Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J020902.151ON92924666e-62
NCAS0G024702.151ON88682689e-32
KNAG0I021302.151ON92912681e-31
SAKL0E10978g2.151ON95902672e-31
NDAI0F028202.151ON128862659e-31
ZYRO0G06490g2.151ON92912593e-30
KLLA0F24068g2.151ON95692551e-29
TDEL0B051302.151ON93912515e-29
Skud_14.2102.151ON103662472e-28
KLTH0B05214g2.151ON91902463e-28
YNL122C2.151ON115662473e-28
Suva_14.2182.151ON112892464e-28
Ecym_82022.151ON98922447e-28
Smik_14.2062.151ON113662431e-27
CAGL0L04070g2.151ON95672384e-27
Kwal_33.147622.151ON91832375e-27
ABR133W2.151ON96702308e-26
Kpol_505.212.151ON85842037e-22
TPHA0F018802.151ON99691873e-19
TBLA0B012302.151ON97671492e-13
KNAG0B040805.466ON56853622.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J02090
         (92 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   184   6e-62
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...   107   9e-32
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   107   1e-31
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...   107   2e-31
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   106   9e-31
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   104   3e-30
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...   102   1e-29
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...   101   5e-29
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   100   2e-28
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    99   3e-28
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   100   3e-28
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...    99   4e-28
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    99   7e-28
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...    98   1e-27
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...    96   4e-27
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    96   5e-27
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    93   8e-26
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    83   7e-22
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    77   3e-19
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    62   2e-13
KNAG0B04080 Chr2 complement(780447..782150) [1704 bp, 568 aa] {O...    28   2.4  

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  184 bits (466), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%)

Query: 1  MLFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN 60
          MLFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN
Sbjct: 1  MLFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN 60

Query: 61 GGWSRRSLKCLTGRKTATPSQAKRLKRLLPFG 92
          GGWSRRSLKCLTGRKTATPSQAKRLKRLLPFG
Sbjct: 61 GGWSRRSLKCLTGRKTATPSQAKRLKRLLPFG 92

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
          Anc_2.151 YNL122C
          Length = 88

 Score =  107 bits (268), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (83%)

Query: 24 TLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAK 83
          TL I RNLMKTHKGTAKRWR+TA  FKRGIAGRNHGN GWSRRSLK L+GRK A PS  +
Sbjct: 20 TLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPSYLR 79

Query: 84 RLKRLLPF 91
           LKRL+P+
Sbjct: 80 HLKRLMPY 87

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  107 bits (268), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%)

Query: 1  MLFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN 60
          M F    S LF  G +  +  S ++I+ R+LMKTHKG AKRWRK ANGFKRGI+GR HGN
Sbjct: 1  MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60

Query: 61 GGWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
           GWS+R LK LTGR  A  SQ KRLK+LLP+
Sbjct: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPY 91

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score =  107 bits (267), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%)

Query: 2  LFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNG 61
          L +P  +     G+S+ + + P+L++ RNLMKTHKG AKRW+KTAN +KRG AGRNHGN 
Sbjct: 5  LLRPLSNISVKFGTSLSQIQHPSLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNHGNA 64

Query: 62 GWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
          GW++ +LK L G+  A P+  K LKRLLP+
Sbjct: 65 GWNKSTLKSLDGKTLAHPTHIKHLKRLLPY 94

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  106 bits (265), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 63/86 (73%), Gaps = 2/86 (2%)

Query: 6   FFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSR 65
           F + L +MG  +  +   +L+I RNLMKTHKG AKRWRK+A GFKRGIAGRNHGN GWS 
Sbjct: 44  FKTGLLSMG--LKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSH 101

Query: 66  RSLKCLTGRKTATPSQAKRLKRLLPF 91
           R L  LTGRK A P+  K LKR+LP+
Sbjct: 102 RYLNKLTGRKEADPTHVKHLKRMLPY 127

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
          similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
          ribosomal protein L35 and some similarites with YNL122C
          uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 92

 Score =  104 bits (259), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 67/91 (73%), Gaps = 5/91 (5%)

Query: 6  FFSALFTMGS-----SVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN 60
          FF+++  +GS     S     S +L+  RNLMKTHKGTAKRW+KTA+GFKRG AGRNHGN
Sbjct: 2  FFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGN 61

Query: 61 GGWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
           GWSRRSLK L+G+  A  S  +RL+RLLP+
Sbjct: 62 VGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
          to uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 95

 Score =  102 bits (255), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 54/69 (78%)

Query: 23 PTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQA 82
           +LI+ RNLMKTHKG AKRWRKTAN FKRG AGRNHGN GWSR SLK L+GR  A  +  
Sbjct: 26 SSLILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSLSGRSLADSTHM 85

Query: 83 KRLKRLLPF 91
           RLKRLLP+
Sbjct: 86 HRLKRLLPY 94

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
          Anc_2.151 YNL122C
          Length = 93

 Score =  101 bits (251), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 1/91 (1%)

Query: 1  MLFKPFFSALF-TMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHG 59
          M F    + +F T  ++  + E+P+LI+ R+LMKTHKG AKRWRKTA  FKRG AGR+HG
Sbjct: 2  MFFSSIINPIFRTCLNTFSKVEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHG 61

Query: 60 NGGWSRRSLKCLTGRKTATPSQAKRLKRLLP 90
          N GWSRRSLK L+G+  A  +  K LKRL+P
Sbjct: 62 NAGWSRRSLKSLSGKTLAHETHIKHLKRLMP 92

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/66 (75%), Positives = 53/66 (80%)

Query: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85
           I  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRKTA P+  K L
Sbjct: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96

Query: 86  KRLLPF 91
           KRLLP+
Sbjct: 97  KRLLPY 102

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 99.4 bits (246), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 60/90 (66%)

Query: 2  LFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNG 61
          +      ++ + G  + + + P ++  RNLMKTHKGTAKRWRKT+  +KRG AGRNHGN 
Sbjct: 1  MLSNLMRSIMSYGRQITQLQQPFMMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNA 60

Query: 62 GWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
          GW + +LK L G+  A P+  K LKRLLP+
Sbjct: 61 GWGKSTLKSLDGKTLAHPTHIKHLKRLLPY 90

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score = 99.8 bits (247), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 53/66 (80%)

Query: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85
           I  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRK A P+ +K L
Sbjct: 49  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHL 108

Query: 86  KRLLPF 91
           KRLLP+
Sbjct: 109 KRLLPY 114

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score = 99.4 bits (246), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 55/89 (61%), Positives = 58/89 (65%), Gaps = 8/89 (8%)

Query: 3   FKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGG 62
           FKP  + L     S         I  R LMKTHKGTAKRWR+T N FKRGIAGR HGN G
Sbjct: 31  FKPRLNQLLFNNVST--------ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIG 82

Query: 63  WSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
           WS RSLK LTGRKTA  S  K LKRLLP+
Sbjct: 83  WSHRSLKVLTGRKTANSSYLKHLKRLLPY 111

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
          similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 98.6 bits (244), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 62/92 (67%), Gaps = 2/92 (2%)

Query: 2  LFKPF--FSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHG 59
          LF+P    ++ F  G          LI +R+LMKTHKG AKRWRKTAN FKRG AGR+HG
Sbjct: 6  LFRPLEKLTSRFGGGVGCGSVGVSYLIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHG 65

Query: 60 NGGWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91
          N GWS+ SLK L+GR  A  SQ  RLKRLLP+
Sbjct: 66 NSGWSKNSLKVLSGRALANGSQLNRLKRLLPY 97

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score = 98.2 bits (243), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 52/66 (78%)

Query: 26  IIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKRL 85
           +  R LMKTHKGTAKRWR+T N FKRGIAGR HGN GWS RSLK LTGRKTA  +  K L
Sbjct: 47  VTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLKHL 106

Query: 86  KRLLPF 91
           KRLLP+
Sbjct: 107 KRLLPY 112

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
          similar to uniprot|P53921 Saccharomyces cerevisiae
          YNL122c
          Length = 95

 Score = 96.3 bits (238), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 53/67 (79%)

Query: 25 LIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKR 84
          ++  R LMKTH+G  KRWR+T+ GFKRGIAGR HGN GWS RSLK LTGR  A P+Q KR
Sbjct: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87

Query: 85 LKRLLPF 91
          L+RL+P+
Sbjct: 88 LRRLMPY 94

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
          YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 95.9 bits (237), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (69%)

Query: 9  ALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSL 68
          ++F+ G S  + + P +   RNLMKTHKGTAKRWRKT+  +KRG AGRNHGN GW + +L
Sbjct: 8  SVFSFGKSFSQIQQPFMQQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTL 67

Query: 69 KCLTGRKTATPSQAKRLKRLLPF 91
          K L G+  A  +  K LKRLLP+
Sbjct: 68 KALDGKTLAHSTHIKHLKRLLPY 90

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 93.2 bits (230), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 44/70 (62%), Positives = 54/70 (77%)

Query: 22 SPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQ 81
           P+LI+ R LMKTHKG AKRWRKTA G+KR  AGR+HGN GW +R+LK L+GR  A  + 
Sbjct: 26 QPSLIMVRTLMKTHKGAAKRWRKTAGGYKRSKAGRSHGNTGWGQRALKQLSGRTMAASAH 85

Query: 82 AKRLKRLLPF 91
           KRL+RLLP+
Sbjct: 86 LKRLRRLLPY 95

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON}
          (56756..57013) [258 nt, 86 aa]
          Length = 85

 Score = 82.8 bits (203), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 2/84 (2%)

Query: 10 LFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWR--KTANGFKRGIAGRNHGNGGWSRRS 67
          +F + + +   +   L I R+LMKTHKGTAKRW+  K+ + FKRG +GR HGN GWS+RS
Sbjct: 1  MFGINTGLFNSKISILQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRS 60

Query: 68 LKCLTGRKTATPSQAKRLKRLLPF 91
          LK L+GR  A  +   RL++LLP+
Sbjct: 61 LKHLSGRTYAHTTHVSRLRKLLPY 84

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
          YNL122C
          Length = 99

 Score = 76.6 bits (187), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (2%)

Query: 25 LIIARNLMKTHKGTAKRWRKTA--NGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQA 82
          L   R LMKTHKGTAKRW+  +  + FKRG +GR HGN GWS+RSLK L+GR  A  +  
Sbjct: 30 LDFRRTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHV 89

Query: 83 KRLKRLLPF 91
           +L++LLP+
Sbjct: 90 SKLRKLLPY 98

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
          Anc_2.151 YNL122C
          Length = 97

 Score = 62.0 bits (149), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 7/67 (10%)

Query: 32 MKTHKGTAKRWRK-------TANGFKRGIAGRNHGNGGWSRRSLKCLTGRKTATPSQAKR 84
          +KTHKGT KRWR+        A  F R  AGRNHGN GWS R+L  L+ R  A  +  K 
Sbjct: 31 LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 85 LKRLLPF 91
          L++LLP+
Sbjct: 91 LRKLLPY 97

>KNAG0B04080 Chr2 complement(780447..782150) [1704 bp, 568 aa] {ON}
           Anc_5.466 YOR132W gene extends into a gap in the genome
           sequence
          Length = 568

 Score = 28.5 bits (62), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 9   ALFTMGSSVVRRESPTLII--ARNLMKTHKGTAKRWRKTANGFKRGIAGRNHG 59
           AL   GS   +RE+PT++   +  L   HK   K  +KT + F+R +A  N G
Sbjct: 111 ALERTGSLSNKRENPTVVFHCSTTLPTFHKQQYKGVKKTMDEFRRYVAYLNKG 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.135    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,861,277
Number of extensions: 287767
Number of successful extensions: 820
Number of sequences better than 10.0: 21
Number of HSP's gapped: 817
Number of HSP's successfully gapped: 21
Length of query: 92
Length of database: 53,481,399
Length adjustment: 63
Effective length of query: 29
Effective length of database: 46,257,441
Effective search space: 1341465789
Effective search space used: 1341465789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)