+ S LNSL  EL+E+P+Y+KYLV P++ 
Sbjct: 184 YNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPDIK 243

Query: 239 DTDKKALIRCFHTRLCSSLDLISRFQ-----FLTYQGSFTDDKTSDSQLPSATSFIKVFP 293
             +   L + F+      L++ S ++     F+     F D KT+D Q PS TS +K+F 
Sbjct: 244 PQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIFN 303

Query: 294 SQE-HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQF 352
           S +   +EQ+I+NGVK G YTK  KPL +   +I+SR  QWN++K++  + E   SYL F
Sbjct: 304 SNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQ-YSYLTF 362

Query: 353 KAEQEQRRDLVENAKICLSHGSWIATLKDDCI 384
           K  Q  R +     + CLS   WI+T  DD I
Sbjct: 363 KRFQTDRIETRNRIRKCLSQDGWISTFNDDII 394

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 247/385 (64%), Gaps = 13/385 (3%)

Query: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64
           + D IA  V   YD+L  S KP  RSNG  EWTVL+ +VA +E  D  +   I++ TGVK
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEP--ISLGTGVK 61

Query: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFRWK 124
           A PN  L RS G+I+HDCHAE++ LR FN +LLK + DL+N + S  ++KSA G  ++ K
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSADG--YKVK 119

Query: 125 SKWKLALYVSRLPCGDASMDHLE--DASELDIEMSEDDRL---QYIDPGKSKILRGRMNF 179
             WK A+Y+SR+PCGDASM+ LE  D SE +      +     QY+ P    I+RGR N+
Sbjct: 120 DVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRANY 179

Query: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239
           K +  VRTKPGR DS ITLSKSCSDKL +KQ+ S  N+LTW L+++PVYL+++V+P+   
Sbjct: 180 KLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPKQYQ 239

Query: 240 TDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299
            ++  L   F  RL +   L   F+FL    +F+ D+T+ SQ PS +S + ++ S E  +
Sbjct: 240 YEQVQLEDTFWLRLKNQQFL--PFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNE-AV 296

Query: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359
            + ILNGVKNGFY K  KPLR+GC+SI+SR +QW+ +K +K+ + +   Y  FK+    R
Sbjct: 297 SEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKA-MPSDTDYYGFKSSVVDR 355

Query: 360 RDLVENAKICLSHGSWIATLKDDCI 384
             ++  AK  LS   WI+T +D+CI
Sbjct: 356 NHIISKAKATLSASGWISTCRDNCI 380

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  305 bits (780), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 241/388 (62%), Gaps = 17/388 (4%)

Query: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62
           D  G +I +LV  EY++L A  +PVTRSNG KE T++AAV+A +   D+  +  + I+TG
Sbjct: 5   DDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LTITTG 62

Query: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFR 122
           VK+ PN  L RS G+ILHDCHAEILALRGFN +LL++++       S+ +  +  G  F 
Sbjct: 63  VKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNG--FE 120

Query: 123 WKSKWKLALYVSRLPCGDASMDHLEDAS---ELDIEMSEDDRLQYIDPGKSKILRGRMNF 179
           W ++ +L L++S+LPCG+ SM  LE+     E  +   EDD  QYI P    ILRGR NF
Sbjct: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180

Query: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239
            ++  VRTKPGR+DS  T SKSCSDKL I+  TS LNSLT  +M TP+Y+   VIP +N 
Sbjct: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240

Query: 240 TDKKALIRCFHTRLCSSLDLIS---RFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQE 296
              + +   F+      +DL S   R    T    F DD + ++  PS+ S +K+  +  
Sbjct: 241 HQIEEMNLYFN----RPMDLHSSARRLYIHTSHYKFGDDLSPETP-PSSMSALKILFNDN 295

Query: 297 HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQ 356
              E+ ILNGVKNG+YTK  KPLR+ CES +SRYS W+L+ ++  + ++ L+YL+FK   
Sbjct: 296 DIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKD-LTYLEFKRRY 354

Query: 357 -EQRRDLVENAKICLSHGSWIATLKDDC 383
             +R +L+ + K  LS   W++T +DDC
Sbjct: 355 CAERAELIRSIKSSLSSDGWLSTAEDDC 382

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  292 bits (748), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 161/385 (41%), Positives = 228/385 (59%), Gaps = 10/385 (2%)

Query: 2   NDSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAIST 61
           +D L + I   V  +Y   K SSKP  RSNG+ EWTVLA VV ++    E   +L++ +T
Sbjct: 3   DDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAE--CRLVSAAT 60

Query: 62  GVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSS--FLDKSAQGG 119
           GVKA+P+  L+RS GR++HD HAEILALRGFN VLL+  + + +  ++    ++++    
Sbjct: 61  GVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQD 120

Query: 120 KFRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRMNF 179
           +FR  S+W+ ALY+S+ PCGD SMD + D    ++  S DD +QY+      +LRGR N+
Sbjct: 121 RFRLASRWQAALYISKAPCGDCSMD-MADDDADEMTFSPDDPIQYVAEHNYTMLRGRFNY 179

Query: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239
            RKG  RTKPGR DS ITLSKSCSDKL  K + S L+S+TWEL E PV+L YLV+P    
Sbjct: 180 SRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPHTIA 239

Query: 240 TDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299
           T      RCF  RL + L+     + L    +F  D+ +  Q P+ T+ + +  + +  +
Sbjct: 240 T--AGFERCFAERL-AGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITAKKHV 296

Query: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359
           EQA+LNGV+NG Y +  + L    E+I+SR + W ++  L       LSY  FK +Q  R
Sbjct: 297 EQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLHQ--APPLSYAAFKRQQHAR 354

Query: 360 RDLVENAKICLSHGSWIATLKDDCI 384
             L  + +  LS   W  T  DDCI
Sbjct: 355 NRLKRHVRHRLSPDGWPTTRVDDCI 379

>KLLA0A07579g Chr1 complement(679469..681631) [2163 bp, 720 aa] {ON}
           weakly similar to uniprot|Q7LGN4 Saccharomyces
           cerevisiae YOR080W DIA2 Protein of unknown function
           involved in invasive and pseudohyphal growth
          Length = 720

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 201 SCSDKLCIKQITS-ALNSLTW--ELMETPVYLKYLVIPELNDTDKKALIRCFHTRLCSSL 257
           S   +L  K ITS  L S  W  +L  TP+ + YL +P+ N +   +L+R   T+ C S 
Sbjct: 248 SIMRRLDTKDITSCMLVSKFWYRKLSTTPMIIDYLSVPKTNYSKINSLLRFVKTKRCVS- 306

Query: 258 DLISRFQFLTYQGSFTDDKTSDSQL 282
              S  Q+L +    T+++   SQL
Sbjct: 307 ---SVIQYLNFSVMATNEEAKCSQL 328

>TDEL0A04260 Chr1 (758507..759331) [825 bp, 274 aa] {ON} Anc_5.561
           YDR446W
          Length = 274

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 189 PGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDTDKKAL 245
           PGR+ +    S S  DK  +KQ       L  E  ETP+  +  V+   N + KK L
Sbjct: 75  PGRVGTATASSYSSKDKPLVKQEPEYSKGLIHEGTETPIKRQTNVVEAANSSKKKKL 131

>ADL108C Chr4 complement(494813..497158) [2346 bp, 781 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL038C
           (NOT3)
          Length = 781

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 20  LKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVKAMPNARLDRSCGRIL 79
           LK ++ P  +  G  +W V AA  A+ +   EK   L+A+ T   + P A +D S    L
Sbjct: 394 LKPATVPA-KPAGELKWAV-AAAQALEKEKREKSASLMAMKTQGASSPRATMDMSSTSQL 451

Query: 80  HDCHA 84
            D H+
Sbjct: 452 TDAHS 456

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,068,819
Number of extensions: 1810932
Number of successful extensions: 5572
Number of sequences better than 10.0: 26
Number of HSP's gapped: 5640
Number of HSP's successfully gapped: 26
Length of query: 384
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 273
Effective length of database: 40,753,473
Effective search space: 11125698129
Effective search space used: 11125698129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)