Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J013702.284ON78078038440.0
Skud_9.782.284ON80984216460.0
Smik_9.842.284ON80836914120.0
Suva_9.1042.284ON80536014000.0
YIL095W (PRK1)2.284ON81033713960.0
TDEL0G021502.284ON66134713780.0
KAFR0H033302.284ON36932713351e-179
NCAS0B062602.284ON72336313571e-177
NDAI0B035602.284ON75636613451e-175
Kpol_1003.352.284ON71331613221e-172
TPHA0C033802.284ON69732013151e-171
Kwal_27.115422.284ON79131613181e-170
NDAI0G006402.284ON62131612981e-170
CAGL0G02607g2.284ON68832412961e-168
KLLA0E08405g2.284ON77732612991e-167
Smik_14.3112.284ON63736512831e-167
KLTH0G10318g2.284ON79031612971e-167
NCAS0G038102.284ON66138512821e-167
YNL020C (ARK1)2.284ON63836512701e-165
Skud_14.3092.284ON63936212691e-165
Ecym_33232.284ON74878512671e-163
ZYRO0A01848g2.284ON70434312591e-163
Suva_14.3272.284ON63234912431e-161
ADL217W2.284ON75034112531e-161
TBLA0B059302.284ON71731412371e-159
Kpol_1039.332.284ON70132912271e-158
KNAG0H020202.284ON59232512131e-157
TBLA0B069402.284ON144332311961e-146
KNAG0A054302.284ON78831811461e-144
CAGL0J03432g2.284ON62236911311e-144
TPHA0D015402.284ON70732010241e-127
KNAG0J008203.273ON10913487788e-89
CAGL0H10208g3.273ON10273267689e-88
Kpol_1052.223.273ON11013167603e-86
KAFR0A010403.273ON9123267523e-86
CAGL0K11990g3.273ON9913227467e-85
Smik_2.1913.273ON11083427491e-84
KNAG0H012203.273ON9133317383e-84
YBR059C (AKL1)3.273ON11083427463e-84
Kpol_251.43.273ON8383267334e-84
SAKL0D03234g3.273ON8583167336e-84
TBLA0E025903.273ON10613197401e-83
KAFR0C004303.273ON9493237298e-83
KLLA0F18612g3.273ON8143147202e-82
Suva_4.2973.273ON11073407289e-82
Ecym_26503.273ON8943177162e-81
Skud_2.1793.273ON10903207233e-81
ZYRO0E06864g3.273ON11153567234e-81
NDAI0A057003.273ON11573317245e-81
KLTH0C07260g3.273ON9013177138e-81
Kwal_27.109453.273ON9353197149e-81
TDEL0D035203.273ON10493207181e-80
AGR027C3.273ON9613147062e-79
NCAS0A105903.273ON10953207102e-79
TPHA0A040303.273ON10543227065e-79
TBLA0I019303.273ON13613397135e-79
TPHA0M011203.273ON7883266893e-78
Kwal_56.242746.262ON3463382371e-20
SAKL0E07722g2.284ON7912212451e-20
CAGL0J11638g6.31ON7462752352e-19
Kpol_1023.266.31ON7392752317e-19
Kpol_1037.206.31ON7042832317e-19
KAFR0A050906.31ON6682832299e-19
TDEL0G043806.31ON7222832235e-18
Smik_13.1596.31ON7052742235e-18
Skud_13.1546.31ON7052742236e-18
KNAG0E008506.31ON7112822236e-18
YMR001C (CDC5)6.31ON7052742227e-18
TPHA0J004206.31ON7073432228e-18
NDAI0C026806.31ON7502742229e-18
Suva_13.1636.31ON7052742211e-17
ZYRO0C07480g6.31ON7742832211e-17
NCAS0D021006.31ON7263082192e-17
SAKL0A03344g6.262ON3643552123e-17
ACL006W6.31ON7082742173e-17
YPL236C (ENV7)6.262ON3643292113e-17
KAFR0G026906.31ON7132742164e-17
Suva_16.706.262ON3643422095e-17
TPHA0F024306.31ON7982762156e-17
Ecym_30356.31ON7402762121e-16
Kpol_1072.198.668ON8962022131e-16
Suva_16.1608.668ON9182992121e-16
KLTH0H03080g6.262ON3463332042e-16
TDEL0A067506.262ON3723012052e-16
SAKL0H06754g8.668ON8842072093e-16
NCAS0G012106.262ON3673442034e-16
Smik_1.793.177ON9742692094e-16
TDEL0A027202.496ON9152772075e-16
KLLA0C06138g6.31ON7082742066e-16
KNAG0F002901.52ON11253472077e-16
Skud_16.426.262ON3643292008e-16
KNAG0F001701.24ON5432332048e-16
YAR019C (CDC15)3.177ON9742692059e-16
KLTH0C10912g6.31ON6972872041e-15
TBLA0B004906.31ON7872752041e-15
KLTH0F16676g5.406ON8782782041e-15
Skud_16.1328.668ON9242992032e-15
SAKL0E01584g6.31ON6952762022e-15
Kwal_56.224766.31ON6972762012e-15
ZYRO0D05500g7.86ON12621802022e-15
Smik_6.4416.262ON3643311962e-15
CAGL0K08514g2.479ON14892252023e-15
TBLA0A047207.86ON12622882013e-15
Kwal_26.71547.86ON12132862013e-15
NDAI0K021002.496ON9092352003e-15
KNAG0B053502.496ON8362332004e-15
NCAS0C016708.668ON8962021995e-15
TPHA0E038501.24ON4821941966e-15
Skud_1.723.177ON9742671986e-15
Kwal_26.78612.496ON9552711987e-15
Sklu_YGOB_Anc_2.4962.496ON6192691977e-15
Ecym_10301.24ON4402771957e-15
CAGL0I07513g3.92ON10762281979e-15
Kpol_1055.242.496ON9372801971e-14
NCAS0C041008.141ON9053241971e-14
TPHA0G032902.496ON9732321971e-14
KAFR0D012207.86ON10551921952e-14
KLTH0F00946g1.24ON5121941922e-14
KLTH0D02486g7.86ON12232861942e-14
CAGL0M02299g8.668ON8932091942e-14
KNAG0F029006.31ON6492881922e-14
Kwal_33.131121.24ON5051941913e-14
ZYRO0B01166g2.496ON9632891923e-14
KLTH0G05214g5.591ON6532811913e-14
Skud_10.1191.271ON14812911924e-14
SAKL0C01716g1.52ON12153061915e-14
AFR724C1.24ON4402751875e-14
KNAG0D048107.86ON14401801916e-14
KLLA0B13607g2.496ON9892171906e-14
YJL095W (BCK1)1.271ON14782911907e-14
Suva_6.1691.271ON14842911908e-14
ZYRO0F07194g8.668ON9382951898e-14
NDAI0E012908.654ON7292361888e-14
Kpol_1044.37.86ON9321801899e-14
KLLA0C12485g3.92ON9252861881e-13
KLLA0E03587g5.591ON6472801871e-13
Ecym_52513.177ON8932841881e-13
YPL150W8.668ON9013001881e-13
Suva_1.863.177ON9742671881e-13
KLTH0D06006g2.496ON9542711881e-13
Smik_8.422.496ON9391761881e-13
Suva_7.838.140ON5692421861e-13
YHL007C (STE20)2.496ON9392301871e-13
KAFR0C014403.92ON10952251871e-13
TBLA0A071501.52ON13912941871e-13
CAGL0M10153g2.496ON8672361871e-13
NDAI0F045201.24ON4891961851e-13
Kpol_1065.36.222ON3762701821e-13
YDR490C (PKH1)3.92ON7661961862e-13
Kpol_463.81.271ON14472941872e-13
NDAI0H024707.86ON14112931872e-13
ABL034W2.479ON14252231872e-13
Kwal_55.215455.406ON8652041862e-13
KLLA0E21693g5.406ON10162231862e-13
KLLA0C01650g1.52ON11122931862e-13
SAKL0C00946g1.24ON5641951842e-13
SAKL0C09174g3.92ON10712901862e-13
Kpol_431.92.479ON15522321862e-13
AFL101C6.222ON3672721812e-13
TBLA0H016605.406ON9962301852e-13
TDEL0H036407.86ON12372911852e-13
Smik_10.1471.271ON14782911853e-13
Smik_6.3478.668ON9173001853e-13
Skud_8.392.496ON9231761843e-13
TDEL0C067801.24ON4682761823e-13
TBLA0B082503.92ON13471961853e-13
Suva_2.6663.92ON7642871843e-13
Smik_4.7673.92ON7582001843e-13
TBLA0I002802.496ON13162741843e-13
CAGL0H06259g7.86ON13362851843e-13
TPHA0H026307.86ON13672421843e-13
KLLA0F07623g7.86ON12293111843e-13
Skud_7.928.140ON5632091824e-13
NCAS0B044906.222ON3492481784e-13
Ecym_10581.52ON11642361834e-13
Suva_8.472.496ON9801761834e-13
TBLA0D022308.141ON11543081834e-13
NCAS0A050502.496ON8932311834e-13
KAFR0D033902.496ON7982541825e-13
ZYRO0E07876g6.262ON3693361785e-13
Kpol_1040.207.86ON12972391835e-13
Skud_16.3403.338ON3882271786e-13
Kpol_1054.23.92ON10962921826e-13
AFR696C1.52ON11422801817e-13
TPHA0E036401.52ON11372361817e-13
Suva_11.1232.479ON15262481818e-13
ZYRO0C06776g5.591ON8902721818e-13
KLTH0C09548g3.92ON9931571818e-13
KAFR0A083603.60ON8292211808e-13
NDAI0G034508.141ON9483201801e-12
CAGL0K02673g2.496ON9152471801e-12
Ecym_24342.496ON11222711801e-12
NDAI0A061303.60ON8192421791e-12
KAFR0D041001.52ON11173001801e-12
CAGL0F00913g7.86ON12062891801e-12
KNAG0K023703.60ON8831981791e-12
NCAS0A099603.60ON7902471791e-12
TDEL0D053203.92ON10572241791e-12
KAFR0D049505.406ON10082371791e-12
Kpol_2002.241.24ON4871931771e-12
ABR014W2.496ON9712221791e-12
Smik_7.938.140ON5632151781e-12
Skud_4.7643.92ON7562911781e-12
CAGL0G04609g3.92ON9652931791e-12
Ecym_12751.374ON4512831761e-12
Ecym_73922.479ON14342071791e-12
KLTH0E06754g8.141ON8733801781e-12
SAKL0H16632g8.279ON10622081791e-12
KNAG0D008306.262ON3873001752e-12
CAGL0H00979g6.262ON3991511752e-12
Ecym_35863.92ON10771911782e-12
AER223C3.177ON9022801782e-12
KAFR0G012001.24ON5072671762e-12
KLLA0A07403g3.60ON8792381772e-12
NDAI0A006601.52ON10222811782e-12
AFR335C3.92ON10331951772e-12
KLLA0F11319g8.668ON8431931772e-12
YDR507C (GIN4)1.52ON11423471772e-12
CAGL0K05709g1.52ON11032361772e-12
KAFR0A017602.496ON8851761772e-12
KAFR0B028008.279ON10952061772e-12
KLLA0B02332g6.222ON3612201722e-12
TBLA0E022907.86ON13002421773e-12
Kwal_56.226933.92ON9842251763e-12
ZYRO0F18062g1.24ON4711931743e-12
TPHA0G032002.479ON15342071763e-12
SAKL0H07084g8.654ON9192411753e-12
KNAG0D040404.192ON4382311734e-12
YDR523C (SPS1)1.24ON4901961734e-12
Skud_11.1262.479ON15182181764e-12
KNAG0K012403.177ON9802191754e-12
Smik_16.2963.338ON3882411714e-12
KNAG0L005207.86ON3683121714e-12
ACR133C8.668ON8511931754e-12
KLTH0F01672g1.52ON11642281754e-12
NCAS0B086001.52ON11172361745e-12
KLTH0D11044g8.668ON8492441745e-12
TDEL0A025502.479ON13692221745e-12
KAFR0K007007.86ON13812391745e-12
CAGL0B01925g8.279ON9442121745e-12
ACL104C5.406ON9472031745e-12
YOL100W (PKH2)3.92ON10812301746e-12
YGL179C (TOS3)8.140ON5601741726e-12
YNL298W (CLA4)3.60ON8422091736e-12
Suva_16.3823.338ON3982401706e-12
NCAS0A053706.341ON15082971746e-12
NDAI0F016006.222ON4122201706e-12
KLLA0C17160g8.141ON8313031736e-12
TDEL0A075606.341ON15752791737e-12
YOL045W (PSK2)7.86ON11012891737e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01370
         (780 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...  1485   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   638   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   548   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   543   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   542   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   535   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   518   e-179
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   527   e-177
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   522   e-175
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   513   e-172
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   511   e-171
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   512   e-170
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    504   e-170
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   503   e-168
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   504   e-167
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   498   e-167
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   504   e-167
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   498   e-167
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   493   e-165
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   493   e-165
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   492   e-163
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   489   e-163
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   483   e-161
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   487   e-161
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   481   e-159
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   477   e-158
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   471   e-157
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   465   e-146
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   446   e-144
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   440   e-144
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   399   e-127
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   304   8e-89
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   300   9e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   297   3e-86
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   294   3e-86
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   291   7e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   293   1e-84
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   288   3e-84
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   291   3e-84
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   286   4e-84
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   286   6e-84
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   289   1e-83
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   285   8e-83
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   281   2e-82
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   285   9e-82
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   280   2e-81
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   283   3e-81
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   283   4e-81
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   283   5e-81
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   279   8e-81
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   279   9e-81
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   281   1e-80
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   276   2e-79
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   278   2e-79
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   276   5e-79
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   279   5e-79
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   270   3e-78
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    96   1e-20
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    99   1e-20
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    95   2e-19
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    94   7e-19
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    94   7e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             93   9e-19
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    91   5e-18
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    91   5e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    91   6e-18
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    91   6e-18
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    90   7e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    90   8e-18
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    90   9e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    90   1e-17
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    90   1e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      89   2e-17
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    86   3e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    88   3e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    86   3e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    88   4e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    85   5e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    87   6e-17
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    86   1e-16
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    87   1e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    86   1e-16
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    83   2e-16
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    84   2e-16
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    85   3e-16
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    83   4e-16
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    85   4e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    84   5e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    84   6e-16
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    84   7e-16
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    82   8e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    83   8e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    84   9e-16
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    83   1e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    83   1e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    83   1e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    83   2e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    82   2e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    82   2e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    82   2e-15
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    80   2e-15
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    82   3e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    82   3e-15
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    82   3e-15
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    82   3e-15
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    82   4e-15
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    81   5e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    80   6e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    81   6e-15
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    81   7e-15
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    80   7e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    80   7e-15
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    80   9e-15
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    80   1e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     80   1e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    80   1e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    80   2e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    79   2e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    79   2e-14
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    79   2e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               79   2e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    78   3e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   3e-14
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    78   3e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    79   4e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    78   5e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    77   5e-14
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    78   6e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    78   6e-14
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    78   7e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    78   8e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    77   8e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    77   8e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    77   9e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    77   1e-13
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    77   1e-13
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    77   1e-13
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    77   1e-13
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    77   1e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    77   1e-13
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    77   1e-13
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    76   1e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    77   1e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    77   1e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    77   1e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    77   1e-13
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    76   1e-13
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    75   1e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    76   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    77   2e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    77   2e-13
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    77   2e-13
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    76   2e-13
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    76   2e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    76   2e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    75   2e-13
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    76   2e-13
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    76   2e-13
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    74   2e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    76   2e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    76   2e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    76   3e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    76   3e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    75   3e-13
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    75   3e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    76   3e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    75   3e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    75   3e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    75   3e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   3e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    75   3e-13
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    75   3e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    75   4e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     73   4e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    75   4e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    75   4e-13
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    75   4e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   4e-13
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    75   5e-13
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    73   5e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    75   5e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    73   6e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    75   6e-13
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    74   7e-13
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    74   7e-13
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    74   8e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   8e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    74   8e-13
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    74   8e-13
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     74   1e-12
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    74   1e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    74   1e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    74   1e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    74   1e-12
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    74   1e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    74   1e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    74   1e-12
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    74   1e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    74   1e-12
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    73   1e-12
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    74   1e-12
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    73   1e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    73   1e-12
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    74   1e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    72   1e-12
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    74   1e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    73   1e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    74   1e-12
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    72   2e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    72   2e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    73   2e-12
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    73   2e-12
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    72   2e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    73   2e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     73   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    73   2e-12
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    73   2e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    73   2e-12
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    73   2e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    73   2e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    73   2e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    71   2e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    73   3e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    72   3e-12
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    72   3e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    72   3e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    72   3e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    71   4e-12
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    71   4e-12
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    72   4e-12
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    72   4e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    70   4e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   4e-12
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    72   4e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    72   4e-12
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    72   5e-12
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    72   5e-12
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    72   5e-12
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    72   5e-12
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    72   5e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    72   5e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    72   6e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    71   6e-12
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    71   6e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    70   6e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    72   6e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    70   6e-12
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    71   6e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    71   7e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    71   7e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    71   7e-12
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    71   8e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    71   8e-12
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    71   8e-12
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    71   8e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    70   8e-12
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    71   9e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    71   9e-12
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    71   9e-12
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    71   1e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    70   1e-11
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    71   1e-11
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     70   1e-11
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    71   1e-11
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    71   1e-11
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    71   1e-11
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    70   1e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    70   1e-11
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    70   1e-11
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    70   1e-11
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    70   1e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    70   1e-11
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    70   1e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    70   1e-11
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    70   1e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    70   1e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    70   1e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    70   1e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    70   1e-11
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    70   1e-11
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    70   1e-11
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    70   1e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    69   1e-11
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    70   2e-11
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    70   2e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    70   2e-11
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    70   2e-11
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    70   2e-11
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    70   2e-11
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    70   2e-11
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    69   2e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    69   2e-11
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    69   2e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   2e-11
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    68   2e-11
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    69   2e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    69   2e-11
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    69   2e-11
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    69   3e-11
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    70   3e-11
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    69   3e-11
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    69   3e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    69   3e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    69   3e-11
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    69   3e-11
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    69   3e-11
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    68   3e-11
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    68   3e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   3e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   3e-11
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    69   3e-11
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    68   3e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    69   4e-11
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    69   4e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    69   4e-11
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    69   4e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    69   4e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    69   4e-11
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    69   4e-11
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    69   4e-11
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    69   4e-11
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    69   4e-11
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    69   4e-11
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    69   4e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    67   4e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    67   4e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    67   4e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   4e-11
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    68   4e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    69   4e-11
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    69   5e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    69   5e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    68   5e-11
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    68   5e-11
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    69   5e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    67   5e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    68   5e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    68   5e-11
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    69   5e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    68   5e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    68   5e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    68   5e-11
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    68   5e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    69   5e-11
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    69   5e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    68   5e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    68   5e-11
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    68   6e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    68   6e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    68   6e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    68   6e-11
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    68   6e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    68   6e-11
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    68   6e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    68   6e-11
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    68   6e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    68   6e-11
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    68   6e-11
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    68   6e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    68   6e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    68   7e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    68   7e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    68   7e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    68   7e-11
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        67   7e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   7e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    67   7e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    68   7e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    68   7e-11
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    68   8e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    68   8e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    67   8e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    68   8e-11
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    68   8e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    67   9e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   9e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    68   9e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    68   9e-11
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    67   9e-11
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    67   1e-10
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    67   1e-10
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    67   1e-10
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    67   1e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   1e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       67   1e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    67   1e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    67   1e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    67   1e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    67   1e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    67   1e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              67   1e-10
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    67   1e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    67   1e-10
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    67   1e-10
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    67   1e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    67   1e-10
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    67   1e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    67   1e-10
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   1e-10
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    67   1e-10
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    67   2e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    67   2e-10
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    67   2e-10
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    67   2e-10
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    67   2e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    67   2e-10
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    66   2e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    66   2e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    65   2e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    66   2e-10
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    66   2e-10
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              66   2e-10
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    66   2e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    66   3e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    65   3e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    66   3e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    66   3e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    66   3e-10
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    65   3e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    65   3e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    65   3e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     65   3e-10
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    66   4e-10
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    66   4e-10
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    65   4e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    64   4e-10
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      65   4e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    65   4e-10
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    65   5e-10
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    65   5e-10
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    65   5e-10
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    64   5e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    65   5e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    65   5e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    64   5e-10
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    65   5e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   6e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    65   6e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    65   6e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    65   6e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     65   6e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    64   6e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   7e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    64   7e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    64   7e-10
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    65   7e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    65   8e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    65   8e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    64   8e-10
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    64   8e-10
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    64   8e-10
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    64   9e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   9e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    64   9e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    64   9e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    64   9e-10
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    64   9e-10
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    64   9e-10
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    64   1e-09
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               64   1e-09
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    64   1e-09
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    64   1e-09
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    64   1e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    63   1e-09
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    64   1e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    64   1e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    64   1e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    63   1e-09
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    64   1e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    63   1e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    63   1e-09
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    64   1e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   1e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    63   1e-09
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    63   1e-09
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    64   1e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    63   1e-09
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    64   1e-09
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    64   1e-09
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    64   1e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    64   2e-09
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    64   2e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    64   2e-09
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     63   2e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    64   2e-09
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    64   2e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    62   2e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    64   2e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    63   2e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    64   2e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    64   2e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    64   2e-09
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    63   2e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    62   2e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    63   2e-09
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    62   2e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    62   2e-09
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    63   2e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    62   2e-09
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    63   2e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    62   3e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              62   3e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    63   3e-09
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    63   3e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    62   3e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    62   3e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    62   3e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    62   3e-09
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    62   3e-09
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    63   3e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    62   3e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    62   3e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    63   3e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    62   3e-09
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    62   3e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    62   3e-09
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    62   3e-09
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               62   3e-09
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    62   4e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    62   4e-09
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    62   4e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    62   4e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    62   4e-09
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    62   4e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    62   4e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    62   4e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    61   4e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              62   4e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    61   4e-09
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    62   4e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   4e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   4e-09
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    62   4e-09
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    62   5e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    62   5e-09
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    62   5e-09
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    61   5e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    62   5e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    62   5e-09
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    62   5e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    62   5e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    62   5e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    61   5e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    62   5e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    62   5e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    62   6e-09
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    61   6e-09
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    62   6e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    61   6e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    61   6e-09
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    62   6e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    61   6e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    62   7e-09
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    61   7e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    60   7e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    61   7e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    60   7e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    61   7e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    61   8e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    61   8e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    61   8e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    61   8e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    61   8e-09
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    61   8e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    61   8e-09
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    61   8e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    61   8e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    61   8e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    60   8e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     60   8e-09
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    60   8e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    61   8e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    60   9e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    61   9e-09
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     61   9e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    60   9e-09
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    60   9e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    60   1e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    60   1e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    60   1e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    60   1e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    60   1e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    60   1e-08
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    60   1e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    61   1e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    60   1e-08
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    60   1e-08
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    60   1e-08
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    59   1e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    60   1e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    61   1e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    60   1e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    60   1e-08
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    60   1e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    59   2e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    60   2e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   2e-08
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    60   2e-08
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       59   2e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    60   2e-08
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    60   2e-08
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    60   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    59   2e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    60   2e-08
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    59   2e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    60   2e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   2e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    60   2e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    60   2e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    60   2e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    59   2e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    59   2e-08
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    60   2e-08
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    60   2e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    59   2e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    60   2e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    59   3e-08
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    59   3e-08
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               59   3e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    60   3e-08
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    59   3e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    60   3e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   3e-08
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    59   3e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    59   3e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    60   3e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    59   3e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    59   3e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    59   3e-08
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    58   3e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     59   3e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    59   3e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    59   3e-08
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               59   3e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    58   3e-08
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    59   3e-08
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    59   4e-08
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    59   4e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    58   4e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    59   4e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    58   4e-08
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    59   4e-08
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    59   4e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    58   4e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    59   4e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    58   4e-08
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    59   4e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    59   4e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    59   4e-08
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    59   4e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    57   4e-08
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    59   5e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    58   5e-08
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    58   5e-08
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    58   5e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    58   5e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    58   5e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               59   5e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    58   5e-08
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    59   5e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    58   5e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    58   5e-08
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    58   5e-08
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    58   6e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    58   6e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    58   6e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    59   6e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    57   6e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    58   6e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   6e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    57   6e-08
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    57   6e-08
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    58   6e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    59   7e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    57   7e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    59   7e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    57   7e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    57   7e-08
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    58   7e-08
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    58   7e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    58   7e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    58   7e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    58   7e-08
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    58   8e-08
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    58   8e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    58   8e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    58   8e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    57   8e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               58   8e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    57   8e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    57   8e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    58   9e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    57   9e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    57   9e-08
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    57   9e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    57   1e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   1e-07
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    57   1e-07
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    57   1e-07
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    57   1e-07
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    57   1e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    57   1e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    57   1e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    57   1e-07
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    57   1e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    57   1e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    57   1e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    57   1e-07
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    57   1e-07
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    56   1e-07
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    56   1e-07
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    57   1e-07
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    57   1e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              56   1e-07
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    57   2e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    57   2e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   2e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    56   2e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    56   2e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    57   2e-07
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    57   2e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   2e-07
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    57   2e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     57   2e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    57   2e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    57   2e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    56   2e-07
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    56   2e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               56   2e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    57   2e-07
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    56   2e-07
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    56   2e-07
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    56   2e-07
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    56   2e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    55   2e-07
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    55   2e-07
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    56   2e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    57   2e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    56   2e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    56   2e-07
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    57   2e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    57   2e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    56   2e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    56   2e-07
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    56   2e-07
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    57   2e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    56   2e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    56   2e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    55   3e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    56   3e-07
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    56   3e-07
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    55   3e-07
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    56   3e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    56   3e-07
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    56   3e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    55   3e-07
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    55   3e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    56   3e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    56   3e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   3e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    56   3e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    56   3e-07
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    55   3e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    55   3e-07
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    55   3e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    55   3e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    56   3e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   3e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   3e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    56   3e-07
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    56   3e-07
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    56   3e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    55   3e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    55   3e-07
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    56   3e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    55   3e-07
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    55   3e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    55   4e-07
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    56   4e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    56   4e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    56   4e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    55   4e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    55   4e-07
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    55   4e-07
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    55   4e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    54   4e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    55   4e-07
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    55   4e-07
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    55   5e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    55   5e-07
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    55   5e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    54   5e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    55   5e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   5e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    55   5e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    55   5e-07
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    55   5e-07
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    55   5e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    55   5e-07
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    55   5e-07
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     54   5e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    54   5e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    54   6e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    55   6e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              55   6e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    53   6e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    55   6e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    54   6e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    55   6e-07
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    55   6e-07
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    55   6e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    55   6e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               54   6e-07
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              55   6e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    55   6e-07
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    55   6e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   6e-07
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    55   6e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    54   7e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    55   7e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    55   7e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    54   7e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    55   7e-07
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    55   7e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    55   7e-07
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    55   7e-07
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    54   8e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    55   8e-07
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    54   8e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    54   8e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    55   8e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    54   8e-07
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    54   8e-07
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    54   8e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    54   8e-07
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    54   9e-07
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    55   9e-07
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    55   9e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   9e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    55   9e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    54   9e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    54   9e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    53   9e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    54   9e-07
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    54   9e-07
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    54   9e-07
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    54   9e-07
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    54   9e-07
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    54   9e-07
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    53   9e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    53   9e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    54   1e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    54   1e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    54   1e-06
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    54   1e-06
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    54   1e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              55   1e-06
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    54   1e-06
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    54   1e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    54   1e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    54   1e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    54   1e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    54   1e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    54   1e-06
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    54   1e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    54   1e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    54   1e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              54   1e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    54   1e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   1e-06
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   1e-06
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    54   1e-06
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    54   1e-06
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    54   1e-06
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    54   1e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    54   1e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    53   1e-06
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    54   1e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    54   1e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    54   1e-06
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    54   1e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    54   1e-06
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   1e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   1e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    54   1e-06
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    54   1e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    54   1e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    54   1e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    54   1e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    54   1e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   1e-06
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    54   1e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    54   1e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    54   1e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    54   1e-06
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    53   1e-06
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    53   1e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    54   1e-06
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    54   2e-06
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    54   2e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    54   2e-06
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    54   2e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    54   2e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              54   2e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    52   2e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    53   2e-06
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    54   2e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    53   2e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    52   2e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    54   2e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   2e-06
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    54   2e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    54   2e-06
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    54   2e-06
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     53   2e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    54   2e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    53   2e-06
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    53   2e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    53   2e-06
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    54   2e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    54   2e-06
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    54   2e-06
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    53   2e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    53   2e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    53   2e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    53   2e-06
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    53   2e-06
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    53   2e-06
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    53   2e-06
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    53   2e-06
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    52   2e-06
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    52   2e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    53   2e-06
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    53   2e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    53   2e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    53   2e-06
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    53   2e-06
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    53   2e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    52   2e-06
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    53   2e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    53   3e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    53   3e-06
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    53   3e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    53   3e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    53   3e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    53   3e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    53   3e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    53   3e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    53   3e-06
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    53   3e-06
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    53   3e-06
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    52   3e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    52   3e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    52   3e-06
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    53   3e-06
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    53   3e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    53   3e-06
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    53   3e-06
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    53   3e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    53   3e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    53   3e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    52   3e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    52   3e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     53   3e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    53   3e-06
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    52   3e-06
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    52   3e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    52   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   3e-06
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    52   3e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    53   3e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    52   3e-06
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    52   3e-06
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    52   3e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    52   3e-06
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    52   3e-06
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    52   3e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    52   4e-06
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    52   4e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    52   4e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    52   4e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    52   4e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     52   4e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    52   4e-06
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    52   4e-06
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    52   4e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     52   4e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    52   4e-06
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    52   4e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    51   4e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     52   4e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    52   4e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   4e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    52   4e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    52   4e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    52   4e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    52   4e-06
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    52   4e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    52   4e-06
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    52   4e-06
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    52   4e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     52   5e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    52   5e-06
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    52   5e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   5e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    52   5e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    52   5e-06
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    52   5e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    51   5e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    51   5e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    51   5e-06
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    52   5e-06
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    52   5e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    51   5e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    52   6e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    52   6e-06
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    52   6e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    52   6e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    51   6e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    50   6e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    52   6e-06
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    51   6e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    52   6e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    52   6e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    52   6e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   6e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    52   6e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   7e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   7e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    51   7e-06
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    50   7e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    52   7e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    51   7e-06
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    51   7e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    52   7e-06
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    52   7e-06
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    50   8e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    51   8e-06
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    51   8e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    51   8e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    51   8e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    51   8e-06
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    51   8e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    51   8e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    51   8e-06
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    51   8e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    51   9e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    50   9e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    51   9e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    51   9e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    51   9e-06
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    51   9e-06
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    51   9e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    50   9e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    51   1e-05
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    51   1e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    51   1e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    51   1e-05
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    51   1e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   1e-05
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    51   1e-05
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    50   1e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    51   1e-05
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    51   1e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    51   1e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    51   1e-05
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    51   1e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    51   1e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    50   1e-05
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    51   1e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    51   1e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    50   1e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               50   1e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    51   1e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    50   1e-05
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    51   1e-05
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    50   1e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    51   1e-05
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    50   1e-05
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    50   1e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    50   1e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     50   1e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    50   1e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    50   1e-05
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    50   1e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    50   1e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    50   1e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    50   1e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    50   2e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    50   2e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    50   2e-05
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    50   2e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    50   2e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    50   2e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    50   2e-05
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    50   2e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   2e-05
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    50   2e-05
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    50   2e-05
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    50   2e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    49   2e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    50   2e-05
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    50   2e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   2e-05
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    50   2e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    50   2e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    50   2e-05
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    50   2e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    50   2e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    50   2e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    50   2e-05
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    50   2e-05
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    50   2e-05
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    50   2e-05
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    50   2e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    50   2e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    50   2e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    50   2e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    50   2e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    49   2e-05
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    50   2e-05
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    50   2e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    50   2e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    50   2e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    49   2e-05
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    50   2e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    50   2e-05
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    50   2e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    49   2e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    50   2e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    50   2e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    50   2e-05
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    49   2e-05
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    49   3e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    49   3e-05
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    50   3e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    50   3e-05
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    50   3e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    50   3e-05
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    49   3e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   3e-05
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    50   3e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    50   3e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    50   3e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    50   3e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    49   3e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   3e-05
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    50   3e-05
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    49   3e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    49   3e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    49   3e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    49   3e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    49   3e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               49   3e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    49   3e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    49   3e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   3e-05
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    49   3e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    49   3e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    49   3e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    49   3e-05
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    49   3e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    49   3e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    49   3e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    49   3e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   3e-05
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    49   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    49   4e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    49   4e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    49   4e-05
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    49   4e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    49   4e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    49   4e-05
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    49   4e-05
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    49   4e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   4e-05
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    49   4e-05
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    49   4e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    49   4e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    49   4e-05
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    49   4e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    49   4e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   4e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    49   4e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   5e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    49   5e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    49   5e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    49   5e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    49   5e-05
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    49   5e-05
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    49   5e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    49   5e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    49   5e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    49   5e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   5e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    48   6e-05
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    48   6e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   6e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    48   6e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    49   6e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    49   6e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    48   6e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    49   6e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    48   6e-05
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    48   7e-05
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    49   7e-05
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    48   7e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    48   7e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   7e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    48   7e-05
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    48   7e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    48   7e-05
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    48   8e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    48   8e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    48   8e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    48   8e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    47   8e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             48   8e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    48   9e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    48   9e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   9e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    48   9e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    48   9e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    48   9e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    48   9e-05
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    48   9e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   9e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    48   1e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    48   1e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    48   1e-04
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    47   1e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       48   1e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    48   1e-04
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    47   1e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    48   1e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    47   1e-04
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    47   1e-04
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    47   1e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    47   1e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    47   1e-04
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    48   1e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    48   1e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    48   1e-04
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    47   1e-04
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    48   1e-04
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    47   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   1e-04
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    47   1e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    47   1e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    47   1e-04
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    47   1e-04
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    47   1e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    47   1e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    47   1e-04
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    47   1e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    47   1e-04
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    47   1e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    46   1e-04
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    47   1e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    47   1e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    47   1e-04
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    47   1e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    47   2e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    47   2e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    47   2e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    46   2e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   2e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    47   2e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   2e-04
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    47   2e-04
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    47   2e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    47   2e-04
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    47   2e-04
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    47   2e-04
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    47   2e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   2e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    47   2e-04
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    47   2e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    47   2e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    47   2e-04
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    47   2e-04
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    47   2e-04
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    47   2e-04
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    47   2e-04
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     46   2e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    47   2e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    47   2e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    47   2e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    47   2e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               47   2e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   2e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 47   2e-04
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    47   2e-04
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    46   2e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    47   2e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    46   2e-04
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    47   2e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   2e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   2e-04
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    47   2e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   2e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     47   2e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   2e-04
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    47   2e-04
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    47   2e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    46   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   2e-04
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    47   2e-04
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    47   2e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    46   2e-04
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    47   2e-04
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    47   2e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    46   2e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    47   2e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    47   2e-04
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    47   2e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               47   2e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    47   2e-04
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    47   2e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    47   3e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    47   3e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    47   3e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    46   3e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    46   3e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   3e-04
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    46   3e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    46   3e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    46   3e-04
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    46   3e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    47   3e-04
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    46   3e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    46   3e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    46   3e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    46   3e-04
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    46   3e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    46   3e-04
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    46   3e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    46   3e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    45   3e-04
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    46   3e-04
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    46   3e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    46   3e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    45   3e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    46   3e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    45   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   3e-04
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    46   3e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    46   4e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    46   4e-04
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    46   4e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    46   4e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   4e-04
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    46   4e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    46   4e-04
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               46   4e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    46   4e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    46   4e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    46   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   4e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    46   4e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    46   4e-04
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    46   4e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    46   4e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    46   4e-04
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    45   4e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    45   4e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    46   4e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    45   4e-04
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    45   4e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    45   4e-04
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    46   4e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    46   4e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    45   4e-04
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    46   4e-04
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    45   5e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    46   5e-04
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    45   5e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    45   5e-04
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    45   5e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     45   5e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    45   5e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    45   5e-04
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    45   5e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    45   5e-04
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    45   5e-04
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    45   5e-04
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    45   5e-04
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    45   5e-04
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    45   5e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    45   5e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    45   5e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    45   5e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   5e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    45   5e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    45   6e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    45   6e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    45   6e-04
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    45   6e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    45   6e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    45   6e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    45   6e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    45   6e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    45   6e-04
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    45   7e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    44   7e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    45   7e-04
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    45   7e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   7e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    45   7e-04
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    45   7e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    45   7e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    45   7e-04
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    45   7e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    45   8e-04
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    45   8e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   8e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    45   8e-04
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    45   8e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    45   8e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   8e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    45   8e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    45   8e-04
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    45   9e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    45   9e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    44   9e-04
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    45   9e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    45   9e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    45   9e-04
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    45   0.001
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    45   0.001
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    45   0.001
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    45   0.001
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    45   0.001
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    44   0.001
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    44   0.001
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    44   0.001
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    45   0.001
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    44   0.001
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    44   0.001
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    44   0.001
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    44   0.001
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    44   0.001
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    44   0.001
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    44   0.001
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    44   0.001
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      44   0.001
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   0.001
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    44   0.001
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    44   0.001
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    44   0.001
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    44   0.001
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    44   0.001
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    44   0.001
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   0.001
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    44   0.001
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    44   0.001
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    44   0.001
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    44   0.001
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   0.001
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    44   0.001
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    44   0.001
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    44   0.001
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   0.001
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    44   0.001
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              44   0.001
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    44   0.001
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    44   0.001
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    44   0.001
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    44   0.001
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    44   0.001
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    44   0.001
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    44   0.001
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    44   0.001
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    44   0.001
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    44   0.001
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    44   0.001
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    44   0.001
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    43   0.001
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    44   0.001
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    44   0.001
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    44   0.002
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    44   0.002
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    43   0.002
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    44   0.002
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    44   0.002
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    44   0.002
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    44   0.002
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    44   0.002
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    44   0.002
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    44   0.002
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    44   0.002
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     44   0.002
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    44   0.002
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    44   0.002
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    44   0.002
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    44   0.002
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    43   0.002
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    44   0.002
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    41   0.002
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.002
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    43   0.002
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.002
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    44   0.002
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    44   0.002
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    43   0.002
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    44   0.002
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.002
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    43   0.002
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    44   0.002
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    44   0.002
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    44   0.002
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    44   0.002
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    43   0.002
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    44   0.002
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    43   0.002
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    43   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    43   0.002
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    44   0.002
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    43   0.002
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    43   0.002
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    43   0.002
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    43   0.003
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    42   0.003
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    43   0.003
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.003
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    43   0.003
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    43   0.003
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    43   0.003
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    43   0.003
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    43   0.003
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.003
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    43   0.003
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    43   0.003
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    43   0.003
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    42   0.003
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    43   0.003
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    43   0.003
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               43   0.003
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    42   0.003
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    43   0.004
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    43   0.004
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    42   0.004
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    43   0.004
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    42   0.004
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    43   0.004
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    42   0.004
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    42   0.004
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    42   0.004
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    42   0.004
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    42   0.004
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    43   0.005
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    42   0.005
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    42   0.005
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    42   0.005
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    42   0.005
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    42   0.005
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.005
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    42   0.005
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    42   0.005
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    42   0.005
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    42   0.005
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    42   0.005
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    42   0.005
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    42   0.006
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    42   0.006
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    42   0.006
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    42   0.006
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    42   0.006
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.007
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    42   0.007
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    42   0.007
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    42   0.007
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    42   0.007
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    42   0.008
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    42   0.008
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    42   0.008
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    42   0.008
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.008
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    41   0.008
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    42   0.008
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    42   0.008
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    41   0.008
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    41   0.009
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    41   0.009
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    41   0.009
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    41   0.009
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    41   0.010
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    41   0.010
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    41   0.010
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    41   0.010
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    41   0.010
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    41   0.010
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    41   0.010
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    41   0.010
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    41   0.010
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    41   0.010
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    40   0.010
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    41   0.011
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    40   0.011
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    41   0.011
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    41   0.011
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     41   0.011
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    41   0.011
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    40   0.012
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    40   0.012
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    41   0.012
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    41   0.013
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    41   0.013
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    41   0.013
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    41   0.013
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    40   0.014
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.015
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    41   0.015
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    40   0.016
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    41   0.016
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               40   0.016
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    41   0.016
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    40   0.016
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    40   0.017
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.017
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    40   0.017
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.017
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.018
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    40   0.018
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    40   0.021
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    40   0.021
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    40   0.022
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    40   0.023
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    40   0.024
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    40   0.024
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    40   0.024
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    40   0.024
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    40   0.025
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.025
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    40   0.026
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    40   0.026
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.027
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    40   0.028
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    40   0.028
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    40   0.029
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    40   0.030
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.030
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    40   0.030
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    40   0.031
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      40   0.032
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    39   0.033
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    39   0.033
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    39   0.034
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.034
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    40   0.034
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    40   0.036
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    39   0.036
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    39   0.037
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    39   0.037
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.040
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.042
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    39   0.042
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.043
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               39   0.043
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    39   0.043
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    39   0.049
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    39   0.050
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    39   0.051
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    39   0.055
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    39   0.055
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    39   0.057
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.059
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       39   0.061
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     39   0.061
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    39   0.061
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    39   0.063
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.067
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    39   0.068
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    38   0.072
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    39   0.074
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      39   0.075
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    39   0.077
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      39   0.079
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    38   0.082
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    38   0.083
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    38   0.083
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    38   0.085
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    38   0.094
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    38   0.10 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    38   0.10 
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    38   0.11 
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    38   0.11 
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    38   0.11 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    38   0.12 
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    38   0.12 
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    37   0.12 
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    38   0.12 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    38   0.12 
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    38   0.12 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    38   0.13 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    37   0.13 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    38   0.14 
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    37   0.15 
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    37   0.16 
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    37   0.16 
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    37   0.16 
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     37   0.17 
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    37   0.18 
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    37   0.18 
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    37   0.18 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    37   0.18 
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    37   0.19 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.19 
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    37   0.19 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    37   0.19 
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    37   0.20 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    37   0.20 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.21 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    37   0.22 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    37   0.22 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    37   0.23 
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    37   0.25 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    37   0.26 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.27 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    36   0.30 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    36   0.32 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    37   0.33 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    36   0.35 
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    36   0.37 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    36   0.37 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    36   0.37 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    36   0.38 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    36   0.38 
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    36   0.41 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    36   0.42 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    36   0.43 
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    36   0.45 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    36   0.45 
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    35   0.45 
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    36   0.45 
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    35   0.46 
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    36   0.47 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.54 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    35   0.55 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    36   0.59 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    35   0.61 
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    35   0.63 
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    35   0.68 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    35   0.70 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    35   0.71 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    35   0.71 
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    35   0.72 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    35   0.81 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   0.84 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.84 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    35   0.92 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    35   0.93 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    34   0.94 
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    35   0.95 
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    35   1.0  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    34   1.1  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   1.1  
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    35   1.2  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    34   1.2  
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    34   1.5  
TBLA0B02440 Chr2 complement(564793..565713) [921 bp, 306 aa] {ON...    34   1.6  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    34   1.8  
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    34   1.8  
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    34   1.9  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    33   2.1  
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    33   2.3  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    33   2.6  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   2.6  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    33   2.6  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    33   3.0  
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    33   3.4  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    33   3.9  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    33   4.0  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   4.1  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   4.4  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   4.4  
Kwal_56.23939 s56 (788304..790319) [2016 bp, 671 aa] {ON} YGL083...    33   4.7  
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    32   4.9  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    32   5.0  
TBLA0F01530 Chr6 (375673..378045) [2373 bp, 790 aa] {ON} Anc_7.4...    32   7.0  
TBLA0C06190 Chr3 complement(1501660..1503108) [1449 bp, 482 aa] ...    32   7.0  
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    32   7.9  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    32   7.9  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    32   8.3  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    31   9.3  
NDAI0E03240 Chr5 (692864..696139) [3276 bp, 1091 aa] {ON} Anc_8....    32   9.9  

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score = 1485 bits (3844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/780 (92%), Positives = 723/780 (92%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360
           QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360

Query: 361 QTTIPPTNXXXXXXXXXXXXXXXXNDHPVAISHVQDKISPHEXXXXXXXXXXXXXXXNKN 420
           QTTIPPTN                NDHPVAISHVQDKISPHE               NKN
Sbjct: 361 QTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSNKN 420

Query: 421 VIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSINDNYDV 480
           VIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSINDNYDV
Sbjct: 421 VIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSINDNYDV 480

Query: 481 SKRPTNYVDEETQTYTGQSTFLXXXXXXXXXXXXXXQYSGVQENTTGSSLVRKLSVKLKN 540
           SKRPTNYVDEETQTYTGQSTFL              QYSGVQENTTGSSLVRKLSVKLKN
Sbjct: 481 SKRPTNYVDEETQTYTGQSTFLRRTSSNRSNRSISSQYSGVQENTTGSSLVRKLSVKLKN 540

Query: 541 VLTGESIKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQ 600
           VLTGESIKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQ
Sbjct: 541 VLTGESIKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQ 600

Query: 601 DDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRV 660
           DDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRV
Sbjct: 601 DDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRV 660

Query: 661 QDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKK 720
           QDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKK
Sbjct: 661 QDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKK 720

Query: 721 PPVPYKRDSLKPTPPAKPAFLXXXXXXXXXXXXNATDMLVDLSVDDIEKDIRRRFPSTVG 780
           PPVPYKRDSLKPTPPAKPAFL            NATDMLVDLSVDDIEKDIRRRFPSTVG
Sbjct: 721 PPVPYKRDSLKPTPPAKPAFLSSRPVASSRVSSNATDMLVDLSVDDIEKDIRRRFPSTVG 780

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/842 (46%), Positives = 487/842 (57%), Gaps = 96/842 (11%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI  +  G +LTVGSHHAK+IKYLTSGG+AQVY  EISP DPY N+N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119
           PDK  LNTLRAEVDAMKLLKNN+HVVSYIDSHA+KS   NG AYEVFVLMEFCERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
           FMN+RLQ RL E+EIL IMS T QGIAAMH LQP L+HRDIKIENVLIS +  YKVCDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
           SV G++RPP+N QEFN+V HDI+ NTTAQYRSPEM+DL +  PI+EKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
           CYYTTPFEK+ GEAAIL +R+QYPS+P YSDRLK LI +ML + PS RPN+CQVLEEVSR
Sbjct: 239 CYYTTPFEKS-GEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297

Query: 300 LQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKF 359
           LQ  PCPIRNFYLLRAM  N +   +P    Y+      P+  +             +K 
Sbjct: 298 LQNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQ-----------GIKH 346

Query: 360 NQTTIPPTNXXXXXXXXXXXXXXXXNDHPVAISHVQDKISPHEXXXXXXXXXXXXXXXNK 419
            Q+ +P T+                N+   +I  V+ +                    N 
Sbjct: 347 LQSMVPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQ------------PESDLNLGNP 394

Query: 420 NVIDTSAP--DHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANL----SSSPQKSWKS 473
            +   S P  D F  L +   +    +Q      S   +  P+  L    SSSP  S  +
Sbjct: 395 LMKTKSVPLSDDFASLYYRELH---PFQKSQTFKSVESFQSPQRKLSTPSSSSPVNSKNN 451

Query: 474 INDNYDVSKRPTNYVDEETQTYTGQSTF-LXXXXXXXXXXXXXXQYSGVQENTTGSSLVR 532
              +     RP NYVD  TQT    +   L              + S V EN TG S+VR
Sbjct: 452 DRASTSTVDRPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVR 511

Query: 533 KLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNN-NNTRSASYDN---G 583
            LS KLK V+TGES     IKSRQNTGDSIRSA   +R G TG++ +N R+ S+D+    
Sbjct: 512 SLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNGN 571

Query: 584 KRLSSVNLHMHSAIL----------EQDDSDEFE-MPRYNSVSSNTLKDVEEHERRTVNT 632
              +SVN  + S+             QDD D+ + +    S+  + L D ++HER    T
Sbjct: 572 GNGNSVNRRLASSSSSSSNFNFDTKRQDDLDKKQKLENRRSMPPSILSDFDKHERNNSRT 631

Query: 633 SSREYYRSQSPVR--------------------MSVNREMKNSIQKRVQDLLKNAEENTT 672
            SR+YYRS SPV+                    + V +  K SIQ+RV +LL N+E+   
Sbjct: 632 GSRDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLA 691

Query: 673 ATVRTASGYGKYTDYNKNKD------EISP-TKSRVAQFNQSTAALASLSGKRKKPPVP- 724
              ++ASGYGKYTD N           I+P T+ +  ++  S       S   K    P 
Sbjct: 692 H--KSASGYGKYTDVNAEASNRHSSVRITPITEGKFNKYYNSGTLKGETSRNDKHKSRPP 749

Query: 725 -------YKRDSLKPTPPAKPAFLXXXXXXXXXXXXNATDMLVDLSVDDIEKDIRRRFPS 777
                  + R  ++ T     + L             AT+ +VD++VDD+E D R+RFPS
Sbjct: 750 RPPPKPLHLRTEIQNT--RNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPS 807

Query: 778 TV 779
            V
Sbjct: 808 KV 809

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/369 (70%), Positives = 302/369 (81%), Gaps = 7/369 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI  +  G ILTVGSHHAK+IKYLTSGG+AQVY  EISP DPY N+NIACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119
           PDK  LNTLRAEVDAMKLLKNN+HVVSYIDSHA+KS   NG AYEVFVLMEFCERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
           FMN+RLQ+RL E+EIL IMS T QGIAAMH LQP L+HRDIKIENVLIS N  YKVCDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
           SV G++RPP+N QEFN+V HDI+ NTTAQYRSPEM+DL +GLPI+EKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
           CYYTTPFEK+ GEA IL AR+QYP +P YSDRLKNLIR+ML + PS RPN+CQVLEEVSR
Sbjct: 239 CYYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297

Query: 300 LQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQM-NLASLNDTLPTAALK 358
           LQ  PCPIRNFYLLRAM    +   +P    Y+PT    P+  + ++  +++ +P + ++
Sbjct: 298 LQIKPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVR 357

Query: 359 F--NQTTIP 365
              N +T+P
Sbjct: 358 TTPNLSTLP 366

 Score =  139 bits (351), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 171/363 (47%), Gaps = 79/363 (21%)

Query: 483 RPTNYVDEETQTYTGQSTFLXXXXXXXXXXXXXXQYSGVQ-ENTTGSSLVRKLSVKLKNV 541
           RP NYVD ETQT    +                 Q   +  EN +G ++VR LS KLK V
Sbjct: 459 RPNNYVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKV 518

Query: 542 LTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNN-NNTRSASYDNG----------KR 585
           +TGES     IKSRQNTGDS RSA+  +R GFTG++ NN RSAS+D+           +R
Sbjct: 519 ITGESRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRR 578

Query: 586 LSSVNLHMHSAI-------LEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYY 638
           L S +    S          E D   + E  R  S+ S+ L D ++HER    T SR+YY
Sbjct: 579 LGSSSTSSLSVFNPDTKRQEEIDKKQKLENRR--SMPSSILSDFDQHERINSRTGSRDYY 636

Query: 639 RSQSPVR--------------------MSVNREMKNSIQKRVQDLLKNAEENTTATVRTA 678
           RS SPV+                    +++N+E K SIQ+RV +LLK++E+    T ++A
Sbjct: 637 RSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSED--PLTYKSA 694

Query: 679 SGYGKYTDYN----------------------KNKDEISPTKSRVAQFNQSTAALASLSG 716
           SGYGKYTD +                      +NK+ +S  K++    ++S         
Sbjct: 695 SGYGKYTDTDTETSNRHSSVRITPITEEKFKSRNKNGLSNNKTKDNDRHKSRPPRPPPKP 754

Query: 717 KRKKPPVPYKRDSLKPTPPAKPAFLXXXXXXXXXXXXNATDMLVDLSVDDIEKDIRRRFP 776
              +  +   R S +         L            +AT+ +V+++VDD+E D R+RFP
Sbjct: 755 LHLRAEIQKVRSSSR---------LHSGELSSERISSDATETIVEVNVDDLEADFRKRFP 805

Query: 777 STV 779
           S V
Sbjct: 806 SKV 808

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/360 (71%), Positives = 294/360 (81%), Gaps = 5/360 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI  +  G ILTVGSHHAK+IKYLTSGG+AQVY  EISP DPY ++NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119
           PDK  LNTLRAEVDAMKLLKNN+HVVSYIDSHA+KS   NG AYEVFVLME+CERGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
           FMN+RL++RL E+EIL IM  T QGIAAMH LQP L+HRDIKIENVLIS    YKVCDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
           SV G++RPPKN QEFN+V HDI+ NTTAQYRSPEM+DL +GLPI+EKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
           CYYTTPFEK  GEAAIL AR+QYPS+P YSDRLKNLIR+ML + PS RPN+CQVLEEVSR
Sbjct: 239 CYYTTPFEKT-GEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSR 297

Query: 300 LQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPT-TLSQPSTQMNLASLNDTLPTAALK 358
           LQ  PCPIRNFYLLRAM  N +   +     Y P   L  P +  N+ ++ + +P + +K
Sbjct: 298 LQNRPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIK 357

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 135/381 (35%), Positives = 191/381 (50%), Gaps = 71/381 (18%)

Query: 464 SSSPQKSWKSI--------NDNYD---VSKRPTNYVDEETQTYTGQSTF-LXXXXXXXXX 511
           S SPQ+  KSI        ++NYD      RP NYVD ETQT    +T  L         
Sbjct: 431 SQSPQR--KSIPFSPTPVNSNNYDRVSTINRPNNYVDSETQTLDSIATLKLKPSPTISNK 488

Query: 512 XXXXXQYSGVQENTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRS 566
                + S V EN TG  +VR LS KLK V+TGES     IKSRQNTGDSIRSA   +R 
Sbjct: 489 TTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGDSIRSAFGMLRH 548

Query: 567 GFTGNN-NNTRSASYDN------GKRLSSVNLHMHSAILEQDDSDEFEMPR------YNS 613
           GFTG++ NN+RS S+DN       +RL+S + +  S+ L  D   + E+ +        S
Sbjct: 549 GFTGSSINNSRSTSFDNNNANSVNRRLTSSSSNPSSSNLNSDTKRKEELDKKRKLEHRRS 608

Query: 614 VSSNTLKDVEEHERRTVNTSSREYYRSQSPVR--------------------MSVNREMK 653
           +  + L D ++HER    T SR+YYRS SPV+                    +++++E K
Sbjct: 609 MPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTTRPSLKSSNSDINIDQEKK 668

Query: 654 NSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYN------KNKDEISP-TKSRVAQFNQ 706
            SIQ+RV +LL N+E+  + + ++ASGYGKYTD        ++   I+P T+ R   ++ 
Sbjct: 669 ESIQRRVHNLLNNSED--SLSYKSASGYGKYTDTEAESTNRQSSVRITPITEERFNNYHS 726

Query: 707 STAALASLSGKRKKPPVP--------YKRDSLKPTPPAKPAFLXXXXXXXXXXXXNATDM 758
           S       S K K    P        + R  +  T  +  + L             AT+ 
Sbjct: 727 SNTMNDHTSSKDKPKSRPPRPPPKPLHLRTKIHNTRCS--SNLQSRKPPMERISSEATET 784

Query: 759 LVDLSVDDIEKDIRRRFPSTV 779
           +VD++VD++E D R+RFPS V
Sbjct: 785 IVDVNVDELEADFRKRFPSKV 805

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/337 (75%), Positives = 284/337 (84%), Gaps = 6/337 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI  +  G ILTVGSHHAK+IKYLTSGG+AQVY  EISP DPY N+NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119
           P K  LNTLRAEVDAMKLL+NN+HVVSYIDSHA++S   NG AYEVFVLMEFCERGGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
           FMN+RLQ+RL E+EIL IMS T QGI AMH LQP L+HRDIKIENVLIS +  YKVCDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
           SV G++RPP+N QEFN+V HDI+ NTTAQYRSPEM+DL +GLPI+EKSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
           CYYTTPFEK+ GEA IL AR+QYPS+P YSDRLKNLIR+ML + PS RPN+CQVLEEVSR
Sbjct: 239 CYYTTPFEKS-GEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSR 297

Query: 300 LQGIPCPIRNFYLLRAMENNKRT--IEQPVQNVYMPT 334
           LQ  PCPIRNFYLLRAM  N  T    +P    Y+PT
Sbjct: 298 LQNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPT 334

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 135/255 (52%), Gaps = 44/255 (17%)

Query: 474 INDNYDVSKRPTNYVDEETQTYTGQST-FLXXXXXXXXXXXXXXQYSGVQENTTGSSLVR 532
           I D      RP NYVD ETQT    +   L              +     +N  GS +VR
Sbjct: 452 IFDRVSAINRPNNYVDSETQTIDNMAVPNLKLSPTITSKSLSSTKEIAAPDNINGSKIVR 511

Query: 533 KLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNN-NNTRSASYD----- 581
            LS KLK V+TGES     IKSRQNTGDSIRSA   +R GFTGN+ NN+RSAS+D     
Sbjct: 512 SLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNNSRSASFDNNNVN 571

Query: 582 -----NGKRLSSVNL----HMHSAILEQDDSDEFE-MPRYNSVSSNTLKDVEEHERRTVN 631
                  +RL S +       +S    +++SD+ + + +  S+  + L D ++HER    
Sbjct: 572 GNGNNTNRRLVSSSTSSFPKFNSDTKRKEESDKNQRLEKRRSMPPSILSDFDQHERNNSR 631

Query: 632 TSSREYYRSQSPVR--------------------MSVNREMKNSIQKRVQDLLKNAEENT 671
           T SR+YYRS SPV+                    +++N+E K SIQ+RV +LLK++++  
Sbjct: 632 TGSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDD-- 689

Query: 672 TATVRTASGYGKYTD 686
             T ++ASGYGKYTD
Sbjct: 690 PVTYKSASGYGKYTD 704

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/347 (71%), Positives = 289/347 (83%), Gaps = 12/347 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P+I  +  G +LTVGSHHAKVI YLTSGG+AQVY  EI P+D +I+SN+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN+HVVSYIDSHA+KS+  NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QGIAAMH LQP L+HRDIKIENVLIS   +YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPP+N QEF +V HD++KNTTAQYRSPEM+DL +G PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GGE AIL +RFQ+P+ P+YSDRLK LIR ML +NP  RPNVCQVLE+VSR+
Sbjct: 241 YYTTPFEK-GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299

Query: 301 QGIPCPIRNFYLLRAMENN--------KRTIEQPVQNVYMPTTLSQP 339
           QGI CP+RNFYLLRAME          + +  QPV NV +   +SQP
Sbjct: 300 QGIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPI---ISQP 343

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 20/152 (13%)

Query: 633 SSREYYRSQSPVRMSV----NREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYN 688
           + R+  R +S + + +    +RE K SIQ+RV+DLL ++E+               +   
Sbjct: 525 TGRQSLRQESEIEIPLTSVRSREAKESIQRRVRDLLNSSEDLP------------LSKSE 572

Query: 689 KNKDEISPTKSRVAQFNQSTAALASLSGKRK-KPPVPYKRDSLKPTPPAKPAFLXXXXXX 747
             KDE  P + ++++ +           K+K +P  P K   L+P PP KPAFL      
Sbjct: 573 PKKDE--PKRGQLSKTHHDEKPSVKEKSKQKVRPRAPPKPAHLRPKPPPKPAFL-SGKKM 629

Query: 748 XXXXXXNATDMLVDLSVDDIEKDIRRRFPSTV 779
                  A   ++D  V+ +E+D+R+    T+
Sbjct: 630 VDTEPSEAGKAVIDAKVESLERDLRKEVTGTL 661

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  518 bits (1335), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 232/327 (70%), Positives = 283/327 (86%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P+I+T+  G IL VGSH  ++IKY+TSGG+AQ+Y VEISP D + +SNIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN+HVVSYIDSHASKS   NG+YEVF+LME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RLTE+E+L+I S  +QGIAAMH LQP LLHRDIKIENVLIS++N+YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V GI+RPP N QE  +V HD++KNTTAQYRSPEM+D  +GLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEKNGGEAAIL AR++YP++P+YS+RLK+LI  ML +NP  RPN+ QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPV 327
           Q +PCPI NFYL+   + +K    QP+
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPI 327

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  527 bits (1357), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/363 (66%), Positives = 294/363 (80%), Gaps = 2/363 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I T+P G +LTVGSH+ K+IKYLTSGG+AQ+Y  EISP +PY NS  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK  LNTLRAEVDAMKLLKNNRHVVSYIDSHA++S +  GAYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RLTE EIL I+S T QG++AMH LQPAL+HRDIKIENVLIS   E+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VC  +RPP+N QE  +V HD++KNTTAQYR+PEMLDL +GLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GGEAAIL +R+QYP++P+Y+D+LKNLIR  L ++PS RPN+CQ+LEE+SR+
Sbjct: 241 YYTTPFEK-GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360
           QGIPCPI NFYL R + N + ++  P+      T L    +   ++  +  +P A+ + +
Sbjct: 300 QGIPCPINNFYLSRTI-NVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSS 358

Query: 361 QTT 363
            TT
Sbjct: 359 TTT 361

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 147/313 (46%), Gaps = 36/313 (11%)

Query: 486 NYVDEETQTYTGQSTFLXXXXXXXXXXXXXXQYSGVQENTTGSSLVRKLSVKLKNVLTGE 545
           +YVD ETQT++  S                     ++E+ TG S+ +  +  LK V+TGE
Sbjct: 428 HYVDSETQTFSTSSR--RLSRSSSVRSASSRSSDQLKEHRTGGSITQFFTSTLKRVVTGE 485

Query: 546 S-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQ 600
           S     I+SRQNTG SIRSA +++RSG TG N N+R +S  +  R  S +          
Sbjct: 486 SRNTSPIRSRQNTGGSIRSAFDALRSGITG-NTNSRVSSLASSVRNVSSSSKHSKHSDAD 544

Query: 601 DDSDEFEM----PRYNSVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSI 656
           D+ ++ ++        SV  N   D   +E       + + Y S SPV++      + SI
Sbjct: 545 DEPNKIKIRMKKAHRRSVPPNLYSDFYANE------DTPKLYSSNSPVKLKSLSTQRESI 598

Query: 657 QKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEI--------SPTKSRVAQ--FNQ 706
           Q RV+ LL+  EE   +T++TASGYGKYTD       +        +PT  R +    N 
Sbjct: 599 QNRVKALLETFEEE-PSTIKTASGYGKYTDSEFITSPVPERGGRIPTPTNKRYSSVIINP 657

Query: 707 STAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFLXXXXXXXXXXXXNATDMLVDLSVDD 766
            T  ++       KP        L+P PP KP  L             AT+ +V+L V+ 
Sbjct: 658 VTEPISIRPSPPPKP------KHLRPIPPPKPTRL-SKIYPDERISSTATERIVNLDVES 710

Query: 767 IEKDIRRRFPSTV 779
           +EKD +RRFPS +
Sbjct: 711 LEKDFKRRFPSRI 723

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  522 bits (1345), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/366 (66%), Positives = 295/366 (80%), Gaps = 4/366 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I  +P+G +LTVG+H A + KYLTSGG+AQ+Y VEI+P D Y  SN+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           P K  LNTLRAEVDAMKLLKNNRHVVSYIDS+A KSA  NG+YEV +LME+CE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MNSRLQ+RL+EAEIL I+S T+QG+A MH LQP LLHRDIKIENVL S N E+K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG +RPP+NQQE ++V HDI+KNTTAQYR PEMLDL +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GE AIL ++FQYP++P+YSDRLKNLIRVMLS+NP+ RPN+C++LEE+S +
Sbjct: 241 YYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360
           QG+PCPI+NFYL+RA +   + I+   Q        +QP  Q+N  +   T+P    K N
Sbjct: 300 QGVPCPIQNFYLIRAQQLANQ-IQLQRQTTVPKIATAQPIQQLN--ARTQTMPIINTKAN 356

Query: 361 QTTIPP 366
            + + P
Sbjct: 357 TSLVTP 362

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 109/350 (31%), Positives = 163/350 (46%), Gaps = 46/350 (13%)

Query: 460 RANLSSSPQKSWKSINDNYDVSKRPTNYVDEET--QTYTGQSTFLXXXXXXXXXXXXXXQ 517
           R  +S SP +     N NYD+ +R T+  D +     Y G+S                  
Sbjct: 420 RRYISRSPSRD----NTNYDIQRRRTSQYDHDQNQSNYMGRS----LSRTSSIKSTSALS 471

Query: 518 YSG-VQENTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGN 571
           + G +Q N TG S  +K + K+K V+TGES     I+SRQ+TG S+RSA  +IR  FTG+
Sbjct: 472 FEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGAFTGS 531

Query: 572 NNNTRSASYDNGKRLSSVNLHM-----------HSAI---LEQDDSDEF---EMPRYNSV 614
               R+ S DN    S  N              H+ I   ++++DS      ++ + +++
Sbjct: 532 ---MRAPSLDNNTNNSMHNNSNNNTSRNSSYGRHNIITNPIKEEDSRNMTKAKLAKRHTM 588

Query: 615 SSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEE----N 670
               L D+E  E       + EYYRS SP +  V +  +++IQ+RVQ+LL  +E+    N
Sbjct: 589 PPGMLYDLENLEIENEGYHASEYYRSHSPTKPFVTKTTRDNIQQRVQNLLSESEQPMERN 648

Query: 671 TTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQSTAALASL-SGKRKKPPVPYKRDS 729
              T  T +        N N  E    +      N     L  + S  +K PP+P+K   
Sbjct: 649 NIDTHHTNAVSHSMIPRNLNSREKDSLRYSSVVIN----PLEDIGSSPKKAPPLPFKPHH 704

Query: 730 LKPTPPAKPAFLXXXXXXXXXXXXNATDMLVDLSVDDIEKDIRRRFPSTV 779
           L+P PP KP +L             AT+ LV L VD +E+D R+RFPST+
Sbjct: 705 LRPKPPPKPTYL-SKMFSKERISSTATEQLVTLDVDTLERDFRKRFPSTL 753

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 233/316 (73%), Positives = 270/316 (85%), Gaps = 1/316 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I T+P G  L VG HHA ++KYLTSGGYAQVY+ +ISP D    S+I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLNT RAEVDAMKLL+N  HVVSYIDS+A+KS ++NGAYEV +LMEFC  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QG+AAMH L+P LLHRDIKIENVLIS + EYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPP +QQEFNFV HDI+KNTTAQYR+PEM+DLS+ LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GEAAIL +R++Y +YP YSD LKNLIR+ML+  PS RPN+CQVLEEVSRL
Sbjct: 241 YYTTPFEK-AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRL 299

Query: 301 QGIPCPIRNFYLLRAM 316
           QGIPCPI+NFYL RA+
Sbjct: 300 QGIPCPIKNFYLERAI 315

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 9/98 (9%)

Query: 649 NREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYT----DYNKNKDEISPTKSRVAQF 704
           N+   NSIQ R+++L+ NA+       + AS YGKYT    ++ K+  E    K  +   
Sbjct: 581 NQSDNNSIQDRMKNLIDNAD--NIPINKIASDYGKYTKSSDNFGKDSGEEMNDKENIKTA 638

Query: 705 NQSTAALASLSGKRKKPPVPYKRDS-LKPTPPAKPAFL 741
           N  T      + K K  PVP K+ + L+P  P KP FL
Sbjct: 639 NSGTRNQPKKNKKEK--PVPAKKPAHLRPQKPPKPTFL 674

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  511 bits (1315), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 272/320 (85%), Gaps = 5/320 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P+I  +  G IL VGSH AK++KYLTSGG+AQVY+VEISP D +  SNIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKS----AIYNGAYEVFVLMEFCERGG 116
           PDK SLN  RAEV+AMKLL+NN++VVSYIDSHA+KS     + NG+YEVF+LME+C   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVC 176
           LIDFMN+RLQ+RL E EIL IMSH SQG+AAMH LQP LLHRDIKIENVLIS  NE+K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFL 236
           DFGSVCG++RPP NQ E +FV HDI+KNTTAQYRSPEML LSK +PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
           YK+CYYTTPFEK  GE AIL +R+QYP+YP YSD LKNLIRVML  +PS RPN+CQV+EE
Sbjct: 241 YKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299

Query: 297 VSRLQGIPCPIRNFYLLRAM 316
           VSRLQG+PCP++NFYL RA+
Sbjct: 300 VSRLQGVPCPLKNFYLERAI 319

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  512 bits (1318), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 270/316 (85%), Gaps = 1/316 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P    +  G  LTVGSH A++IKYLTSGG+A +Y  EISP+DP    N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLN LRAEVDAMKLL+ N+HVVSYIDSHA+KS   +G+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RLTE E+L IMS  +QGIAAMH L P L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPPKN QEF++V +DI+KNTTAQYRSPEM+DL +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  G+AAIL +RFQ+P+YP YSDRLKNLI VMLS+NP+ RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKV-GDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299

Query: 301 QGIPCPIRNFYLLRAM 316
           Q +PCP+RNFYLLR+M
Sbjct: 300 QNVPCPLRNFYLLRSM 315

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 134/293 (45%), Gaps = 48/293 (16%)

Query: 525 TTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSAS 579
           +TG S  R    +LK V TGE      IKSRQNTG+S++SA  ++R GF+  ++     S
Sbjct: 509 STGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLS 568

Query: 580 YDN-------GKRLSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNT 632
             N       G   +     + S+   ++++  F        SS ++    +  +    T
Sbjct: 569 KKNTVDVTTNGSSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSLQDDSGT 628

Query: 633 SSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKD 692
           ++++YYRS SPV++S + + ++SIQKRVQ+LLK+++++     ++A GYG+ ++    +D
Sbjct: 629 NAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVK--KSAHGYGEVSE---KED 683

Query: 693 EISPTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSL---------------------- 730
           + SP      QF    A   +   KR   P P +  S+                      
Sbjct: 684 KESP-----EQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTAKDIEQPIR 738

Query: 731 ---KPTPPAKPAFLXXXXXXXXXXXXNATDM-LVDLSVDDIEKDIRRRFPSTV 779
              KP  P KP  L                    DL ++++EKD +RRFPS V
Sbjct: 739 VHHKPKRPTKPPHLKADRIIKHGSSTTENPRHSSDLEIEELEKDFQRRFPSAV 791

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  504 bits (1298), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 268/316 (84%), Gaps = 1/316 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQ+  +  G +L+VGSH A++IKYLTSGG+AQVY  EISP DP+INS+I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN HVVSYIDSHA+K     G+YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  SQG+AAMH LQP LLHRDIKIENVL++    YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCGI+RPP N QEF +V HDIMKNTTAQYRSPEM++L KGLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GE AIL A FQ+P++P YSDR+K+LIR+ L+  PS RPN+ Q+LEEVS++
Sbjct: 241 YYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299

Query: 301 QGIPCPIRNFYLLRAM 316
           Q +PCPI +FYL R +
Sbjct: 300 QNVPCPIPDFYLQRKL 315

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  503 bits (1296), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/324 (72%), Positives = 270/324 (83%), Gaps = 1/324 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P+++    G  LTVG+H  K++KYLTSGG+AQ+Y VEI     +  SN+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLN LRAEVDAMKLL NN+HVVSYIDSHA++S   +G YEVF+LME+CE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RLTE EIL IMS T+QGIA MH L P LLHRDIKIENVL+S+   YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G++RPP+NQQE  +V HDIMKNTTAQYR PEMLDL +GLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GE AIL ARFQ+PS+P YSDRLKNLI+ ML ++PSDRPNVCQVLEEVSR+
Sbjct: 241 YYTTPFEK-LGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIE 324
           Q +PCPIRNFYLLRAME  K + E
Sbjct: 300 QNVPCPIRNFYLLRAMEKVKLSTE 323

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 68/151 (45%), Gaps = 28/151 (18%)

Query: 649 NREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQST 708
           N E + SIQ RVQ LL N   N     ++A GYGKYTD      E+S T + + +    +
Sbjct: 546 NSEKRKSIQLRVQHLLDNMSSNEVK--KSAQGYGKYTD------ELSSTGTNIPKVTPDS 597

Query: 709 AALASLSGKRKKPPV--PYKRDSLKPTPPAKP------------------AFLXXXXXXX 748
             LA L      P +  P  ++ L  +   KP                  + L       
Sbjct: 598 PVLADLIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSALRLEPKQN 657

Query: 749 XXXXXNATDMLVDLSVDDIEKDIRRRFPSTV 779
                +ATD+L+ L+VDD+E+D +RRFPS V
Sbjct: 658 DRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  504 bits (1299), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 227/326 (69%), Positives = 272/326 (83%), Gaps = 5/326 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQIE + SG IL VGSH  KV+KYL SGG+A VY VEISP DP    N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLNTLRAEVD+MK L+ N+ +VSYIDSHA+KS +  G YEV++LME+C  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  SQG+AAMH LQP L+HRDIKIENVL+S+N+E+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G++R P+N +EFN+V +DIMKNTTAQYR PEM+DL +GLPI+EKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEKN GE+AIL ++F++P+YP YSDR+KNLI VML  +P  RPN+CQV+EEVSR+
Sbjct: 241 YYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQP 326
           QGIPCPI+NFYLLR M+      EQP
Sbjct: 300 QGIPCPIKNFYLLRMMDKQ----EQP 321

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 109/233 (46%), Gaps = 49/233 (21%)

Query: 483 RPTNYVDEETQTYTGQSTF-LXXXXXXXXXXXXXXQYSGVQENTTGSSLVRKLSVKLKNV 541
           RP  YVD ETQT    S   L                  ++  +TG SL RK+  K+K V
Sbjct: 478 RP-KYVDSETQTSDHPSELGLSRSLSRKSVASSLSSAESLEATSTGGSLTRKIGSKMKKV 536

Query: 542 LTGE-----SIKSRQNTGDSIRSAMNSIRSG-----FTGNNNNTRSASYDNGKRLSSVNL 591
           +TGE     +I+S QNTG+S++SA N++R G     FTG          D+  R SS+  
Sbjct: 537 ITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTG----------DSSSRKSSL-- 584

Query: 592 HMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSR---------EYYRSQS 642
                     ++ ++      S+  NT  + + H R T + S           E  + + 
Sbjct: 585 ----------EARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEK 634

Query: 643 P---VRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKD 692
           P   +R S + +  +SIQKRV+DL+ NA++    +  +A+GYGKYTD  +  D
Sbjct: 635 PKSSLRRSSSLKTSSSIQKRVKDLI-NADDIPNRS--SATGYGKYTDIGRKTD 684

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  498 bits (1283), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 235/365 (64%), Positives = 292/365 (80%), Gaps = 18/365 (4%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY V ISP DP+ N+N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LLKNNR+VVSYIDSHA+K+ + NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL I+S  +QG+AAMH LQP L+HRDIKIENVLIS NNEYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCGI+R P+N QE ++V  DI+KNTTAQYRSPEM+D+ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GGE AIL  +F++P YP YS++LK+LIR +L +NP  RP+V Q+L+ +S +
Sbjct: 241 YYTTPFEK-GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN------DTLPT 354
           Q +PCPI          N+ +T++ P  ++ + T L Q S   N+ SLN      +++PT
Sbjct: 300 QNVPCPI----------NDIQTVQAPSSHLNL-TELHQLSATQNIQSLNSHLVMGNSIPT 348

Query: 355 AALKF 359
            A +F
Sbjct: 349 TAFQF 353

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  504 bits (1297), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/316 (71%), Positives = 267/316 (84%), Gaps = 1/316 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN    + +  G  LTVGSH A++IKYLTSGG+A +Y  EI P+D    + IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLN LRAEVDAMKLL+ N+HVVSYIDSHA+KS +++G+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E E+L I S  +QGIAAMH LQP L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPPKN QEFN+V HDI+KNTTAQYR+PEM+DL +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GEAAIL +RFQ+PSYP YSD LK+LI  MLS+NP+ RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299

Query: 301 QGIPCPIRNFYLLRAM 316
           QG PCP+RNFY+ RAM
Sbjct: 300 QGTPCPLRNFYVTRAM 315

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 146/290 (50%), Gaps = 42/290 (14%)

Query: 526 TGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASY 580
           TG S  R+   KLK V TGE      IKSRQNTGDS+RSA  ++R GF+G +  +   + 
Sbjct: 507 TGGSATRRFGQKLK-VFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNK 565

Query: 581 DNGKRLSSVNLHMHSAILEQDDSDEFEM----PRYNSVSSNTLK----DVEEHERRTVNT 632
            N   +SS + H +        S+  E     PR++   S++      D+++ ++   +T
Sbjct: 566 RNSLDISSTSSHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQD--DT 623

Query: 633 SSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKD 692
            ++ YY+S SPV++S  +  ++SIQKRVQDLLKN++++     +TA GYG  +  ++  +
Sbjct: 624 GAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVK--KTAHGYGMLSPGDEAAE 681

Query: 693 EIS--PTKSRVAQFNQSTAALAS-LSGKRKKPPVPYK------RDSLKPTPPAKPAFLXX 743
             S    ++ +   +QSTA+    LS  ++   V  K      +D+ +  P ++      
Sbjct: 682 LASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDA-EEVPSSRKPAPPK 740

Query: 744 XXXXXXXXXXNATDML-----------VDLS---VDDIEKDIRRRFPSTV 779
                      A  ++           VD+S   +D++EKD +RRFPS V
Sbjct: 741 PKRPKKPSHLKADKIIKEAETSAYEHSVDISDIEIDELEKDFKRRFPSAV 790

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  498 bits (1282), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/385 (64%), Positives = 286/385 (74%), Gaps = 20/385 (5%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI  +  G +LTVGSH  +V+KYLTSGG+AQ+Y V+ISP D + N+N+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVD MKLL+NN HVVSYIDSHA+K     G+YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ RL E EIL IMS  +QGIAAMH L P LLHRDIKIENVL++   EYKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCGI+RPP N QE ++V HDIMKNTTAQYR+PEM+DL +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEKN GEAAIL A FQ+P+YP YSDRLK LI  ML + PS RPN  QVLEEVS +
Sbjct: 241 YYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299

Query: 301 QGIPCPIRNFYLLR--------AM----ENNKRTIEQPVQNVYMPTTLSQPSTQMNLASL 348
           Q + CPI NFYL+         AM    +NN   +  P    Y+P      +T  N  S+
Sbjct: 300 QNVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTP-NAVSM 358

Query: 349 NDTLPTAA--LKFNQT----TIPPT 367
           ND     A  LK N T     IPPT
Sbjct: 359 NDIQMMNAINLKVNSTHNTGMIPPT 383

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  493 bits (1270), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/365 (63%), Positives = 288/365 (78%), Gaps = 18/365 (4%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY   I+P DP+ NS++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LLKNNR+VVSYIDSHA+K+ ++NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QG+AAMH LQP L+HRDIKIENVLIS NNEYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCGI+RPP+N QE ++V  DI+KNTTAQYRSPEM+D  +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GG+ AIL  +F++P YP YS++LK LIR +L ++P  RPNV Q+L+ +S +
Sbjct: 241 YYTTPFEK-GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN------DTLPT 354
           Q +PCPI          N+ + ++ P  ++ + T L Q S   N+ SLN      +T+P 
Sbjct: 300 QNVPCPI----------NDIQVVQAPSSHLNL-TELHQLSATQNILSLNSPTTMENTMPN 348

Query: 355 AALKF 359
           A  + 
Sbjct: 349 ATFQI 353

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  493 bits (1269), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/362 (62%), Positives = 284/362 (78%), Gaps = 21/362 (5%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI T+  G  LTVGSH  +++KYLTSGG+AQVY   ISP DP+ +SNIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NNR+VVSYIDSHA+K+ ++NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QG+AAMH LQP L+HRDIKIENVLIS NNEYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPP+N QE ++V  DI KNTTAQYRSPEM+D+ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GGE AIL   F++P YP YS++L++LIR +L +NP  RPNV Q+L+ +S +
Sbjct: 241 YYTTPFEK-GGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIM 299

Query: 301 QGIPCPIRNFYLLRAME--------------------NNKRTIEQPVQNVYMPTTLSQPS 340
           Q +PCPI +  + +A +                    N+  TIE+P+ N    +++   +
Sbjct: 300 QNVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMPDAA 359

Query: 341 TQ 342
           TQ
Sbjct: 360 TQ 361

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  492 bits (1267), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 323/785 (41%), Positives = 426/785 (54%), Gaps = 101/785 (12%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN    ++F  G +LTVGSH  KV+KYLTSGG+AQ+Y  E+   D  +  ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLNTLRAEVDAMKLL+ N+H+VSYIDSHASKS + NG+YEV +LME+C RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ RL E E+L IM+   QGI AMH LQP L+HRDIKIENVLI++N + KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPPKN  E ++V HDI+KNTTAQYR+PEM+DL +G  ++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GE AIL+A FQ+PSYP YS+RLKNLI VML++NP  RPN CQVLEEV R+
Sbjct: 240 YYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360
           QG PCP++NFYL R+++              +P+ L    +Q          P  A+   
Sbjct: 299 QGQPCPVKNFYLERSLKQQ------------IPSQLRHSVSQ----------PMIAMNPQ 336

Query: 361 QTTIPPTNXXXXXXXXXXXXXXXXNDHPVAISHVQDKISPHEXXXXXXXXXXXXXXXNKN 420
           Q  I                       P+ I  VQ+ + P                   N
Sbjct: 337 QAKI-----------------------PIVIPQVQNSVLPSNTMNMGYVTGAFQPASQPN 373

Query: 421 VI--DTSAPDHFTKLLHASKNTD--------------LSYQPVTVPTSSSLYNLPRANLS 464
            +  DT+      KLL  + + D               S +   +PTSS    LP    S
Sbjct: 374 EVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESGHLPTSS----LPTPRSS 429

Query: 465 SSPQKSWKSINDNYDVSKRPTN-----YVDEETQTYTGQS-------TFLXXXXXXXXXX 512
            SP +S +  N N  ++  P N     YVD E QT    S                    
Sbjct: 430 VSPVRSGRG-NINKIIAANPINIKRPVYVDSEMQTTDLASLKKANSRPLSLSLSSLPSQE 488

Query: 513 XXXXQYSGVQENTTGSSLVRKLSVKLKNVLTGESIKSRQNTGDSIRSAMNSIRSGFTGNN 572
                Y+G+    +       ++    N+L    + S+ NTGDS  S+   I      + 
Sbjct: 489 SFSLHYTGISAVESSQQFQGPVTFDKNNLL----VNSKSNTGDSKSSSPELINRTLRYSY 544

Query: 573 NNTRSASYDNGKRLSSVNLHMHSAILEQDDS---DEFEMPRYNSVSSNTLKDVEEHERRT 629
           +    AS+++ + +SS  L   +AIL+   S    E    R + +  ++L +V  +    
Sbjct: 545 HAPEPASWESSE-MSSKKLPYLNAILKTPKSLSAAEVSESRRSELERDSLANVPINNEYA 603

Query: 630 VNTSSREYYRSQSP-VRMSVNREMKNSIQKRVQDLLKN--AEENTTATVRTASGYGKYTD 686
           V+  S  Y+ S    V +   +  + SIQKRV  LL N  A+E  ++T   A   G  + 
Sbjct: 604 VDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQELYSSTNSEAVNSGNISV 663

Query: 687 YNK---NKDEISPTKSRV-------AQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPA 736
            N+   + D I P K  V       +QFN  +    S   ++K P  P+K   L+PTPP 
Sbjct: 664 GNEELNSDDNIKPEKPPVMPVSRSKSQFNTPSVVKFSTKNQKKPPEKPFKPVHLRPTPPP 723

Query: 737 KPAFL 741
           KPA L
Sbjct: 724 KPAHL 728

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  489 bits (1259), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 275/343 (80%), Gaps = 4/343 (1%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MNHP+I T+  G +L+VG+HHAK++KY+ SGG+AQVY  E+ P+D    +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           P+K  LN LRAEV+AMKLLK ++HVV YIDSHA++S + NG YEVF+LMEFC  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QGIAAMH LQP L+HRDIKIENVLIS + EYKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G +RPP+N QEF FV HDI+KNTTAQYRSPEM+DL +   I+EKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GG+ AIL +R+Q+ ++P+YSDRLKNLI  MLS+ P  RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEK-GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRT---IEQPVQNVYMPTTLSQPS 340
           QG+  P+RNFYLLRAM++   +   I  PV  V   T ++ P+
Sbjct: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPA 342

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 56/135 (41%), Gaps = 7/135 (5%)

Query: 644 VRMSVNREMKNSIQKRVQDLLKNAEEN-------TTATVRTASGYGKYTDYNKNKDEISP 696
            R+  N + K SIQK+VQ LLK AE++           +RT +         K    +  
Sbjct: 570 ARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKTTSNVEN 629

Query: 697 TKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFLXXXXXXXXXXXXNAT 756
            KS        ++       K K PP P K + L+P  P KPAFL               
Sbjct: 630 GKSTTRSIKTPSSVNGKSESKSKPPPPPPKPEHLRPKKPPKPAFLSGKRKEPEVLLNEVK 689

Query: 757 DMLVDLSVDDIEKDI 771
           D ++D +VD IE D+
Sbjct: 690 DAVMDSNVDTIETDV 704

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  483 bits (1243), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/349 (64%), Positives = 281/349 (80%), Gaps = 12/349 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN PQI T+  G  LTVGSH  ++IKYLTSGG+AQVY   ISP DP+ NSN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLNTLRAEVDAMKLL+NNR+VVSYIDSHA+K+ ++NG+YEVFVLME+CERGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E+EIL IM   +QG+AAMH LQP L+HRDIKIENVLIS  NEYK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPP+N QE ++V  D++KNTTAQYRSPEM+D+ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK GGE AIL  +F++  YP YS++L+NLI  +L +NPS RPNV Q+L++++ +
Sbjct: 241 YYTTPFEK-GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLN 349
           Q  P PIR+           +T+++P  ++ +   L Q S   N+ SLN
Sbjct: 300 QNAPYPIRDV----------QTVQRPSNHLNL-MELHQNSATQNIQSLN 337

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  487 bits (1253), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 224/341 (65%), Positives = 269/341 (78%), Gaps = 2/341 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN    +    G ILTVGSH  K+I+YLTSGG+AQ+Y  E+    P I  ++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLNTLRAEVDAMK+LK +RHVVSYIDSHA+KS  ++G YEV++LME+C RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MNSRLQ RL+E E+L IMSH +QGI AMH L P L+HRDIKIENVLIS + ++KVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G++RPPKN  EFN+V HDI+KNTTAQYR+PEM+DL + LP++EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           Y+TTPFEK  GE AILQA+FQ+PSYP Y+DRLKNLI VMLS++P  RPN+CQVLEEVSR+
Sbjct: 240 YFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPST 341
           QG+PCP+ NFYL R        +        +P    Q ST
Sbjct: 299 QGVPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFST 339

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  481 bits (1237), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 253/314 (80%), Gaps = 1/314 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I+ +  G  L VG H   +IKYLTSGG+AQ+Y+V+++P +P    N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   HVV YIDS+A++S   +G YEV  LMEFC  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RL E E+L IM+  +QGI AMH L P L+HRDIKIENVLIS N EYKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V GI+RPPKN +EFNFV  DIMKNTTAQYR PEMLDL +G PINEKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFE NGGE AIL AR+QYP YPMYS RLKNLIR+ML + P  RPNVCQVLEEVS +
Sbjct: 241 YYTTPFE-NGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSM 299

Query: 301 QGIPCPIRNFYLLR 314
           QGIPCP+ NFYL R
Sbjct: 300 QGIPCPLPNFYLQR 313

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  477 bits (1227), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/329 (65%), Positives = 273/329 (82%), Gaps = 3/329 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN  Q+  +    ++TVGSH AK++KYL SGGYAQVY   ++P D    +NIACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK SLN LRAEVDA+K+L+N ++VVSYIDSHASK + + G+YEVFVLME+C  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           +N+RL++RL E EIL IM+  + G+A MH LQP+L+HRDIKIEN+LIS+N EYKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           VCG++RPP++ +E  ++ HDIMKNTTAQYRSPEMLDL+KG  INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK  GE AIL+++FQYP+YP+YSD LKN+IRV+LS +P  RPN+CQ++EE+SRL
Sbjct: 241 YYTTPFEKE-GEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQN 329
           QGI  P++NFYL RA+E +  ++ QP+QN
Sbjct: 300 QGIVPPMKNFYLSRALETS--SLMQPLQN 326

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 114/226 (50%), Gaps = 31/226 (13%)

Query: 521 VQENTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNT 575
           + +N+TG SLVR LS KLKNV+TGE      ++SRQNTG S RS    +  GFTG   N+
Sbjct: 495 LSKNSTGISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEGFTG--GNS 552

Query: 576 RSASYDNGKRLSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSR 635
           R +S ++  R  S + H         + +E  + ++  +       VEE     V     
Sbjct: 553 RISSSEHTIRGPSSSSHKSRVSSSTKNFEEGFIRKHVDI-------VEESAEPKVG---- 601

Query: 636 EYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEIS 695
                   +++   RE K+SI++RV++LL  +E+      RTASGYGKYTD    ++ ++
Sbjct: 602 --------IKLKTTREAKDSIKRRVRELLLVSEDEQYH--RTASGYGKYTDV---QEIVT 648

Query: 696 PTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFL 741
              + + +  Q T   +  S  RKKP +P K   L+  P  + A L
Sbjct: 649 NIMTPLVKSTQKTPIDSKNSSPRKKPILPAKPLHLRSQPKQQTAIL 694

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  471 bits (1213), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/325 (65%), Positives = 266/325 (81%), Gaps = 1/325 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I T+P G  LTVGSH  ++IKYLT+GG+AQ+Y+  ISP DP+  +NIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDKPSLN LRAEVDAMKLL+NNR VVSYIDSHA+KS+  NG YEVF+LME+CE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           +NSRLQ+RL E+E++ IM   SQG+AAMH LQP L+HRDIKIENVL+S+NNE+K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G +RPP N QE   V +DIM+NTTAQYRSPEM+D+S+G PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFEK+ GEA IL +R+++P++P YSDRL++LI  +L+  P+ RPN+  V++E+S +
Sbjct: 241 YYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299

Query: 301 QGIPCPIRNFYLLRAMENNKRTIEQ 325
           + I CPI NFYL   M +    I+ 
Sbjct: 300 KNISCPIINFYLKPNMTDASNNIQH 324

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 719 KKPPVPYKRDSLKPTPPAKPAFL 741
           K PPVP+K D L+P  P+KPAFL
Sbjct: 555 KGPPVPHKPDRLRPVLPSKPAFL 577

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  465 bits (1196), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 251/323 (77%), Gaps = 3/323 (0%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN--SNIACLKRV 58
           MN P+I  +  G++L +G+H   + KYL  GG+AQVY V +  S    N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLI 118
           IVPDK  LNTLRAEVDAMKLLK N+++VSYIDSHA +S +  G YEVF+LME+C RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDF 178
           DF+N+RL HRL E EIL IMS   QG+AAMH LQP L+HRDIKIENVLIS+N +YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYK 238
           GS C ++RPPK  QE  F++HDIM NTTAQYRSPEM+D   G PI+EKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVS 298
           LCYYTTPFEK  GE AIL  +FQ+PSYP YSD ++N+I +ML+K+P  RPN+CQVLE+VS
Sbjct: 241 LCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299

Query: 299 RLQGIPCPIRNFYLLRAMENNKR 321
           +LQG+PCPI NF L R    N R
Sbjct: 300 KLQGVPCPIENFMLTRIKLQNSR 322

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 642  SPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRV 701
            S +R+  N + K+ I+KRV +LLKN+E +   T RTA GYGKYTD        +P ++  
Sbjct: 1196 SSLRLVSNPDAKDLIKKRVMELLKNSETDNGVT-RTAHGYGKYTDKPNTSQNKAPQRTIS 1254

Query: 702  AQFNQSTAALA 712
              F +  A  A
Sbjct: 1255 MDFFEKQAVFA 1265

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  446 bits (1146), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 250/318 (78%), Gaps = 7/318 (2%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I  +P G ++ VGSH AK++KYLTSGG+AQ+Y VEISP D Y NSNIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           P+K  LN LR EVDAMKLLKNNRHVVSYIDS+A+KS   NG+YEVF+LME+CERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN++L+ RL E E+L IM+   QGIAAMH+L P L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS---DIWALGVFLY 237
           VCGI+RPP+N QE  +V HD+MKNTTAQYRSPEM+DL KG PI  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
            L +YT    +   E AIL  R+QYP+YP+YSDRLKN++RV+LS +P  RPN+CQ+LEE+
Sbjct: 241 -LLHYTF---REDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 298 SRLQGIPCPIRNFYLLRA 315
           S++Q IPCPI NFYL R+
Sbjct: 297 SKIQNIPCPIDNFYLERS 314

 Score =  115 bits (289), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 160/345 (46%), Gaps = 66/345 (19%)

Query: 487 YVDEETQTYTGQSTFLXXXXXXXXXXXXXXQYSGVQENTTGSSLVRKLSVKLKNVLTGES 546
           YVD ETQT    S                   S  + + TG+S+V +L V+L+NV+T +S
Sbjct: 457 YVDSETQTLEEPSL---------QHTRILPHISTDRTDNTGNSIVSRLGVQLRNVITNDS 507

Query: 547 -----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGK----RLSSVNLHMHSAI 597
                I + Q TG+SI+SA+ S+++  +G  NN ++ S +N +    RL S      +  
Sbjct: 508 SASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVENARNHLERLGSSYSIGSNNN 567

Query: 598 LEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYY------------RSQSPVR 645
           + + +S         + +SN+LK        +  +   E Y            +S SP++
Sbjct: 568 IAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPDPKTSFQSPSPLK 627

Query: 646 MSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFN 705
            +V+R+MK SI+KRV +LLKNAE++     +TA+GYGKYT   K    +SPT        
Sbjct: 628 YAVDRKMKASIEKRVLNLLKNAEDSPVK--KTAAGYGKYT---KRPKMVSPTNPHYHLVR 682

Query: 706 QSTAALASL-------SG--------------------KRKKPP-VPYKRDSLKPTPPAK 737
           Q++ +   L       SG                    K K PP VP K D L+P PP K
Sbjct: 683 QNSVSQTPLILSARGSSGHPVVVPALINRDNDNGKYPAKSKAPPVVPKKPDHLRPKPPKK 742

Query: 738 PAFLXXXXXXXXXXXX---NATDMLVDLSVDDIEKDIRRRFPSTV 779
           PA L                  D+L D +VD++EK  ++R+PSTV
Sbjct: 743 PAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  440 bits (1131), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 209/369 (56%), Positives = 268/369 (72%), Gaps = 9/369 (2%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           MN P I  +  G  +TVGSH   ++KYLTSGGYAQ+Y  +I P+D ++ +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120
           PDK  LNTLRAEVDAMK LK+++++VSYIDSHA+KS   +G YEVF++ME+C RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
           MN+RLQ+RLTE EILTI  H SQG+AAMH LQP L+HRDIKIENVLIS +++YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
           V G +RPPK  +E  +V HDIM +TTAQYR+PEMLDL+KG  +N+KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           YYTTPFE+  GEA IL    ++P YP YSD +K LI  ML+KNP  RPN+ Q+++ VS+L
Sbjct: 241 YYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299

Query: 301 QGIPCPIRNFYL---LRAMENNKRTIEQPVQNVYMP----TTLSQP-STQMNLASLNDTL 352
             + CPI N ++   +    +N  T    +   Y P    + +S P S    LA   + +
Sbjct: 300 LNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDM 359

Query: 353 PTAALKFNQ 361
           P  + K  +
Sbjct: 360 PKPSTKLGK 368

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  399 bits (1024), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 238/320 (74%), Gaps = 1/320 (0%)

Query: 7   ETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSL 66
           + +  G  L V SH   +  YLTSGG+AQVY   I+     +   + CLKRVIVP+K SL
Sbjct: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSL 66

Query: 67  NTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQ 126
           N LRAEVDAMK+LKNN+++VSYIDSHA++      +Y V +LME+C   GL+DFMN RL+
Sbjct: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLK 126

Query: 127 HRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVR 186
            RL E EIL IM+  SQG+  MH+LQP LLHRDIKIENVL+S +  +K+CDFGSV G++R
Sbjct: 127 ERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186

Query: 187 PPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
            P + +EF ++ +DI+KNTTAQYRSPEM++L+ G PINEKSDIWALG+ LYKLCYYTTPF
Sbjct: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246

Query: 247 EKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306
           E++G   AI++ +F YP+YP Y+D LKN+IRV+LS NP  RPN+CQ+LEE+ R+Q    P
Sbjct: 247 EEHGSR-AIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSP 305

Query: 307 IRNFYLLRAMENNKRTIEQP 326
           + NFY+ RAM + +    QP
Sbjct: 306 LPNFYVQRAMSSLQMDTTQP 325

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 109/231 (47%), Gaps = 34/231 (14%)

Query: 521 VQENTTGSSLVRKLSVKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNT 575
           +  N+TG SL++ L  K+K   TG       IKSRQNTGDSIRSA N +R G   N  ++
Sbjct: 498 ISRNSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGI--NLRSS 555

Query: 576 RSASYDNGKRLSSVNLHMHSAI--LEQDDSDEFEMPRYNSVSSN---TLKDVEEHERRTV 630
           R +S D+  R    N      I  L  D+  +F+    N    N       +   ++ ++
Sbjct: 556 RISSNDSVVR----NSEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQKQNSL 611

Query: 631 NTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKN 690
           N S+     S  P+ +  N E K SI+ RVQ L+K++ +N    + +A GYGKYTD   N
Sbjct: 612 NDST-----SNDPIILITNLEAKKSIKDRVQALMKSSSDN--HVIISAHGYGKYTD---N 661

Query: 691 KDEISPTKSRVAQFNQSTAALASLSGKRKKPPVPYKRDSLKPTPPAKPAFL 741
           K  I   KS +        A  +++G  K           KP  P KP FL
Sbjct: 662 KSSIKHFKSNIEHL----TAYGNMNGHLKTA----HHLKAKPKVPTKPVFL 704

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  304 bits (778), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 156/348 (44%), Positives = 224/348 (64%), Gaps = 32/348 (9%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN---------------- 49
           IE F +G+ + VGSH  +++KYLT GG+AQ+Y V+++    Y+N                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTE---YLNEFDAIDIQNQRQQQEL 82

Query: 50  --SNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFV 107
              ++ CLKRV+V D+  L+ ++ EV+ MK L+   +VV Y DS+A+++   NG +EVF+
Sbjct: 83  KIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFL 142

Query: 108 LMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLI 167
           LME+C    L+D+MN RL  +LTE+EIL IM   + G++ +H L   L+HRDIKIENVL+
Sbjct: 143 LMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLV 202

Query: 168 SQNNEYKVCDFGS--VCGIVRPP--KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPI 223
             NN +K+CDFGS  +C    PP     Q+ + + HDI  +TT QYRSPEM+DL + LP+
Sbjct: 203 DHNNRFKLCDFGSTNIC----PPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPV 258

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKN 283
           NEK+DIWALGVFLYKL +YTTPFE   G+ AIL ++++ P    YS+RL NLI VML++N
Sbjct: 259 NEKADIWALGVFLYKLLFYTTPFELT-GQFAILHSKYEIPQS-HYSERLLNLIVVMLAEN 316

Query: 284 PSDRPNVCQVLEEVSRLQGIPCPIRNFYLLRAME-NNKRTIEQPVQNV 330
           P+ RPN+ QVL E+  +  +  PI + Y       NN    ++ VQ +
Sbjct: 317 PNLRPNIYQVLSEICSILNVEVPIPDIYGAGVFNFNNFALFQKKVQKI 364

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  300 bits (768), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 212/326 (65%), Gaps = 18/326 (5%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN----------- 49
           +N P  E +P+GQ+++VG+H  +++ YL  GG+AQ+Y V+      Y+N           
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVE---YLNEFESLGSKSAI 68

Query: 50  --SNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFV 107
              +IACLKRVIV D+  LN +R EV+ MK LK++ ++V Y DS+AS+       +EV +
Sbjct: 69  TVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLL 128

Query: 108 LMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLI 167
           LME C    L+D+MN RL+ +L+E+EIL IM   S GI+ MH L   L+HRDIKIENVL+
Sbjct: 129 LMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLV 188

Query: 168 SQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS 227
             NN +K+CD GS      P  + Q+   +  +I  +TT QYR+PEM+DL + LPINEKS
Sbjct: 189 DANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKS 248

Query: 228 DIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDR 287
           DIWALG+FLYKL +YTTPFE   G+ AIL +++ +P    YS ++ NLI +ML++NP+ R
Sbjct: 249 DIWALGIFLYKLLFYTTPFEIT-GQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLR 306

Query: 288 PNVCQVLEEVSRLQGIPCPIRNFYLL 313
           PN+ QV+  +  +  +P PI + Y L
Sbjct: 307 PNIFQVVYHICSIMNLPVPIEDRYGL 332

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  297 bits (760), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 148/316 (46%), Positives = 199/316 (62%), Gaps = 12/316 (3%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSN----------IACL 55
           +E F +G  + VG+   +++KYLT GG+AQ+Y V+   +    +SN          +ACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERG 115
           KRV+V D+  LN +R EV+ MKLLK   ++V Y DS+AS+       +EV +LME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 116 GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
            L+DFMN RL  +L+E EILTIM   +  +A MH L P L+HRDIKIENVL+   N +K+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 176 CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVF 235
            DFGS           Q+   +  DI  +TT QYRSPEM+DL K LPI+EKSDIWALG+F
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 236 LYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           LYKL +Y TPFE   G+ AIL +++ +P    YS RL NLI +MLS+NP+ RPN+ QVL 
Sbjct: 262 LYKLLFYITPFEMT-GQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLH 319

Query: 296 EVSRLQGIPCPIRNFY 311
           E+  + G    I + Y
Sbjct: 320 EICSISGTRLEITDKY 335

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  294 bits (752), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 204/326 (62%), Gaps = 23/326 (7%)

Query: 7   ETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI------------SPSDPYIN----- 49
           E F  G ++ VG H  ++IKYL  GG+AQ+Y V              S  D  I+     
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 50  ----SNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEV 105
                N+ACLKRV+VPD+  LN LR EV+ M+ LK   ++V Y DS+AS+    N  +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 106 FVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENV 165
            +LME C    L+D+MN RL  +L+E EIL IM   + GI+ MH LQ  L+HRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 166 LISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINE 225
           L+  +N +K+CDFGS         + QE   +  +I  +TT QYRSPEM+DL + LPI+E
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 226 KSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPS 285
           KSDIWALGVFLYKL +YTTPFE   G+ AIL ++++ P    YS RL NLI +ML++NP+
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMT-GQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPN 314

Query: 286 DRPNVCQVLEEVSRLQGIPCPIRNFY 311
            RPN+ QV+ +V    GI  PI++ Y
Sbjct: 315 LRPNIYQVMHQVCITIGIEPPIKDKY 340

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  291 bits (746), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 206/322 (63%), Gaps = 20/322 (6%)

Query: 3   HPQIE-TFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI-------------SPSDPYI 48
            PQIE  FP+G+++TVGSH  +V+ YL  GG+AQ+Y V+              S + P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  NSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG----AYE 104
             + ACLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+AS+   Y+G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           V +LME C    L+D+MN RL  +LTE EI  IM   +  +A MH L   L+HRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           VL+  NN +K+CDFGS         + Q+   +  D+  +TT QYRSPEM+DL K +PIN
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNP 284
           EKSDIWALGVFLYKL ++TTPFE+  G+ A+L ++F++P    YS +L NLI VML++NP
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERT-GQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENP 386

Query: 285 SDRPNVCQVLEEVSRLQGIPCP 306
           S RPN+ QVL  +S +     P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  293 bits (749), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 211/342 (61%), Gaps = 12/342 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI---------SPSDPYINSN 51
           M HP +E F  G I+ VG+H  +VI YL  GG+AQ+Y V+          + S P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +ACLKRV+V D+  LN +R EV+ MK LK   +VV Y DS+AS+       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +LTE+EI+ IM      I+ MH L   L+HRDIKIENVL+  NN
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+ DFGS           Q+   +  +I  +TT QYRSPEM+DL + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LG+FLYKL ++TTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ 
Sbjct: 254 LGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIY 311

Query: 292 QVLEEVSRLQGIPCPIRNFYLLRAMENNKRT-IEQPVQNVYM 332
           QVL  +  +  I  PI + Y   A   +K T  +  +QNV +
Sbjct: 312 QVLYHLCEILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQL 353

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  288 bits (738), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 151/331 (45%), Positives = 212/331 (64%), Gaps = 25/331 (7%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKV-----------EISPS--DPYINSNI 52
           +E +  G+++ VGSH  ++++Y+  GG+AQ+Y V           E SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGA--------YE 104
           ACLKRVIV D+  LN LR EV+ MK L    ++V Y DS+AS+  + NG         +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           V +LME C    L+D+MN RL  +L+E EIL +M   S  IA MH L+  L+HRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           VL+ Q N +K+CDFGS           ++  ++  +I  +TT QYRSPEM+DL + LPI+
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNP 284
           EKSDIWALG+FLYKL ++TTPFE+  G+ AIL ++F++P    YS +L NLI VMLS+NP
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERT-GQFAILHSKFEFPQN-NYSFKLINLIIVMLSENP 310

Query: 285 SDRPNVCQVLEEVSRLQGIPCPIRNFYLLRA 315
           + RPN+ QVL ++ +L+ +P PI + Y L A
Sbjct: 311 NLRPNIYQVLHQICQLKQVPIPIADKYGLGA 341

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  291 bits (746), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 212/342 (61%), Gaps = 12/342 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI---------SPSDPYINSN 51
           M HP +E +  G I+ VG+H  +V+ YL  GG+AQ+Y V+          + S P    +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +ACLKRV+V D+  LN +R EV+ MK LK   ++V Y DS+AS+       +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +LTEAEI+ IM   +  I+ MH L  +L+HRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+ DFGS           Q+   +  +I  +TT QYRSPEM+DL + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LGVFLYKL ++TTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ 
Sbjct: 254 LGVFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIY 311

Query: 292 QVLEEVSRLQGIPCPIRNFYLLRAMENNKRT-IEQPVQNVYM 332
           QVL  +  +  +  PI + Y   A   +K T  +  +QNV +
Sbjct: 312 QVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQL 353

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  286 bits (733), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 206/326 (63%), Gaps = 11/326 (3%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVE----ISPSDP-----YINSNIACLK 56
           ++++  G I+ VG H  +V+KYL  GG+A++Y V+    +S  DP       N +  CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGG 116
           RV+V D   LN +R EV+ M+ LK    VV Y DS+AS+       YEV +LME C    
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVC 176
           L+D+MN RL  +L+E EIL IM   +  +A MH L   L+HRDIKIENVL+   N +K+C
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFL 236
           DFGS    +    + Q+   +  +I  +TT QYRSPEM+DL + LP+NEKSDIWALGVFL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
           YKL +YTTPFE+  G+ AIL +++++P    YS +L NLI VML++NP+ RPN+ QVL +
Sbjct: 266 YKLMFYTTPFERT-GQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQ 323

Query: 297 VSRLQGIPCPIRNFYLLRAMENNKRT 322
           +  + GI  P+ + Y L A    K T
Sbjct: 324 ICYISGIKNPMDDAYGLGAYSFEKYT 349

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  286 bits (733), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 202/316 (63%), Gaps = 10/316 (3%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI--------SPSDPYINSNIACL 55
           P +E    G ++ VGSH  +++KYL  GG+A +Y V+         +PS      ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERG 115
           KRV+V D+  LN LR EV+ MK LKN+ ++V Y DS+AS+    +  YEV +LME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
            L+D+MN RL  +L+E E+L IM   ++ +A MH L   L+HRDIKIENVL+   N +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVF 235
           CDFGS           Q+   + ++I  +TT QYR+PEM+DL + LPI+EKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           LYKL +YTTPFE   G+ AIL +++  P+   YS +L NLI +ML++NP+ RPN+ QV+ 
Sbjct: 267 LYKLLFYTTPFELT-GQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIY 324

Query: 296 EVSRLQGIPCPIRNFY 311
           +V  +  +  P  + Y
Sbjct: 325 QVCAIMKVDVPFEDKY 340

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  289 bits (740), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 203/319 (63%), Gaps = 16/319 (5%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI------SPSDPYINSN--------IAC 54
           +P+G  + VGSH  +VIKY+  GG+AQ+Y V+         S P  N N        IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV+V D   LN +R EV+ M+ L+    VV Y DS+AS  +     YEV +LMEFC  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
             L+D+MN RL  RL+E EI+ IM  T+ GIA +H L+  L+HRDIKIENVL+ Q N +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS         N ++      +I  NTT QYRSPEM+DL +  PI+EKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL ++TTPFE+  G+ AIL +++++P    YS +L NLI +ML++NPS RPN+ QVL
Sbjct: 339 FLYKLLFFTTPFERT-GQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVL 396

Query: 295 EEVSRLQGIPCPIRNFYLL 313
           + +  + G   P+ + Y L
Sbjct: 397 QYLCSINGWKVPLNDKYGL 415

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  285 bits (729), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 202/323 (62%), Gaps = 19/323 (5%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKV-------EISPSDPYIN--------- 49
           IE F  GQ L VG+H  +++ YLT GG+AQ+Y V       E    D   N         
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -SNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVL 108
             ++ACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++S   N  YEV +L
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLIS 168
           ME C    L+++MN RL  +L+E E+L IM   + G+A MH L+  L+HRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 QNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSD 228
            NN +K+CDFGS           Q+   +  ++  +TT QYRSPEM+DL + LPINEKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRP 288
           IWALGVFLYKL +YTTPFE   G+ A+L ++F  P+   YS ++ NL+ +MLS+N + RP
Sbjct: 268 IWALGVFLYKLLFYTTPFETT-GQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRP 325

Query: 289 NVCQVLEEVSRLQGIPCPIRNFY 311
           N+ QV+  + +L  +  PI + Y
Sbjct: 326 NIYQVMHYICQLIQVDTPILDIY 348

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  281 bits (720), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 207/314 (65%), Gaps = 13/314 (4%)

Query: 10  PSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI----SPSDPYINS------NIACLKRVI 59
           P+ Q++ VG+H  +++++L  GG+A +YKV+     +  D  I+S      +IACLKRVI
Sbjct: 31  PNTQVV-VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVI 89

Query: 60  VPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLID 119
           VPD+  LN LR EV+ MK L+ + ++V Y DS+AS+    +  +E+ +LME C +  L+D
Sbjct: 90  VPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLD 149

Query: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
           +MN++L  +LTEAEIL IM   S  IA MH L   L+HRDIKIENVL+ +++ +K+CDFG
Sbjct: 150 YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG 209

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
           S           Q+   + ++I  +TT QYRSPEM+DL + LPINEKSDIWALG+FLYKL
Sbjct: 210 STSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269

Query: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
            +YTTPFE   G+ AIL ++++ P    YS +L NLI +ML++NPS RPN+ QV+  V  
Sbjct: 270 LFYTTPFELT-GQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327

Query: 300 LQGIPCPIRNFYLL 313
           +     P  + Y L
Sbjct: 328 ILKCDVPFTDKYEL 341

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  285 bits (728), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 148/340 (43%), Positives = 210/340 (61%), Gaps = 12/340 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI---------SPSDPYINSN 51
           M HP +E +  G+I+ VG+H  +++ YL  GG+AQ+Y V+          + S P    +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +ACLKRV+V D+  LN +R EV+ MK LK   +VV Y DS+AS+       +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +L+E+EI+ IM   +  I+ MH L   L+HRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+ DFGS           Q+   +  +I  +TT QYRSPEM+DL + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LG+FLYKL ++TTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ 
Sbjct: 254 LGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIY 311

Query: 292 QVLEEVSRLQGIPCPIRNFYLLRAMENNKRT-IEQPVQNV 330
           QVL  +  +     PI + Y   A +  K T  +  +QNV
Sbjct: 312 QVLYHICDILNAEVPIEDKYSEGAYDFAKYTKFQNKLQNV 351

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  280 bits (716), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 196/317 (61%), Gaps = 16/317 (5%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN-----------SNIAC 54
           +E   +G IL VG H  ++I+YL  GG+A +YKV       Y N            +IAC
Sbjct: 25  LEKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIE---YTNELDRHHSVLQRGDIAC 81

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV V D+  LN LR EV+ MK LK   +VV Y DS+AS+       +EV +LME C  
Sbjct: 82  LKRVQVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSN 141

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
           G L+D+MN RL  +L+E E+L IM   ++GI+ MH L+  L+HRDIKIENVL+   N +K
Sbjct: 142 GSLLDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFK 201

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS    +      QE   + ++I  +TT QYRSPEM+DL + L INEKSDIWALG+
Sbjct: 202 LCDFGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGI 261

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL +YTTPFE   G+ AIL +++  P    +S +L NLI VML++NP  RPN+ Q+L
Sbjct: 262 FLYKLLFYTTPFELT-GQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQIL 319

Query: 295 EEVSRLQGIPCPIRNFY 311
             +  +     PI + Y
Sbjct: 320 YHICSIMECDVPIEDHY 336

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  283 bits (723), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 200/320 (62%), Gaps = 11/320 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI---------SPSDPYINSN 51
           M HP +E +  G I+ VG+H  +++ YL  GG+AQ+Y V+          + S P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +ACLKRV+V D+  LN +R EV+ MK LK   +VV Y DS+AS+       +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +LTE EI+ IM   +  I+ MH L   L+HRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+ DFGS           Q+   +  +I  +TT QYRSPEM+DL + LPINEKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LG+FLYKL ++TTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ 
Sbjct: 254 LGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIY 311

Query: 292 QVLEEVSRLQGIPCPIRNFY 311
           QVL  +  +  +  PI + Y
Sbjct: 312 QVLCHLCDILNVEVPIEDKY 331

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  283 bits (723), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 148/356 (41%), Positives = 210/356 (58%), Gaps = 12/356 (3%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEI---------SPSDPYINSNIAC 54
           P ++ +  G ++ VG+   ++I ++  GG+AQ+Y V+              P    +IAC
Sbjct: 17  PVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV+VPD+  L+ +R EV+ MK L+  + ++ Y DS+AS+       YEV +LME C  
Sbjct: 77  LKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPN 136

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
             L+D+MN RL  RLTE EIL +M  T+  I+ MH L   L+HRDIKIENVL+   N +K
Sbjct: 137 NSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFK 196

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS           Q+   +  +I  NTT QYRSPEM+DL + LPINEKSDIWALG+
Sbjct: 197 LCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL ++ TPFE   G+ +IL +++++P+   YS +L NLI +ML++NP  RPN+ QV+
Sbjct: 257 FLYKLLFFITPFEMT-GQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVM 314

Query: 295 EEVSRLQGIPCPIRNFYLLRAMENNKRT-IEQPVQNVYMPTTLSQPSTQMNLASLN 349
             +  + G   PI + Y L      K T  +  +QNV     L Q     N   LN
Sbjct: 315 HHICSVIGCEVPIEDKYGLGPYNFEKYTEFQTKLQNVQYQMYLLQQKKLENNGRLN 370

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  283 bits (724), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 148/331 (44%), Positives = 207/331 (62%), Gaps = 30/331 (9%)

Query: 7   ETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPS-DPYINSN-------------- 51
           E FP+G  + VGSH  ++IKY+  GG+AQ+Y V+   S + + +SN              
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 52  ---------IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGA 102
                    IACLKRV+V D+  LN +R EV+ MK LK   +VV Y DS+AS+   +NGA
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRR--HNGA 139

Query: 103 --YEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDI 160
             +EV +LME C    L+D+MN RL  +LTE EIL IM   +  ++ MH L+  LLHRDI
Sbjct: 140 SGFEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDI 199

Query: 161 KIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKG 220
           KIENVL+   N +K+CDFGS    +      Q+   +  +I  +TT QYRSPEM+DL + 
Sbjct: 200 KIENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRC 259

Query: 221 LPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVML 280
           LPI+EKSDIWALG+FLYKL ++ TPFE   G+ AIL +++++P    YS +L NLI +ML
Sbjct: 260 LPIDEKSDIWALGIFLYKLLFFITPFEMT-GQFAILHSKYEFPKN-NYSSKLINLIIIML 317

Query: 281 SKNPSDRPNVCQVLEEVSRLQGIPCPIRNFY 311
           ++NP+ RPN+ QVL+ +  +  +  PI + Y
Sbjct: 318 AENPNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  279 bits (713), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 201/317 (63%), Gaps = 11/317 (3%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVY---------KVEISPSDPYINSNIAC 54
           P +E   +G  + VG+H  +++KYL  GG+A +Y         ++E +PS        AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHAS+S      +EV +LME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
             L+D+MN RL  +L+E EIL IM   ++ +A MH L   L+HRD+KIENVL+  +N +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS    +      QE   + ++I  +TT QYRSPEM+DL + LPI+EKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL +YTTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ Q++
Sbjct: 264 FLYKLLFYTTPFELT-GQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIM 321

Query: 295 EEVSRLQGIPCPIRNFY 311
           + +  +  +  PI + Y
Sbjct: 322 DNLCSIMKVENPIEDKY 338

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  279 bits (714), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 139/319 (43%), Positives = 203/319 (63%), Gaps = 11/319 (3%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVY---------KVEISPSDPYINSNIAC 54
           P +E   +G  + VG+H  +++KYL  GG+A +Y         ++E  P+      ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHAS++   +  +EV +LME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
             L+D+MN RL  +L+E EIL IM   ++ +A MH L   L+HRD+KIENVL+  N+ +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS           QE   + ++I  +TT QYRSPEM+DL + LPINEKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL +YTTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ QV+
Sbjct: 306 FLYKLLFYTTPFELT-GQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVM 363

Query: 295 EEVSRLQGIPCPIRNFYLL 313
           + +  +  +  P+ + Y L
Sbjct: 364 DNLCSILKVKNPLEDKYQL 382

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  281 bits (718), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 198/320 (61%), Gaps = 11/320 (3%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKV---------EISPSDPYINSN 51
           + +P +E F  G ++ VG+H  +V+ YL  GG+AQ+Y V         E     P    +
Sbjct: 14  VGNPTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +ACLKRV+V D+  L+ +R EV+ MK L   +++V Y DS+A +    N  +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMEL 133

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +LTE EIL IM   S  ++ MH L+  L+HRDIKIENVL+   N
Sbjct: 134 CPNKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQN 193

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+CDFGS           QE   +  +I  +TT QYR PEM+DL + LPINEKSDIWA
Sbjct: 194 SFKLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LG+FLYKL ++ TPFE   G+ AIL +++++P    YS +L NLI +ML++NP  RPN+ 
Sbjct: 254 LGIFLYKLLFFITPFEMT-GQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIY 311

Query: 292 QVLEEVSRLQGIPCPIRNFY 311
           QVL  +  + G+  PI + Y
Sbjct: 312 QVLNHICTMIGVEVPIEDKY 331

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  276 bits (706), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 141/314 (44%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKV-------EISPSDPYIN-SNIACLKR 57
           +E   +G  + VG H  +VI+YL  GG+A +YKV       E+   D  +   +  CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 58  VIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGL 117
           V V D+  LN LR EV+ MK L+N  ++V Y DS+AS+       YEV +LME C  G L
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 118 IDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCD 177
           +D+MN RL  +L+EAE+L IM   + G++ MH  +  L+HRDIKIENVL+  +N +K+CD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 178 FGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLY 237
           FGS    +    + QE   + ++I  +TT QYRSPEM+DL + LPINEKSDIWALG+FLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 238 KLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           KL +YTTPFE   G+ AIL ++++ P    +S +L NL+ +ML++NP  RPNV QV+  +
Sbjct: 266 KLLFYTTPFELT-GQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 298 SRLQGIPCPIRNFY 311
             +      I + Y
Sbjct: 324 CSMMECEVKIDDLY 337

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  278 bits (710), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 203/320 (63%), Gaps = 16/320 (5%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVE-ISPSDPYIN---------SNIA 53
           P  E +  G  + VG+H  ++IKY+  GG+AQ+Y V+ I   + + N          ++A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG--AYEVFVLMEF 111
           CLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+AS+   +NG   +EV +LME 
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLMEL 134

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
           C    L+D+MN RL  +LTE EIL IM   +  ++ MH L   LLHRDIKIENVL+   N
Sbjct: 135 CPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN 194

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWA 231
            +K+CDFGS           Q+   +  +I  +TT QYRSPEM+DL + LPI+EKSDIWA
Sbjct: 195 NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWA 254

Query: 232 LGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVC 291
           LG+FLYKL ++TTPFE   G+ AIL +++++P    YS +L NLI +ML++NP+ RPN+ 
Sbjct: 255 LGIFLYKLLFFTTPFELT-GQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIY 312

Query: 292 QVLEEVSRLQGIPCPIRNFY 311
           QVL  +  + G+  PI + Y
Sbjct: 313 QVLHNICSISGMKVPIEDQY 332

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  276 bits (706), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 195/322 (60%), Gaps = 38/322 (11%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN---------------- 49
           IE +  G ILTVG    +++KYLT GG+AQ+Y V       Y+N                
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIE---YLNEFDNDDAENDNNSRNL 93

Query: 50  --SNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASK------------ 95
              ++ACLKRV+VPD+  L+ +R EVD MK L N  ++V Y DS+ASK            
Sbjct: 94  KIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNN 153

Query: 96  ---SAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQ 152
              +   +  +E+ +LME+C    L+DFMN RL  +LTE EIL  M+  +  +  MH L 
Sbjct: 154 NDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLA 213

Query: 153 PALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSP 212
             L+HRDIKIENVL+  NN +K+ DFGS   I  P    Q+   +  DI  NTT QYRSP
Sbjct: 214 QPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSP 273

Query: 213 EMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRL 272
           EM+DL K LPI+EKSDIWALGV LYKL +YTTPFE   G+ AIL +++++P+   YS + 
Sbjct: 274 EMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFEL-TGQFAILHSKYEFPA-NNYSSKF 331

Query: 273 KNLIRVMLSKNPSDRPNVCQVL 294
            NLI +ML++NP+ RPN+ QVL
Sbjct: 332 INLIIIMLAENPNLRPNIFQVL 353

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  279 bits (713), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 208/339 (61%), Gaps = 14/339 (4%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKV-------EISPSDPYINS----NIAC 54
           IE +  G++++VG+H  K+  YL  GG+AQ+YKV       E       +NS    +IAC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCER 114
           LKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A +       YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
             L+D+MN RL+ +L E EI+ IM  T+  ++ MH L   L+H+DIK+EN+L+  NN +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGV 234
           +CDFGS         +  +   +  +I  +TT QYRSPEM+DL + LPINE SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           FLYKL ++ TPFE+  G+ +IL A+F  P    Y  +L NLI +MLS+N + RPN+ QV+
Sbjct: 272 FLYKLLFFITPFER-TGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVM 329

Query: 295 EEVSRLQGIPCPIRNFYLLRAMENNK-RTIEQPVQNVYM 332
            E+  +   P PI + Y +     +K  T +  +QN+ M
Sbjct: 330 YEICSITNTPLPIEDKYGMGPYNFDKYATFQNNLQNIQM 368

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  270 bits (689), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 200/326 (61%), Gaps = 11/326 (3%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVY---------KVEISPSDPYINSNIACLK 56
           I+T+  G I+ VG H  ++IKYL  GG+A++Y         +++I+        ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGG 116
           RV+V D   LN +R EV  MK L    ++V   DS+AS+       YEV +LME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVC 176
           L+D+MN RL  +LTE EIL IM   +  +A MH L   L+HRDIKIENVL+   N +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFL 236
           DFGS    +      ++   +  ++  +TT QYRSPEM+D+ + + INEKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
           YKL +Y TPFE+  G+ AIL +++++P +  YS +L NLI +ML++NP+ RPN+ QVL  
Sbjct: 336 YKLLFYITPFERT-GQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAY 393

Query: 297 VSRLQGIPCPIRNFYLLRAMENNKRT 322
           + ++  I  PI + Y L   +  K T
Sbjct: 394 ICKIINIKTPIDDIYGLGPYDFQKYT 419

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 146/338 (43%), Gaps = 62/338 (18%)

Query: 14  ILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEV 73
            +++     ++ K L  GG + VY VE    + +       LK+   P      ++ +  
Sbjct: 18  FVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSIS 67

Query: 74  DAMKLLKNNR-----HVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH- 127
            AMK + N +     ++   +DS   +    +G+  V+VL+ +  +G L D +N  L   
Sbjct: 68  PAMKEVANYQRFSSPYIAQIVDSQVVQEK--DGSKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 128 -RLTEAEILTIMSHTSQGIAAMHRLQP-------------------ALL----------- 156
            +++E +IL +    ++G+  +H   P                   +LL           
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 157 -----HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMK-NTTAQYR 210
                HRD+K  N++IS  +   + D GS C   R   N ++    + +    N T  Y 
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQARFQYPS 264
           +PE+LD+     I EK DIW+ G  +Y +C+  +PFE+    +G     AI   ++  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 265 YPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQG 302
              YS  L  LI   LS NP  RP+V +++  +  LQG
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 126/221 (57%), Gaps = 19/221 (8%)

Query: 483 RPTNYVDEETQTYTGQSTFLXXXXXXXXXXXXXXQYSGV--QENTTGSSLVRKLSVKLKN 540
           R ++YVD ETQT+                       S    +E +TG S  R++  KLK 
Sbjct: 458 RLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKR 517

Query: 541 VLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSA--SYD-NGKRLSS---- 588
           +++ E      I+SRQNTG S RSA +++R G + N ++ RS   S D + +RL S    
Sbjct: 518 IISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNK 577

Query: 589 VNLHMHSAILEQDDSDEFEMPRYN-SVSSNTL-KDVEEHERRTVNTSSREYYRSQSPVRM 646
           V +    +I E+ ++++FE   +N SVS++++  D+ ++E +   + SR Y ++ SP++M
Sbjct: 578 VRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGK-AGSVSRGYNQAHSPIKM 636

Query: 647 SVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDY 687
           S NRE +NSIQKRV DLLKN+++  +   +TA  +G+++ +
Sbjct: 637 SANRESRNSIQKRVHDLLKNSQD--SPVRKTAPDFGEFSSF 675

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 129/275 (46%), Gaps = 28/275 (10%)

Query: 26  KYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHV 85
           ++L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K + +  ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHT-NI 140

Query: 86  VSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGI 145
           V +ID        +     V++L+E C  G L++ +  R    +TE E+   M+    GI
Sbjct: 141 VQFIDC-------FEDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
             MH     ++HRD+K+ N+   ++   K+ DFG    +     N +E  F         
Sbjct: 192 QYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLA----NDRERKFTI-----CG 240

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQY 262
           T  Y +PE+L + K    + + DIW++GV LY L     PF+    N     I Q  F Y
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 263 PSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           P     S   K LI  +LS NP +RP++ ++++ V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 136/275 (49%), Gaps = 35/275 (12%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH-- 84
           +L  GG+A+ ++++      +    +A   ++ +  + + N L +E+   ++ KN RH  
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEI---QIHKNMRHQN 156

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V +ID        +     V++L+E C  G L+D +  R    LTE E+    +     
Sbjct: 157 IVHFIDC-------FEDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGA 207

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  MH     ++HRD+K+ N+   ++   K+ DFG +  I+   +N++++          
Sbjct: 208 LDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIINN-ENERKYTIC------- 256

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS 264
            T  Y +PE++   K +  + + DIW+LGV ++ +     PF+    E + +  R ++ +
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ--AKEVSTIYDRIKHCN 314

Query: 265 YPMYSDR-----LKNLIRVMLSKNPSDRPNVCQVL 294
           Y   +D+     +K LI+ +LS NP +RP + ++L
Sbjct: 315 YSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 133/283 (46%), Gaps = 29/283 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A L    +  + +   L +E+   K +K+ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     I 
Sbjct: 143 QFIDCFEDDTNVY-------ILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   +N   K+ DFG    +     N +E  +         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW++GV LY L     PF+    N     I    F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306
                S+  K LI+ +LS +P +RP++ ++++ V   +GI  P
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPP 343

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 135/283 (47%), Gaps = 46/283 (16%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPD-KPSLN---TLRAEVDAMKLLKNNRHVV 86
           G ++ VYKV    SD  +      LK++ + D K   N   T+  E++  KL+  +++++
Sbjct: 59  GSHSIVYKVTHPTSDATL-----ALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNII 113

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
           S ID     + +Y       +++E C  G L D +  R +  L E E   +M      + 
Sbjct: 114 SMIDHFEIDATMY-------MVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVD 165

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT- 205
            +H  +  ++H D+K+ N+LI  +N  ++CDFG               +FV  DI  N+ 
Sbjct: 166 WIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH--------------SFVSTDIDNNSI 209

Query: 206 ----TAQYRSPE-----MLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA-- 254
               T  Y SPE     +L   K L   ++SDIW++G+ LY + +  TPFE     +   
Sbjct: 210 NKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYE 269

Query: 255 -ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
            I++ ++ +      S+++K LI+ +L   P +R  + +++ +
Sbjct: 270 NIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 133/283 (46%), Gaps = 29/283 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A L    +  + +   L +E+   K +++  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRHA-NIV 161

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID    ++ +Y       +L+E C  G L++ +  R    LTE E+    +    GI 
Sbjct: 162 QFIDCFEDETNVY-------ILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   +N   K+ DFG    +     N +E  +         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 261

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW++GV +Y L     PF+    N     I    F +P
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306
                S   + L++ +LS +P +RP++ +VL+ V   +GI  P
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYVW-FRGIFPP 362

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++    D +    +A   +  +  + +   L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     S +Y       +L+E C  G L++ +  R    L+E E+    +     I 
Sbjct: 143 QFIDCFEDDSNVY-------ILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG    +     N+ E  +         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW+LGV LY L     PF+    N     I    F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                SD  K LIR +LS +P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++    + +    +A   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     S +Y       +L+E C  G L++ +  R    LTE E+    +     I 
Sbjct: 143 QFIDCFEDDSNVY-------ILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG    +     N+ E  +         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW+LGV LY L     PF+    N     I    F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                SD  K LIR +LS +P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 133/282 (47%), Gaps = 33/282 (11%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH-- 84
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   ++ K+ RH  
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 149

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           VV +ID     + +Y       +L+E C  G L++ +  R    +TE E+   M+     
Sbjct: 150 VVQFIDCFEDDTNVY-------ILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGA 200

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           I  MH  +  ++HRD+K+ N+   +N   K+ DFG    +     N +E  +        
Sbjct: 201 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----C 249

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQ 261
            T  Y +PE+L + K    + + DIW++GV +Y L     PF+    N     I    F 
Sbjct: 250 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFA 308

Query: 262 YPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGI 303
           +P     S+  K LI  +LS +P +RP++ ++++ V   +GI
Sbjct: 309 FPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVW-FRGI 349

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++    + +    +A   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     S +Y       +L+E C  G L++ +  R    LTE E+    +     I 
Sbjct: 143 QFIDCFEDDSNVY-------ILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG    +     N+ E  +         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW+LGV LY L     PF+    N     I    F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                SD  K LIR +LS +P +RP++ ++++ V
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 154/343 (44%), Gaps = 36/343 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++        +    +A L    +  + +   L +E+   K +KN  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     I 
Sbjct: 144 QFIDCFEDDTNVY-------ILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   ++   K+ DFG    +     N +E  +         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 243

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW++GV LY L     PF+    N     I    F +P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCPIRNFYLLRAMEN--NKR 321
                S   K LI+ +LS +P +RP+V ++++ V   +G+  P     ++  + N  N+ 
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVW-FRGLFPPQIESDVMTNIPNYDNQL 361

Query: 322 TIEQPVQNVYMPTTLSQPSTQMNLASLN---DTLPTAALKFNQ 361
           T+EQ + N      L       + A++N   D  P + +K N+
Sbjct: 362 TMEQSIVN--FKKCLESSGLLSDAAAVNPSSDKQPISIIKNNE 402

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 127/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +K++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     I 
Sbjct: 156 QFIDCFEDDANVY-------ILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            +H  +  ++HRD+K+ N+   ++   KV DFG    +     N +E  +         T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NDRERKYTVCG-----T 255

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW++GV +Y L     PF+    N     I   ++ YP
Sbjct: 256 PNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYP 314

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                S   + LI  +LS NP  RP +  ++++V
Sbjct: 315 KDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 127/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++    + +    +A   +  +  + +   L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            ++D     S +Y       +L+E C  G L++ +  R    LTE E+    +     I 
Sbjct: 143 QFVDCFEDDSNVY-------ILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG    +     N+ E  +         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW+LGV LY L     PF+    N     I    F +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                SD  K LIR +LS +P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 132/283 (46%), Gaps = 29/283 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ +++       +    +A L    +  + +   L +E+   K +K+ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L++ +  R Q  LTE E+    +     I 
Sbjct: 206 QFIDCFEDDTNVY-------ILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   +N   K+ DFG    +     N +E  F         T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKFTV-----CGT 305

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + D+W++GV +Y L     PF+    N     I    F +P
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306
                S   K L++ +LS +P +RP++ ++++ V   +GI  P
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVW-FRGIFPP 406

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 141/308 (45%), Gaps = 31/308 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +K+  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHP-NIV 152

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            ++D     + +Y       +L+E C  G L+D M  R    LTE E+    +     + 
Sbjct: 153 HFVDCFEDDTNVY-------ILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   ++   KV DFG    +     N +E  +         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----NNRERKYTV-----CGT 252

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA---ILQARFQYP 263
             Y +PE+L + K    + + DIW++GV +Y L     PF+          I   ++ YP
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGI--PCPIRNFYLLRAMENNKR 321
                S   K LI  +L  +P +RP++ +++++V   +GI  P    +   L   + N+ 
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDVW-FRGIFPPKITEDVMELTPKDTNEI 370

Query: 322 TIEQPVQN 329
           T+E+   N
Sbjct: 371 TLEESFTN 378

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/355 (23%), Positives = 151/355 (42%), Gaps = 78/355 (21%)

Query: 14  ILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEV 73
           +L  G H+A + + L  GG++ VY V+        N+++  LK++  P       + +  
Sbjct: 21  VLINGQHYA-IQRLLGEGGFSFVYLVQSRE-----NNDLFALKKIHCP----FGNIESVS 70

Query: 74  DAMKLLKNNRHVVSYIDSHASKSAIY---NGAYEVFVLMEFCERGGLIDFMNSRLQH--R 128
           +AM+ + + +   S   +H   S +    +G+  VF+L+ +   G L+D +N+ L     
Sbjct: 71  EAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGTT 130

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPA---------------LLHRD-------------- 159
           ++E EI+ I+   ++G+  MH   PA               L +RD              
Sbjct: 131 ISEEEIVRILVSVARGLRTMH--NPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLN 188

Query: 160 --------------------------IKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQE 193
                                     IK  N++ S +    +CD GS         ++ +
Sbjct: 189 DSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQ 248

Query: 194 FNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----N 249
                    ++ T  +RSPE+L+++    I+EK DIW+LG  LY +C+  +PFE+    +
Sbjct: 249 LVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLS 308

Query: 250 GGEA--AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQG 302
           G     AI   +F  P    YS  L  +I+  +  +   RP++ ++L  +  LQG
Sbjct: 309 GASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 127/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +K+  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHP-NIV 133

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            + D     + +Y       +L+E C  G L+D +  R Q  LTE E+    +     I 
Sbjct: 134 QFTDCFEDDTNVY-------ILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   ++   K+ DFG    +     N +E  +         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF---EKNGGEAAILQARFQYP 263
             Y +PE+L   K    + + DIW++GV +Y L     PF   E N     I    F +P
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                S   K LI+ +LS +P +RP++ +++E V
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 145/329 (44%), Gaps = 60/329 (18%)

Query: 17  VGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIA-----CLKRVIVPDKPSLNTLRA 71
           V     ++ + L  GG + VY V++S +   I++ IA      LK++I P   S++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR--L 129
           E++  K  ++  +V+  IDS   +    +G+  +++++ +   G L D +N RL     +
Sbjct: 85  EIENYKRFQSP-YVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEGTFV 141

Query: 130 TEAEILTIMSHTSQGIAAMH-----------RL-----------QPALL----------- 156
           +EAE + IM   ++G+  +H           R+           + A+L           
Sbjct: 142 SEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDML 201

Query: 157 -----------HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
                      HRDI   N+L S +    + D GS        +N+ + + +   +  N 
Sbjct: 202 SSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNC 261

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQAR 259
           T  Y  PE+L+L     ++ K DIW+LG   Y L +  +PFE+    +G     AI   +
Sbjct: 262 TLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGK 321

Query: 260 FQYPSYPMYSDRLKNLIRVMLSKNPSDRP 288
           + +P    +S+ L ++I+  +  +P  RP
Sbjct: 322 YSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 127/274 (46%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ +++       +    +A   ++ +  + +   L +E+   K +K+  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     I 
Sbjct: 156 QFIDCFEDDTNVY-------ILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   +    K+ DFG    +     N +E  +         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----CGT 255

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQYP 263
             Y +PE+L + K    + + DIW++GV +Y L     PF+    N     I    F +P
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
              + S   K LI+ +LS +P +RP+V ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 144/342 (42%), Gaps = 60/342 (17%)

Query: 17  VGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIAC-----LKRVIVPDKPSLNTLRA 71
           V     K+ + L  GG + VY V++      + + +A      LK++I P+  S++    
Sbjct: 25  VNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISNGMR 84

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR--L 129
           E++  K  ++  +V+  IDS   +    +G+  +++++ F   G L D +N RL     +
Sbjct: 85  EIENYKRFQSP-YVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLEGTFI 141

Query: 130 TEAEILTIMSHTSQGIAAMHR---------------------------------LQPALL 156
           +EAE + IM    +G+  +H                                  L+  +L
Sbjct: 142 SEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMDML 201

Query: 157 -----------HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
                      HRDI   N+L S +    + D GS         N+ +   +   +  N 
Sbjct: 202 SSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVNDNC 261

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQAR 259
           T  Y +PE+L L     ++ K DIW+LG   Y L +  +PFE+    +G     AI   +
Sbjct: 262 TLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINTGK 321

Query: 260 FQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQ 301
           + +P    +S+ L ++I+  +  +P  RP   Q+L  +  L+
Sbjct: 322 YSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 130/276 (47%), Gaps = 38/276 (13%)

Query: 28  LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAE---VDAMKLLKNNR- 83
           L  GG+A+ + ++       +  + AC     +  K S+ T R +   +  +++ +N R 
Sbjct: 99  LGEGGFARCFHIKDD-----VGISFACK----IVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 84  -HVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTS 142
            H+V ++D        +     V++L+E C  G L+D +  R    LTEAE+  + +   
Sbjct: 150 SHIVKFMDC-------FEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVC 200

Query: 143 QGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIM 202
             I  MH     ++HRD+K+ NV   +N   K+ DF    G+     N  E  +      
Sbjct: 201 GAINYMH--SNNIIHRDLKLGNVFFDKNFNIKIGDF----GLAATLSNVSEKKYTMCG-- 252

Query: 203 KNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQAR 259
              T  Y +PE++ LSK +  + ++DIW+LG+ +Y +     PF+          I   +
Sbjct: 253 ---TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 260 FQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           +++P     ++ +K LI+ +L  +PS RP +  +L+
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 128/276 (46%), Gaps = 32/276 (11%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH-- 84
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   ++ K+ RH  
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHPN 131

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V + D     + +Y       +L+E C  G L+D +  R Q  LTE E+    +     
Sbjct: 132 IVQFTDCFEDDTNVY-------ILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGA 182

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           I  MH  +  ++HRD+K+ N+   ++   K+ DFG    +     N +E  +        
Sbjct: 183 IKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----C 231

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF---EKNGGEAAILQARFQ 261
            T  Y +PE+L   K    + + D+W++GV +Y L     PF   E N     I    F 
Sbjct: 232 GTPNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFN 290

Query: 262 YPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           +P     S   K LI+ +LS +P +RP++ +++E V
Sbjct: 291 FPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 99/202 (49%), Gaps = 36/202 (17%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIE 163
           +V++++E+C    L D++ S+   R++  E   I +     +   H L  + +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 164 NVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT-------TAQYRSPEMLD 216
           N+L+ ++N  K+ DFG                    D  KNT       T  Y +PE+L 
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLR 202

Query: 217 LSK--GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRL 272
             K  G  I    DIWALG+ LY +   T PF+++  +   L+     P Y    ++D  
Sbjct: 203 REKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDS 258

Query: 273 KNLIRVMLSKNPSDRPNVCQVL 294
            +L+  +LSK+PS RP + Q+L
Sbjct: 259 IDLVNRLLSKDPSMRPTIEQIL 280

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 134/299 (44%), Gaps = 59/299 (19%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNT 68
           F S ++  VG++  K++K +  G + +VY     P+   +     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQVGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNI 79

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNSRL 125
           +R      ++  + +    YI      + +Y       +V++ +E+C    L D + S  
Sbjct: 80  VR------EVFYHRQFDFPYI------TKLYEVIVTETKVWMALEYCPGKELYDHLLS-- 125

Query: 126 QHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIV 185
            HR++  E   + +  S  +   H +    +HRD+K+EN+L+ +N   K+ DFG      
Sbjct: 126 LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG------ 177

Query: 186 RPPKNQQEFNFVYHDIMKNT------TAQYRSPEMLDLS--KGLPINEKSDIWALGVFLY 237
                     F    + K T      T  Y +PE+++     G  I    DIW+LGV LY
Sbjct: 178 ----------FTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILY 223

Query: 238 KLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            L   + PF+ +       +   + P+Y   +  D  K+LI  +L+KNP +RP++ QVL
Sbjct: 224 TLITGSLPFDDDDEVKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/333 (23%), Positives = 147/333 (44%), Gaps = 56/333 (16%)

Query: 15  LTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVP--DKPSLNTLRAE 72
           ++V  H   + + L  GG++ VY VE         + +  LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESR------ENGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH--RLT 130
           VD  +  K+  ++   IDS   +    +G+  V++L+ +  +G L D +N  L    ++ 
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EAEILTIMSHTSQGIAAMHRLQPA-------------------LL--------------- 156
           E E++ +    ++G+  +H   PA                   LL               
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 157 -HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIM-KNTTAQYRSPEM 214
            H DIK  N++IS      + D GS C       N ++    + +   ++ T  + +PE+
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGS-CSRACVEINSRQALLQFQEWRSEHCTLTFMAPEI 248

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQARFQYPSYPMY 268
           LD+     I EK D+W+ G  +Y +C+  +PFE+    +G     ++   ++  PS   Y
Sbjct: 249 LDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNY 308

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQ 301
           S  L ++++  L+ +P  RP+V +++  +  LQ
Sbjct: 309 SSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 132/301 (43%), Gaps = 57/301 (18%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFC 112
           LKR+  P  +  S++    EVD  K  ++  ++++ +DS   +    +G+  + +L+ + 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQSP-YIITLVDSQVVQEK--DGSKTLCILLPYF 129

Query: 113 ERGGLIDFMNSRLQHR--LTEAEILTIMSHTSQGIAAMH--------------------- 149
             G L D +N  L     ++EAE + IM   ++G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 RLQPALL-----------------------HRDIKIENVLISQNNEYKVCDFGSVCGIVR 186
             + A L                       HRDI++ N+L S      V D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
               + + N +   +  N +  Y +PE+L++     I+ K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK----NGGEA--AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300
           E+    +G     AI   ++ +P    YS+ L  +I+  L  +P+ RP++ ++L+ +  L
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 301 Q 301
           Q
Sbjct: 370 Q 370

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 95/207 (45%), Gaps = 46/207 (22%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIE 163
           +V++ +E+C    L +++   +QHR++  E   + +     +   H LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISQNNEYKVCDFG------------SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRS 211
           N+L+ +    K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMLDLSK--GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSY--PM 267
           PE+++     G  I    DIW+LGV LY + + T PF++        +   + P Y   +
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDV 251

Query: 268 YSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            S   K+LI  +L K+PS RP + QVL
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVL 278

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 144/344 (41%), Gaps = 57/344 (16%)

Query: 14  ILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDP-YINSNIACLKRVIVP--DKPSLNTLR 70
           I+++ +   K+ K L     +  Y V    S+P + N  +  LKR+  P  D  S++   
Sbjct: 22  IISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFENGPLFVLKRIYCPFGDIESVSAAM 81

Query: 71  AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            E+   K    N H++S +D    +   Y+G+ ++ VL  F   G + D +N  L    T
Sbjct: 82  NEISYYKKFAGNSHIISCLDYQLHQK--YDGSKQIDVLFPFYHYGSVQDDINRHLLSSST 139

Query: 131 -------EAEILTIMSHTSQGIAAMH----RLQ----------------------PALLH 157
                  E + + IM    +G+  +H    R Q                      P  L 
Sbjct: 140 ALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLPMELS 199

Query: 158 RDIKIENV------------LISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
           +D + ENV            L+S+     + D  S          + + N     I ++ 
Sbjct: 200 KDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRFQQWIEEHC 259

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGG--EAAILQAR 259
           T Q+ +PE+L L  G  I  K DIW+LG  LY + +  +PFE+    NGG  +  I   +
Sbjct: 260 TLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCIKMGK 319

Query: 260 FQYP-SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQG 302
           +  P +   YS  + +++   L  +PS+RP++  +L  +  +QG
Sbjct: 320 YSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 125/269 (46%), Gaps = 34/269 (12%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G Y  VYK     +D      +  +K ++  +   LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-- 85

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
                      +YE+++L+E+C  G L   + SR    L+E E  T ++ T  G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLH- 138

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
               ++HRDIK  N+L+S +N  K+ DFG V  IV               +    T  + 
Sbjct: 139 -GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYP--MY 268
           +PE+L  ++G   +  SDIW+LG  + ++     P+  N  +A I  A      YP   +
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSF 241

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           S+ LK+ +     KN   RP   Q+L+ V
Sbjct: 242 SESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 133/277 (48%), Gaps = 37/277 (13%)

Query: 25  IKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH 84
           I    SGG    Y+V         N+++A +K++ +  +P    +  E+  MK  K+ ++
Sbjct: 629 IGQGASGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-QN 679

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V++IDS+  K        +++V+ME+ E G L D +   +   LTEA+I  +   T +G
Sbjct: 680 IVNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRG 729

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  +H     ++HRDIK +N+L+S N E K+ DFG    I        E N     ++  
Sbjct: 730 LQFLH--SKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQI-------NEINLKRTTMVG- 779

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYP 263
            T  + +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P
Sbjct: 780 -TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 835

Query: 264 SY---PMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
                 + S  LK+ +   L+ NP  R +  ++L +V
Sbjct: 836 KLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 125/274 (45%), Gaps = 28/274 (10%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A L    +  + +   L +E+   K +K+  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKHP-NIV 150

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            + D     + +Y       +L+E C  G +++ +  R    LTE E+   M      I 
Sbjct: 151 QFTDCFEDDTNVY-------ILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   +    K+ DFG    +     N +E  +         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA----NDKERKYTI-----CGT 250

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQAR---FQYP 263
             Y +PE+L   K    + + DIW++GV LY L +   PF+    E    + +   F +P
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           +    S   KNLI  +L  NP+ RP++ ++ + V
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 92/347 (26%), Positives = 147/347 (42%), Gaps = 51/347 (14%)

Query: 5   QIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKP 64
           QI ++  G+ L +GS     + Y  + G     KV IS +  + +SN+  +     PD  
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKV-ISKT-IFQDSNVTSMVDNTTPDAL 71

Query: 65  SLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSR 124
                R E+  MKLL N+ +V+   D   + S +Y       +++E+ E+G L + +  R
Sbjct: 72  PYGIER-EIVIMKLL-NHANVLRLYDVWETNSNLY-------MVLEYAEKGELFNLLVER 122

Query: 125 LQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
               L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG     
Sbjct: 123 --GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA-- 176

Query: 185 VRPPKNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLC 240
                          D +  T+     Y +PE++    G+P +   SD+W+ GV LY L 
Sbjct: 177 -----------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALL 222

Query: 241 YYTTPFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
               PF++  G        +   +F+ P     S   +NLI  +L  NP++R     +L+
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

Query: 296 EVSRLQGIPC-----PIRNF-----YLLRAMENNKRTIEQPVQNVYM 332
               LQ  P       IRN      YL    E N    E  +QN+ +
Sbjct: 283 H-PLLQKYPSIKDSKSIRNLPREDTYLHPLAETNSAIDENILQNLVV 328

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 141/329 (42%), Gaps = 60/329 (18%)

Query: 17  VGSHHAKVIKYLTSGGYAQVYKVEI-----SPSDPYINSNIACLKRVIVPDKPSLNTLRA 71
           V     K+ + L  GG + VY V++     S  +    + +  LK++I P   +++    
Sbjct: 25  VNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNGMR 84

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR--L 129
           E++  K  ++  +V+  IDS   +    +G+  +++++ +   G L D +N RL     +
Sbjct: 85  EIENYKRFQSP-YVIQSIDSQVMQEK--DGSKTIYIILPYYSLGSLQDSINRRLLEGTFI 141

Query: 130 TEAEILTIMSHTSQGIAAMHR---------------------------------LQPALL 156
           +EAE + IM   ++G+  +H                                  L+  +L
Sbjct: 142 SEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMDML 201

Query: 157 -----------HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
                      HRDI   N+L S +    + D GS         N+ + + +   +  N 
Sbjct: 202 SSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVNDNC 261

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQAR 259
           T  Y +PE+L+L     ++ K DIW++G   Y L +  +PFE+    +G     AI   +
Sbjct: 262 TLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINTGK 321

Query: 260 FQYPSYPMYSDRLKNLIRVMLSKNPSDRP 288
           + +P    +S+RL ++I+  +  +P  RP
Sbjct: 322 YSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 23/233 (9%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E+  M LLK+  ++  YI +        N  Y ++++ME+C  G   D + +  +  L E
Sbjct: 62  EMRLMSLLKS-PYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAE 113

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
            ++  ++     G+  +H      +HRDIK  N+L++ +   KV DFG V   +R     
Sbjct: 114 NKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKA 170

Query: 192 QEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGG 251
           + F           T  + +PE++ +++G+  NEKSDIW+LG+  Y+L     P  K   
Sbjct: 171 KTFV---------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDA 220

Query: 252 EAAILQARFQYPS--YPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQG 302
              +     + P   +  Y++ +K+ I   L K+P  RP+  ++LE    ++G
Sbjct: 221 IRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG 273

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 125/269 (46%), Gaps = 34/269 (12%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G Y  VYK     +D      +  +K V+  +   LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKY-- 85

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
                      +YE+++L+E+C  G L   + SR    L+E E  T ++ T  G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLH- 138

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
               ++HRDIK  N+L+S +N  K+ DFG V  IV               +    T  + 
Sbjct: 139 -GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYP--MY 268
           +PE+L  ++G   +  SDIW+LG  + ++     P+  N  +A I  A      YP   +
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSF 241

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           S+ LK+ +     KN   RP   Q+L+ V
Sbjct: 242 SEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 132/287 (45%), Gaps = 37/287 (12%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH-- 84
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   ++ K+ RH  
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 137

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     
Sbjct: 138 IVQFIDCFEDDTNVY-------ILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGA 188

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  MH  +  ++HRD+K+ N+   ++   K+ DFG    +     N +E  +        
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----C 237

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQ--- 261
            T  Y +PE+L   K    + + DIW+ GV +Y L     PF+    E  I+  R +   
Sbjct: 238 GTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ--AKEVNIIYERIKCGD 294

Query: 262 --YPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306
             +P     S     LIR +LS +P +RP++ ++++ V   +GI  P
Sbjct: 295 YVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVW-FRGIFPP 340

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 128/275 (46%), Gaps = 28/275 (10%)

Query: 26  KYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHV 85
           ++L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +K+ +++
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKH-QNI 201

Query: 86  VSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGI 145
           V ++D        +     V++L+  C  G L++ +  R    LTE E+          I
Sbjct: 202 VQFVDC-------FEDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
             MH  +  ++HRD+K+ N+   +N   K+ DFG    +     N +E  +         
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA----NDRERKYTVCG----- 301

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK---NGGEAAILQARFQY 262
           T  Y +PE+L L K    + + DIW++GV ++ L     PF+    N   + I  + + +
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 263 PSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           P     S   K LI+ +L  +P  RP++ +++E V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 126/278 (45%), Gaps = 34/278 (12%)

Query: 23  KVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKP--SLNTLRAEVDAMKLLK 80
           K  + +  G +  VYK        YI +N  C  +V+  D     +  ++ EV  +  LK
Sbjct: 20  KRTEVIGRGKFGIVYKGY------YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLK 73

Query: 81  NNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSH 140
              ++  Y  S+ + +       E++V+ME+C  G L   +      ++ E  I  IM  
Sbjct: 74  QVPNITHYYGSYLNNT-------ELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRE 123

Query: 141 TSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
               IA MH  +  ++HRDIK  NVLI+ +   K+CDFG    + +    +Q        
Sbjct: 124 LL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM------ 175

Query: 201 IMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQAR 259
                T  + +PE+  + +G+  + K DIW+LG+  Y++     P+ +     A  L  +
Sbjct: 176 ---AGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITK 230

Query: 260 FQYPSYP--MYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
            + P      +S  LK  I + L ++P +RP+  ++L+
Sbjct: 231 SKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 131/299 (43%), Gaps = 59/299 (19%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNT 68
           F S ++  VG++  K++K +  G + +VY     P+   +     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNI 79

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNSRL 125
           +R      ++  + +    YI      + +Y       +V++ +E+C    L D + S  
Sbjct: 80  VR------EVFYHRQFDFPYI------TKLYEVIVTESKVWMALEYCPGKELYDHLLS-- 125

Query: 126 QHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIV 185
            HR++  E   + +  S  +   H +    +HRD+K+EN+L+ +N   K+ DFG      
Sbjct: 126 LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG------ 177

Query: 186 RPPKNQQEFNFVYHDIMKNT------TAQYRSPEMLDLS--KGLPINEKSDIWALGVFLY 237
                     F    + K T      T  Y +PE++      G  I    D W+LGV LY
Sbjct: 178 ----------FTRECMTKTTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILY 223

Query: 238 KLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            L   + PF+ +       +   + P Y   +  D  K+LI  +L+KNP +RP++ QVL
Sbjct: 224 TLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 128/276 (46%), Gaps = 32/276 (11%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +K+  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHP-NIV 137

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            +ID     + +Y       +L+E C  G L+D +  R    LTE E+    +     I 
Sbjct: 138 QFIDCFEDDTNVY-------ILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+    N   K+ DFG    +     N +E  +         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 237

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQ----- 261
             Y +PE+L   K    + + DIW++GV +Y L     PF+    E  I+  R +     
Sbjct: 238 PNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ--AKEVNIIYERIKSGDYI 294

Query: 262 YPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           +P     S  +  LI+ +LS +P +RP++ ++++ V
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 127/276 (46%), Gaps = 32/276 (11%)

Query: 27  YLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           +L  GG+A+ ++++      +    +A   ++ +  + +   L +E+   K +++  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
            ++D     + +Y       +L+E C  G L+D +  R    LTE E+    +     + 
Sbjct: 140 QFVDCFEDDTNVY-------ILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            MH  +  ++HRD+K+ N+   ++   KV DFG    +     N +E  +         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQAR-----FQ 261
             Y +PE+L   K    + + DIW+ GV +Y L     PF+    E  I+  R     F 
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ--AKEVNIIYERIKCGDFV 296

Query: 262 YPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           +P     S     LI+ +LS +P +RP++ ++++ V
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 86/180 (47%), Gaps = 21/180 (11%)

Query: 116  GLIDFMN-SRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
            G ID  +   L+  +TE E   I       I  +H     ++HRDIK ENV++      K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLH--SQGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE+L    G P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            V LY + +   PF  N  E  IL+   ++      S+   NLI+++L+KNPS RP + +V
Sbjct: 1198 VLLYTIVFKENPF-YNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 140/331 (42%), Gaps = 60/331 (18%)

Query: 15  LTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIA-----CLKRVIVPDKPSLNTL 69
           + V     K+ + L  GG + VY V++  +   + + I       LK++I P   S++  
Sbjct: 23  IRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNG 82

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR- 128
             E++  K  ++  +V+  IDS  ++    NG+  +++++ +   G L D +N RL    
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVTQEK--NGSKIIYIILPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LTEAEILTIMSHTSQGIAAMH-------RLQP--------------------------- 153
            ++EAE + IM   ++G+  +H        + P                           
Sbjct: 140 FISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 154 ----------ALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMK 203
                     A  HRDI   N+L S      + D GS         ++ + + +   +  
Sbjct: 200 VLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWVND 259

Query: 204 NTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGGEA--AILQ 257
           N T  Y +PE+L+L     ++ K DIW++G   Y L +  +PFE+    +G     AI  
Sbjct: 260 NCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAINT 319

Query: 258 ARFQYPSYPMYSDRLKNLIRVMLSKNPSDRP 288
            ++ +P    +S+ L N+I+  +  +P  RP
Sbjct: 320 GKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 111/225 (49%), Gaps = 30/225 (13%)

Query: 98  IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
           ++    E+++++E+ + G L D++ S+   +L+E E +   +   QG++  H     + H
Sbjct: 194 VWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICH 249

Query: 158 RDIKIENVLISQNNEY-KVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA--QYRSPEM 214
           RD+K EN+L+ + N+  K+ DFG +  +  P K           +++ +     Y SPE+
Sbjct: 250 RDLKPENLLLDKKNKVIKIADFG-MAALELPNK-----------LLETSCGSPHYASPEI 297

Query: 215 LDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFEKNGGEAAILQ---ARFQYPSYPMYSD 270
           +    G P +   SD+W+ G+ L+ L     PF  +  +  +L+    RFQ P  P  ++
Sbjct: 298 V---MGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTN 352

Query: 271 RLKNLIRVMLSKNPSDRPNVCQVLEE--VSRLQGIPCPIRNFYLL 313
             K+LI  +L  NP  R  + ++L    + + +  P  IR   LL
Sbjct: 353 DAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLL 397

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 125/288 (43%), Gaps = 51/288 (17%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKLL 79
            ++K +  G Y +V  +     + YI       K  I+ D       L T+ +E+  M  L
Sbjct: 1004 ILKKMGEGAYGKV-DLCYHKKEKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMSTL 1062

Query: 80   K--NNRHVVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
               +N++++S +D        Y         G  ++F L+EF              +  +
Sbjct: 1063 NKTSNKNILSILDFFEDDDYYYVEQPVHGKTGCIDLFDLIEF--------------KTNM 1108

Query: 130  TEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPK 189
            TE E   I      GI+ +H  +  ++HRDIK ENV++      K+ DFGS   +   P 
Sbjct: 1109 TEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAAYVKNGP- 1165

Query: 190  NQQEFNFVYHDIMKNTTAQYRSPEMLDLSK--GLPINEKSDIWALGVFLYKLCYYTTPFE 247
                      D+   T   Y SPE+L   K  G P     DIWALG+ LY + +   PF 
Sbjct: 1166 ---------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIVFKENPF- 1210

Query: 248  KNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
             N  E  IL+   ++P     S    +LI+++L+++  +RP++  + E
Sbjct: 1211 YNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 125/286 (43%), Gaps = 49/286 (17%)

Query: 23   KVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKL 78
            +V++ +  G Y +V  + +   D YI       K  I+ D       L T+ +E+  M  
Sbjct: 954  EVLQKMGEGAYGKV-DLCMHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMAT 1012

Query: 79   LKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
            L    H  ++  +D        Y        +G+ ++F L+E              ++  
Sbjct: 1013 LNAKPHENILMLLDFFEDDDYYYIETAVHGTSGSIDLFDLIE--------------MKTD 1058

Query: 129  LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
            +TE E + I    + GI  +H     ++HRDIK ENV++  N   K+ DFGS   +   P
Sbjct: 1059 MTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGP 1116

Query: 189  KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFE 247
             +     FV        T  Y +PE+L    G P   K  DIWA+GV LY + Y   PF 
Sbjct: 1117 FDV----FV-------GTIDYAAPEVL---GGEPYEGKPQDIWAIGVLLYTIIYKENPF- 1161

Query: 248  KNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
             N  E  IL A  +  S    SD    LIR +L+++ S RP++ ++
Sbjct: 1162 YNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 114/235 (48%), Gaps = 38/235 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K ++H  +V++IDS+     + +G  +++V+ME+ E G L D +   +   LT
Sbjct: 670 INEILVMKGSKHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S N   K+ DFG  C  V     
Sbjct: 720 EGQIGAVCRETLSGLQFLH--SKGVLHRDIKSDNILLSINGNIKLTDFG-FCAQVN---- 772

Query: 191 QQEFNFVYHDIMKNTTA----QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
                      +K TT      + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 773 --------ETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 -EKNGGEAAILQARFQYPSY---PMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
             +    A  L A    P        SD LK+ +   LS NP  R +  ++LE+V
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 114/233 (48%), Gaps = 36/233 (15%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K+++H  +V++IDS   K        +++V+MEF E G L D +   +   LT
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKG-------DLWVIMEFMEGGSLTDVVTHCI---LT 643

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I T+   T +G+  +H     ++HRDIK +N+L+S   + K+ DFG  C  +     
Sbjct: 644 EGQIGTVCRETLRGLQFLH--SNGVIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN---- 696

Query: 191 QQEFNFVYHDIMKNT---TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF- 246
                   H++ + T   T  + +PE++   +  P   K DIW+LG+ + ++     P+ 
Sbjct: 697 -------EHNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYL 746

Query: 247 EKNGGEAAILQARFQYPSY---PMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
            +    A  L A    P      + SD L + +   L  NP +R +   +LE+
Sbjct: 747 NETPLRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 34/202 (16%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIE 163
           +V++ +E+C    L D + S   HR+   E + + +    G+   H L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT------TAQYRSPEMLDL 217
           N+L+ ++ + K+ DFG                F    + K T      T  Y +PE+++ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 218 SK--GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLK 273
               G  I    DIW+LGV LY +   + PF+++       +   Q P     + +   K
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAK 258

Query: 274 NLIRVMLSKNPSDRPNVCQVLE 295
           +LI  +L+KNP+DRP V Q+L+
Sbjct: 259 DLILRLLAKNPNDRPTVEQILK 280

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 97/194 (50%), Gaps = 17/194 (8%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D +       + E+++  I+  T +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLD-LSKGLPI 223
           +L++   + K+ DFG V G +R    +  F           T  + +PE+++   KG   
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVINKQCKGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS--YPMYSDRLKNLIRVMLS 281
           NEK+DIW+LG+  Y+L     P  K      +L    + P   +  YS++ K  + + L 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 282 KNPSDRPNVCQVLE 295
           K+P  RP++  +LE
Sbjct: 252 KDPKQRPSIEALLE 265

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 123/267 (46%), Gaps = 34/267 (12%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G Y  VYK     +D      +  +K ++      LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-- 85

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
                      +YE+++L+E+C  G L   + SR    L+E E  + ++ T  G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLH- 138

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
               ++HRDIK  N+L+S +N  K+ DFG V  IV               +    T  + 
Sbjct: 139 -GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LTLAGTLNWM 185

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYP--MY 268
           +PE+L  ++G   +  SDIW+LG  + ++     P+  N  +A I  A      YP   +
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSF 241

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           S+ LK+ +     KN   RP   Q+L+
Sbjct: 242 SESLKDFLSKCFVKNMYKRPTADQLLK 268

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 128/271 (47%), Gaps = 37/271 (13%)

Query: 30  SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
           SGG    Y+V         N+++A +K++ +  +P    +  E+  MK  K+  ++V++I
Sbjct: 678 SGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKASKH-ANIVNFI 728

Query: 90  DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
           DS+  +        +++V+ME+ E G L D +   +   LTE +I  +   T +G+  +H
Sbjct: 729 DSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 778

Query: 150 RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQY 209
                ++HRDIK +NVL+S + E K+ DFG    I        E N     ++   T  +
Sbjct: 779 --SKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI-------NEINLKRTTMV--GTPYW 827

Query: 210 RSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSYP-- 266
            +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P     
Sbjct: 828 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDA 884

Query: 267 -MYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
              SD LK+ +   L  NP +R    Q+L +
Sbjct: 885 DSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 128/269 (47%), Gaps = 37/269 (13%)

Query: 30  SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
           SGG    Y++         N+++A +K++ +  +P    +  E+  MK  K++ ++V++I
Sbjct: 340 SGGVYTAYELGT-------NASVA-IKQMNLEKQPKKELIINEILVMKGSKHS-NIVNFI 390

Query: 90  DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
           DS+  K        +++V+ME+ E G L D +   +   LTE +I  +   T +G+  +H
Sbjct: 391 DSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFLH 440

Query: 150 RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQY 209
                ++HRDIK +N+L+S N + K+ DFG    I        E N     ++   T  +
Sbjct: 441 --SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI-------NEVNLKRTTMVG--TPYW 489

Query: 210 RSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSY--- 265
            +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P     
Sbjct: 490 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDP 546

Query: 266 PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
              SD LK  +   L  +P DR N  ++L
Sbjct: 547 ENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 131/277 (47%), Gaps = 31/277 (11%)

Query: 23  KVIKYLTSGGYAQVYKVEISPSDPYINSN-IACLKRVIVPDKPS-LNTLRAEVDAMKLLK 80
           ++++ +  G +  VYK        Y+ +N I  +K V + D    ++ L  E+  +  L+
Sbjct: 21  EILQCIGRGNFGDVYKAR------YLATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELR 74

Query: 81  NNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSH 140
           +      YI ++ +   +      ++++ME+C  G   + +    +H+LTE +   I+S 
Sbjct: 75  S-----PYITNYKTAFLV---DVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 TSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
              G+  +H  +   +HRDIK  N+L++ N   K+ DFG V G +   + +  F      
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF------ 177

Query: 201 IMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARF 260
                T  + +PE++D +K    NE +DIW+LG+ + +L     P +K     A++    
Sbjct: 178 ---VGTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 261 QYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           + P      +S   K+ +   L K+PS RP   ++L+
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 109/228 (47%), Gaps = 23/228 (10%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E +A++ L N+R +V    +   +S++Y        L+E+   G  +  M  +    L+E
Sbjct: 230 EKNALQRLNNSRGIVKLFFTFQDESSLY-------FLLEYAPNGDFLSVM--KKYGSLSE 280

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
                  +    GI  +H     ++HRDIK EN+L+ ++ + K+ DFG+    +  PKN+
Sbjct: 281 DCTRYYSAQIIDGIKYLH--SKGIIHRDIKPENILLDKDMKVKITDFGTAK--ILEPKNE 336

Query: 192 Q----EFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFE 247
                EFN +        TA+Y SPE+L+ S    ++ + DIWA G  ++++     PF 
Sbjct: 337 DEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY---VDARCDIWAFGCMVFQMIAGKPPF- 392

Query: 248 KNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
           K   E    Q   + QY     +   +++L++ +L K P  R  + Q+
Sbjct: 393 KATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQI 440

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 127/280 (45%), Gaps = 35/280 (12%)

Query: 19  SHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKL 78
           S +  +IK +  G    VY       + Y+      +K++ +  +P    +  E+  MK 
Sbjct: 648 SKYTDLIK-IGQGASGGVYTAHDPTREGYV-----AIKQMNLEKQPKKELIINEIIVMKE 701

Query: 79  LKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIM 138
            K+  ++V++IDS+  K        +++V+ME+ E G L D +   L   LTEA++  + 
Sbjct: 702 SKH-ENIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAVC 750

Query: 139 SHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVY 198
             T  G+  +H     ++HRDIK +N+L+S   + K+ DFG    I        E N   
Sbjct: 751 RETLSGLQFLH--SKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQI-------NELNLKR 801

Query: 199 HDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQ 257
             ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L 
Sbjct: 802 TTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 856

Query: 258 ARFQYPSY---PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           A    PS       SD L N +   L  NP +R +   +L
Sbjct: 857 ATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 140/324 (43%), Gaps = 66/324 (20%)

Query: 17  VGSHHAKVIKYLTSGGYAQVYKVE-ISPSDPYINSNIA---------CLKRVIVP----- 61
           VGS    V K +  G +A V++   I+P+ P+++ ++          C    IVP     
Sbjct: 33  VGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLK 92

Query: 62  DKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFM 121
           +K  L  L  E+  +K + ++ H+V  ID   +    Y       ++ME+C  G L   +
Sbjct: 93  NKKLLENLEIEIAILKKI-SHPHIVKLIDFERTSKDFY-------LIMEYCSLGDLTFLI 144

Query: 122 NSRLQ----HRLTEAEI---------------LTIMSHTSQGIAAMHRLQPA-LLHRDIK 161
             R Q    H L E                    I+++  Q  +A+  L+   L+HRDIK
Sbjct: 145 KKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIK 204

Query: 162 IENVLISQ-----NNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ-------- 208
            +N+L+S      N+     D G V     P     +F F     + NT+          
Sbjct: 205 PQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFA--RFLPNTSMAETLCGSPL 262

Query: 209 YRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQAR-----FQYP 263
           Y +PE+L+  K    N K+D+W++G  LY++CY   PF+ +       + +       +P
Sbjct: 263 YMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFP 319

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDR 287
           +Y    + LK+LI  +L+ +P +R
Sbjct: 320 TYIEIDNNLKSLISKLLTFDPQER 343

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 113/232 (48%), Gaps = 38/232 (16%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K +RH  +V++IDS+  K        +++V+ME+ E G L D +   +   LT
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I T+   T  G+A +H     ++HRDIK +N+L+S N + K+ DFG  C        
Sbjct: 771 EGQIGTVCKETLGGLAFLH--SKGVIHRDIKSDNILLSMNGDIKLTDFG-FCA------- 820

Query: 191 QQEFNFVYHDIMKNTTA----QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             + N V+   +K TT      + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 821 --QINEVH---LKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

Query: 247 -EKNGGEAAILQARFQYPSY---PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
             +    A  L A    P         + LK  +   L+ NP +R    ++L
Sbjct: 873 LNETPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 92/192 (47%), Gaps = 23/192 (11%)

Query: 106  FVLMEFCERGGLIDFMN-SRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
            ++ +E     G ID  +   L+  +TE E   I      GI  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 165  VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLS--KGLP 222
            V++  N   K+ DFGS       P       FV        T  Y +PE+L  +  KG P
Sbjct: 935  VIVDSNGFVKLIDFGSAAYTKTGPFEV----FV-------GTIDYAAPEILGGNPYKGKP 983

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSK 282
                 DIWALGV LY L Y   PF  N  E  IL+ + ++      +    +LIR +L+K
Sbjct: 984  ----QDIWALGVLLYTLIYKENPF-YNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTK 1036

Query: 283  NPSDRPNVCQVL 294
            + +DRP++ +++
Sbjct: 1037 SVNDRPSIDEIV 1048

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 94/194 (48%), Gaps = 19/194 (9%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++MEFC  G   D +    +HRL+E ++  I+     G+  +H  +   +HRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L++ + E K+ DFG    I+   K      FV        T  + +PE++   K    N
Sbjct: 168 ILLTDDGEVKLGDFGVSGQIMATLKRT---TFV-------GTPYWMAPEII-AKKDNGYN 216

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRL----KNLIRVML 280
           EK+DIW+LG+   +L     P+ K+     ++    + P  P    R     ++ I + L
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKP--PKLQGRFTGSARDFIALCL 274

Query: 281 SKNPSDRPNVCQVL 294
            K+P  RP+  ++L
Sbjct: 275 IKDPDLRPSAAELL 288

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 121/286 (42%), Gaps = 49/286 (17%)

Query: 23   KVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKL 78
            +V++ +  G Y +V  + +   D YI       K  I+ D       L T+ +E+  M  
Sbjct: 964  EVLQKMGEGAYGKV-DLCLHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMAT 1022

Query: 79   LKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
            L    H  ++  +D        Y        +G+ ++F L+E              L+  
Sbjct: 1023 LNTKPHENILMLLDFFEDDEYYYIETPIHGTSGSVDLFDLIE--------------LKTD 1068

Query: 129  LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
            +TE E   I      GI  +H     ++HRDIK ENV++  N   K+ DFGS   +   P
Sbjct: 1069 MTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVKIIDFGSAAYVKSGP 1126

Query: 189  KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFE 247
                       D+   T   Y +PE+L    G P   K  DIWA+GV LY + +   PF 
Sbjct: 1127 ----------FDVFVGTI-DYAAPEVL---GGEPYEGKPQDIWAIGVLLYTIIFKENPF- 1171

Query: 248  KNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
             N  E  IL A  +  S    SD    LIR +L++  S RP++ ++
Sbjct: 1172 YNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 96/209 (45%), Gaps = 50/209 (23%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIE 163
           +V++ +E+C    L D + S+   RL   E   + +  +  +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISQNNEYKVCDFG------------SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRS 211
           NVL+ +N   K+ DFG            +VCG                      T  Y +
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 212 PEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSD 270
           PEM+   +  P +  K DIW+LGV LY L     PF+++     +L  +      P+  +
Sbjct: 201 PEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD---LLTKQKIINDTPVIDE 254

Query: 271 RL-----KNLIRVMLSKNPSDRPNVCQVL 294
           R+     +NLI  +LSK+P++RPN   +L
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 125/288 (43%), Gaps = 52/288 (18%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLL--KNNRHVVSY 88
           G ++ VYKV  S    +    + C      P+K +   +  E++  K++   ++ H+V+ 
Sbjct: 51  GSHSVVYKVFDSEDRIFAGKKVHC------PNKENKRKIIKELEIYKVICRSHHNHIVAL 104

Query: 89  IDSH--ASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR--LTEAEILTIMSHTSQG 144
            D+     +S IY       +++++C    L     S LQ+R  L E E   +M     G
Sbjct: 105 RDAFQWGKESCIY-------MILDYCSNNSL----QSILQYRGSLNEVECKELMIQLCGG 153

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           I  +H     ++H D+K+ N+L  +  + K+CDFGS       P+   E       IM  
Sbjct: 154 IYWLH--LNNVIHGDLKLSNILFDEGQQLKICDFGSSFIATSSPRGPGE-------IMG- 203

Query: 205 TTAQYRSPEMLDLSKG--------LPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA--- 253
            T  Y +PE +   K         L I+   DIW++G+ LY L Y   PF K+  E    
Sbjct: 204 -TPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMGIVLYSLLYGINPFIKSVDELHNV 262

Query: 254 -------AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
                   I     ++P+        + LI  MLS+NP +R  + +++
Sbjct: 263 SLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQNPLERITLVEIV 310

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++MEFC  G   D +    +HRL E ++  I+     G+  +H  +   +HRD+K  N
Sbjct: 107 MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAAN 164

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L++   E K+ DFG    I+   K      FV        T  + +PE++    G   +
Sbjct: 165 ILLTDEGEVKLGDFGVSGQIMATLKRN---TFV-------GTPYWMAPEIIARDNGY--D 212

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRL----KNLIRVML 280
           EK+DIW+LG+   +L     P+ K      ++    + P  P    R     ++ I + L
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKP--PRLQGRFTSSARDFIALCL 270

Query: 281 SKNPSDRPNVCQVL 294
           +K+P+ RP    +L
Sbjct: 271 TKDPALRPTASDLL 284

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 131/289 (45%), Gaps = 46/289 (15%)

Query: 25  IKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH 84
           I    SGG    Y++         N+++A +K++ +  +P    +  E+  MK  K+ R+
Sbjct: 661 IGQGASGGVYTAYEL-------GTNASVA-IKQMNLEKQPKKELIINEIMVMKGSKH-RN 711

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V++IDS+  K        +++V+ME+ E G L D +   +   LTE +I  +   T  G
Sbjct: 712 IVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAG 761

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  +H     ++HRDIK +N+L+S   E K+ DFG  C  +       E N     ++  
Sbjct: 762 LQFLH--SKGVIHRDIKSDNILLSMTGEIKLTDFG-FCAQIN------EINLKRTTMVG- 811

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYP 263
            T  + +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P
Sbjct: 812 -TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTP 867

Query: 264 SYPM---YSDRLKNLIRVMLSKNPSDR---------PNVCQVLEEVSRL 300
                    + L+N +   L+  P  R         P V QV EE S L
Sbjct: 868 KLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSL 916

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 126/281 (44%), Gaps = 39/281 (13%)

Query: 25  IKYLTSGGYAQVYKVEISPSDPYINSNI-ACLKRVIVPDKPSLNTLRAEVDAMKLLKNNR 83
           ++ L  G Y+ V++  +  ++   N  I  C K+ I+ ++  +  +  E D + LL    
Sbjct: 13  LEKLGQGSYSTVFRA-VERANGLRNYAIKVCSKKHIIRER-KVKYVTVEKDLLNLLAGGG 70

Query: 84  H--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHT 141
           H  VV            ++    ++ ++EF   G L+  +  R   RL E     I S  
Sbjct: 71  HPGVVRLF-------CTFHDTDNLYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQL 121

Query: 142 SQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVC----GIVRPPKNQQEFNFV 197
              +  MH     ++HRD+K ENVL+SQ     + DFG+ C    G   P    +  +FV
Sbjct: 122 VDTVDYMH--AKGVIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV 179

Query: 198 YHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF----EKNGGEA 253
                   TA+Y SPE+L  S+    +  SD+WALG  +Y+L     PF    E    E 
Sbjct: 180 -------GTAEYVSPELLLHSQ---CSFGSDVWALGCIIYQLTQGAPPFRGDTELQSFEK 229

Query: 254 AI-LQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            + L  R+ Y + P+    +  L++ +L  +P  RP+  Q+
Sbjct: 230 IVALDYRWVYAAPPL----IVALVQSILVLDPLQRPSAKQL 266

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 134/291 (46%), Gaps = 41/291 (14%)

Query: 12   GQILTVGSHHAKVIKY-LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
            G+++  GS  A  +   +T+G    V +VE+     Y + N A L  V          LR
Sbjct: 1181 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILGTV--------EALR 1229

Query: 71   AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            +EV  +K L ++ ++V Y+    +K+ IY+      + +E+   G +   +  R+  R  
Sbjct: 1230 SEVSTLKDL-DHLNIVQYL-GFENKNNIYS------LFLEYVAGGSVGSLI--RMYGRFD 1279

Query: 131  EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            E+ I  + +   +G+A +H     +LHRD+K +N+L+ Q+   K+ DF    GI R  K+
Sbjct: 1280 ESLIRHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1333

Query: 191  QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
                 +   D+    T  + +PEM+D  +G   + K DIW+LG  + ++     P+    
Sbjct: 1334 I----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLE 1387

Query: 251  GEAAILQARFQYPSYPMYSDRL-------KNLIRVMLSKNPSDRPNVCQVL 294
              AA+ +      + P+  D L       ++ +      NP +RP   ++L
Sbjct: 1388 VVAAMFKIGKSKSAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 135/306 (44%), Gaps = 41/306 (13%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVI--KYLTSGGYAQVYKVEISPSDPYINSNIACLKRV 58
           + + +I  +  G IL  GS   KV+  ++ T+G  A V  V  S       +N + +   
Sbjct: 18  LKNDKIGPWKLGSILGAGSA-GKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGS 76

Query: 59  IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLI 118
             PD       R E+  MKLL N+ +V+   D   +KS +Y       +++E+ E+G L 
Sbjct: 77  NDPDLLPYGIER-EIIIMKLL-NHTNVLRLYDVWETKSNLY-------MVLEYVEKGELF 127

Query: 119 DFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDF 178
           + +  R    L E E +        GI+  H L   ++HRD+K EN+L+      K+ DF
Sbjct: 128 NLLVER--GPLPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADF 183

Query: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGV 234
           G                    D +  T+     Y +PE++    GLP +  +SD+W+ GV
Sbjct: 184 GMAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGV 227

Query: 235 FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPM-----YSDRLKNLIRVMLSKNPSDRPN 289
            LY L     PF+++ G    L  + Q   Y M      S   ++LI  +L+ +P  R  
Sbjct: 228 ILYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIK 287

Query: 290 VCQVLE 295
             ++L+
Sbjct: 288 TREILK 293

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 130/275 (47%), Gaps = 27/275 (9%)

Query: 23  KVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNN 82
           ++++ +  G +  VYK     S+  +   +  L+     D+P ++ L  E+  +  L++ 
Sbjct: 21  EILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELRS- 75

Query: 83  RHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTS 142
                YI ++ +   +      ++++ME+C  G   + +    +H++TE +   I+S   
Sbjct: 76  ----PYITNYKTAFLV---DVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIM 202
            G+  +H  +   +HRDIK  N+L++ N   K+ DFG V G +   + +  F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF-------- 177

Query: 203 KNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQY 262
              T  + +PE++D +K    NE +DIW+LG+ + +L     P +K     A++    + 
Sbjct: 178 -VGTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 263 PSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           P      +S   ++ +   L K+PS RP   ++L+
Sbjct: 236 PPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 116  GLIDFMN-SRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYK 174
            G ID  +   L++ +TE E+  I      GI  +H    A++HRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE+L    G P   K  DIWA+G
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVL---SGDPYEGKPQDIWAIG 1375

Query: 234  VFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            + LY + +   PF  N  E  IL+    +      S   K LI ++L++N   RP +  +
Sbjct: 1376 ILLYTIVFKENPF-YNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 111/217 (51%), Gaps = 33/217 (15%)

Query: 30  SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
           SGG    Y++         N+++A +K++ +  +P    +  E+  MK  K+N ++V++I
Sbjct: 709 SGGVYTAYEL-------GTNASVA-IKQMNLEKQPKKELIVNEILVMKGSKHN-NIVNFI 759

Query: 90  DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
           DS+     ++ G  +++V+ME+ E G L D +   +   LTE +I  +   T +G+  +H
Sbjct: 760 DSY-----LFRG--DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 809

Query: 150 RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQY 209
                ++HRDIK +N+L+S N + K+ DFG    I        E N     ++   T  +
Sbjct: 810 --SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI-------NEVNLKRTTMVG--TPYW 858

Query: 210 RSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
            +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 859 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 132/291 (45%), Gaps = 41/291 (14%)

Query: 12   GQILTVGSHHAKVIKY-LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
            G+++  GS  A  +   +T+G    V +VE+     Y + N A L  V          LR
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALR 1226

Query: 71   AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            +EV  +K L ++ ++V Y+    +K+ IY+      + +E+   G +   +  R+  R  
Sbjct: 1227 SEVSTLKDL-DHLNIVQYL-GFENKNNIYS------LFLEYVAGGSVGSLI--RMYGRFD 1276

Query: 131  EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            E  I  + +   +G+A +H     +LHRD+K +N+L+ Q+   K+ DF    GI R  K+
Sbjct: 1277 EPLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1330

Query: 191  QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
                 +   D+    T  + +PEM+D  +G   + K DIW+LG  + ++     P+    
Sbjct: 1331 I----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLE 1384

Query: 251  GEAAILQARFQYPSYPMYSDRL-------KNLIRVMLSKNPSDRPNVCQVL 294
              AA+ +      + P+  D L       +N +      NP  RP   ++L
Sbjct: 1385 VVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 134/291 (46%), Gaps = 41/291 (14%)

Query: 12   GQILTVGSHHAKVIKY-LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
            G+++  GS  A  +   +T+G    V +VE+     Y + N A L  V          LR
Sbjct: 1184 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALR 1232

Query: 71   AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            +EV  +K L ++ ++V Y+    +K++IY+      + +E+   G +   +  R+  R  
Sbjct: 1233 SEVSTLKDL-DHLNIVQYL-GFENKNSIYS------LFLEYVAGGSVGSLI--RMYGRFD 1282

Query: 131  EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            E+ I  + +   +G+A +H     +LHRD+K +N+L+ Q+   K+ DF    GI R  K+
Sbjct: 1283 ESLIKHLTTQVLRGLAYLH--SKGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1336

Query: 191  QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
                 +   D+    T  + +PEM+D  +G   + K DIW+LG  + ++     P+    
Sbjct: 1337 I----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLE 1390

Query: 251  GEAAILQARFQYPSYPMYSDRLKNLIRV-------MLSKNPSDRPNVCQVL 294
              AA+ +      + P+  D L  + RV           +P  RP   ++L
Sbjct: 1391 VVAAMFKIGKSKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 132/295 (44%), Gaps = 51/295 (17%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVP--DKPSL 66
           F S ++  VG++  K++K +  G + +VY     P+           ++V++   DK   
Sbjct: 26  FTSDELSEVGNY--KILKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKSDP 73

Query: 67  NTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNS 123
           N +R      ++  + +    YI      + +Y       +V++ +E+C    L + +  
Sbjct: 74  NLVR------EVFYHRQFDFPYI------TKLYEVIVTETKVWMALEYCPGRELYEHL-- 119

Query: 124 RLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCG 183
            + HR+   E   + +     +   H L    +HRD+K+EN+L+ +N   K+ DF    G
Sbjct: 120 LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDF----G 173

Query: 184 IVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSK--GLPINEKSDIWALGVFLYKLCY 241
             R   ++     +        T  Y +PE++      G  I    DIW+LGV LY +  
Sbjct: 174 FTRECVSKSSLETIC------GTTVYMAPELIQRQAYDGFKI----DIWSLGVILYTMIN 223

Query: 242 YTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            T PF+++       +    +P++     S   K+LI+ +L+K PS+RP + Q+L
Sbjct: 224 GTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 112/236 (47%), Gaps = 38/236 (16%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E++A+KLL  + ++V        +  + N  Y + +++EF   G    ++  +   RL E
Sbjct: 103 EINALKLL-THPNIVRL------EEVLQNSKY-IGIVLEFASGGEFYKYLQRK--RRLKE 152

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
                + +    G+  MH     L+HRD+K+EN+L+ +N    + DFG V          
Sbjct: 153 PHACQLFAQLISGVTYMH--SKGLVHRDLKLENLLLDKNENLIITDFGFV---------- 200

Query: 192 QEFNFVYHDIMKNTTAQ--YRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK- 248
            EF F  +++MK +     Y +PE++ LS       K DIW+ G+ LY +     P++  
Sbjct: 201 NEF-FGSNELMKRSCGSPCYAAPELV-LSTEPYRARKVDIWSCGIILYAMLAGYLPWDDD 258

Query: 249 ----NGGEAA-----ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
               NG +       I +   ++P+Y   S   ++LIR +L+ NPS R ++  + +
Sbjct: 259 SQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISISYICK 312

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (46%), Gaps = 24/180 (13%)

Query: 117 LIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVC 176
           L DF+  +   ++ E E   I      GI  +H L   ++HRDIK EN++I      +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVF 235
           DFGS       P        V+H      T  Y SPE+L   KG P   K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ------VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKNGGEAAILQARFQY-PSYPM-YSDRLKNLIRVMLSKNPSDRPNVCQV 293
           LY + +  TPF      A I++   +  P++    SD+ + LI  ML K    RP + ++
Sbjct: 868 LYIITFKQTPF---NSVAEIIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 133/286 (46%), Gaps = 25/286 (8%)

Query: 13  QILTVGSHHAKVIKYLTSGGYAQVY-KVEISPSDPYINSNIACLKRVIVPDKPSLNTLRA 71
           Q++  G +  K  + L  G Y+ V     I  +  Y    +  L +  +  +  +  +  
Sbjct: 146 QVIKKGINDFKFGETLGDGSYSTVLLATSIESNKKYA---VKILNKEYLIKQKKVKYVNI 202

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E + ++ LKN + ++S   +   +S++Y        L+E+   G L+  M  R    + E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESSLY-------FLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
                  +     +  MH     ++HRD+K EN+L+  + + K+ DFG+   +    ++ 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDD 311

Query: 192 QEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGG 251
            +++ +        TA+Y SPE+L+ +    ++ + DIWA G  L+++     PF+ N  
Sbjct: 312 LKYDLLTRSNSFVGTAEYVSPELLNDNY---VDFRCDIWAFGCILFQMIAGKPPFKANNE 368

Query: 252 EAA---ILQARFQYPS-YPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
                 +++ +F + + +PM    +++L++ +L KNP  R  + Q+
Sbjct: 369 YLTFQKVMKVQFAFTAGFPM---TVRDLVKNILIKNPERRLLINQI 411

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 119/280 (42%), Gaps = 29/280 (10%)

Query: 28  LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH--- 84
           L  G Y+ VYK     +       +   K +I  +K    T+  E + + LL +  H   
Sbjct: 16  LGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTI--EKNTLNLLAHGNHPGI 73

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +  Y   H S++        ++ +++F   G L+  + +  Q R  EA     M      
Sbjct: 74  IKLYYTFHDSEN--------LYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDA 123

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  +H  +  ++HRD+K EN+L+S   +  + DFG    +          +FV       
Sbjct: 124 LEYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV------- 174

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ-ARFQYP 263
            TA+Y SPE+L  +K    N  SDIWA+G  LY+    T PF      AA  +     Y 
Sbjct: 175 GTAEYVSPELLLQNKS---NFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYH 231

Query: 264 SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGI 303
              M S  + +L+  +L  +P  R  + Q+ +  +  QGI
Sbjct: 232 WIYMVSQHITDLVSKILVLDPDSRYTLPQI-KNHAWFQGI 270

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 127/284 (44%), Gaps = 48/284 (16%)

Query: 21  HAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLK 80
           H  + + +  G Y  VYK     +D      +  +K +   ++  L+    E+D   LLK
Sbjct: 18  HYALKQVIGKGAYGVVYKAVNKATD-----QVIAIKAIEYQNEEELHEHMLEID---LLK 69

Query: 81  NNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIM 138
           N RH  +V Y             ++E+++L+E+C RG L D +    +  L+EA+    +
Sbjct: 70  NLRHENIVKY-------HGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKAKVYV 119

Query: 139 SHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVY 198
             T +G+  +H     ++HRDIK  N+L+++N   K+ DFG    +              
Sbjct: 120 KQTVRGLQYLH--DQGVIHRDIKAANLLLTENGIVKLADFGVSTRVTN------------ 165

Query: 199 HDIMKNTTA---QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA-- 253
              M  T A    + +PE++ L KG   +  SDIW+LG  + +L     PF     EA  
Sbjct: 166 ---MAMTYAGSPNWMAPEVM-LGKG--ASTVSDIWSLGATVVELLTGNPPFHNLVNEAAC 219

Query: 254 -AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
            AI+   +  P +   S + KN I     KN   RP   Q+L++
Sbjct: 220 YAIVNDVYYPPEH--LSTQCKNFIERCFQKNMFKRPQAHQLLQQ 261

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 131/300 (43%), Gaps = 61/300 (20%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNT 68
           F S ++  VG++  K++K +  G + +VY     P+   +     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNI 79

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNSRL 125
           +R      ++  + +    YI      + +Y       +V++ +E+C    L D + S  
Sbjct: 80  VR------EVFYHRQFDFPYI------TKLYEVIVTESKVWMALEYCPGKELYDHLLSLR 127

Query: 126 QHRLTE-AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
           +  L E  E+   +S       +MH      +HRD+K+EN+L+ +N   K+ DFG     
Sbjct: 128 RISLLECGELFAQISGAVYYAHSMH-----CVHRDLKLENILLDKNGNAKLTDFG----- 177

Query: 185 VRPPKNQQEFNFVYHDIMKNT------TAQYRSPEMLDLS--KGLPINEKSDIWALGVFL 236
                      F    + K T      T  Y +PE+++     G  I    DIW+LGV L
Sbjct: 178 -----------FTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVIL 222

Query: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           Y L     PF+ +       +   + P Y   +  D  ++LI  +L+KNP +RP++ QVL
Sbjct: 223 YTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 123/267 (46%), Gaps = 34/267 (12%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G Y  VYK     +D      +  +K ++  +   LN + AE+ ++    NN ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEI-SLLKNLNNNNIVKY-- 85

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
                      +YE+++L+E+C  G L   + SR    L+E E  T ++ T  G+  +H 
Sbjct: 86  -----HGFIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTLWGLKYLH- 138

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
               ++HRDIK  N+L+S +N  K+ DFG V  IV    N               T  + 
Sbjct: 139 -GEGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLA-------GTLNWM 185

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYP--MY 268
           +PE+L  ++G   +  SDIW+LG  + +L     P+  N  +A I  A      YP   +
Sbjct: 186 APEILG-NRG--ASTLSDIWSLGATVVELLTKNPPYH-NLTDANIYYAVENDTYYPPTAF 241

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           S+ LK+ +     KN   RP   Q+L+
Sbjct: 242 SESLKDFLSKCFVKNMYKRPTADQLLK 268

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 126/271 (46%), Gaps = 37/271 (13%)

Query: 30  SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
           SGG    Y+V         N+++A +K++ +  +P    +  E+  MK  K+  ++V++I
Sbjct: 677 SGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKASKH-ANIVNFI 727

Query: 90  DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
           DS+  +        +++V+ME+ E G L D +   +   LTE +I  +   T +G+  +H
Sbjct: 728 DSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 777

Query: 150 RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQY 209
                ++HRDIK +N+L+S   E K+ DFG    I        E N     ++   T  +
Sbjct: 778 --SKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQI-------NEINLKRTTMV--GTPYW 826

Query: 210 RSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSYP-- 266
            +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P     
Sbjct: 827 MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDA 883

Query: 267 -MYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
              SD LK  +   L  +P +R    ++L +
Sbjct: 884 DSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K +RH  +V++IDS+  K        +++V+ME+ E G L D +   +   LT
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 714

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S   + K+ DFG    I      
Sbjct: 715 EGQIGAVCRETLSGLKFLH--SKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI------ 766

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 767 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 816

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 104/242 (42%), Gaps = 33/242 (13%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG--AYEVFVLMEFCERGGLIDFMNSRLQ 126
           +R E++ MK   ++ +VV   D       I N   + +V++++E+C RG +     ++L+
Sbjct: 101 IREEIEIMKRC-HHENVVKLYD-------ILNDPESTKVYLVLEYCSRGPVKWCPENQLE 152

Query: 127 HRLTEAEILT------IMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180
            +     ILT      I+S    G+  +H     + HRDIK  N+LIS N   K+ DFG 
Sbjct: 153 IKAVGPSILTFEQARKIVSDVVSGLEYLH--SQGITHRDIKPSNLLISSNGAVKISDFGV 210

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240
                    N Q             T  + +PE+         +   DIW+LGV LY + 
Sbjct: 211 SILTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDIWSLGVTLYCML 270

Query: 241 YYTTPFEKNGGEAA---ILQARFQYPSYPMYSDR------------LKNLIRVMLSKNPS 285
           + T PF  N        I+     +PSY   S R             K+++  +L KNPS
Sbjct: 271 FGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKDILNRLLKKNPS 330

Query: 286 DR 287
           +R
Sbjct: 331 ER 332

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 107/230 (46%), Gaps = 30/230 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K ++H  +V++IDS+  K        +++V+ME+ E G L D +   +   LT
Sbjct: 663 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S   + K+ DFG    I      
Sbjct: 713 EGQIGAVCRETLSGLEFLH--SKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI------ 764

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKN 249
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+  + 
Sbjct: 765 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 818

Query: 250 GGEAAILQARFQYPSYPM---YSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
              A  L A    P        S  LK  +   L   P DR +  ++L +
Sbjct: 819 PLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 110/225 (48%), Gaps = 21/225 (9%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E +A++ + N++ +V    +   +S++Y        L+E+C  G  +  M        T 
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDESSLY-------FLLEYCPNGDFLSLMKKYGSLNETV 279

Query: 132 AEILTIMSHTSQGIAAMHRLQP-ALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           A       +++Q I A+  L    ++HRDIK EN+L+ +  + K+ DFG+   +     N
Sbjct: 280 A-----CYYSAQVIDAIDYLHTNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNN 334

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
           +  F+ +        TA+Y +PE+L+ S    ++ + D+WA G  LY++     PF K  
Sbjct: 335 K--FDLLTRSKSFVGTAEYVAPELLNDSF---VDYRCDVWAFGCILYQMIAGKPPF-KAT 388

Query: 251 GEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            E    Q   + QY     +   +++L++ +L K+ + RP++ Q+
Sbjct: 389 NEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPSISQI 433

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 129/294 (43%), Gaps = 41/294 (13%)

Query: 12  GQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNI-ACLKRVIVPDKPSLNTLR 70
           G+ L +GS     + Y +S G     KV IS +  + N N  A    ++ PD       R
Sbjct: 23  GETLGLGSTGKVQLAYNSSTGQQAAIKV-ISKA-VFNNDNANASDSALLTPDSLPYGIER 80

Query: 71  AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            E+  MKLL N+ +V+   D   + S +Y       +++E+ E+G L + +  R    L 
Sbjct: 81  -EIIIMKLL-NHPNVLRLYDVWETDSNLY-------MVLEYAEKGELFNLLVER--GPLP 129

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG           
Sbjct: 130 ENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA-------- 179

Query: 191 QQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTTPF 246
                    D +  T+     Y +PE++    GLP +  ++D+W+ G+ L+ L     PF
Sbjct: 180 -----LETEDKLLETSCGSPHYAAPEII---SGLPYHGLETDVWSCGIILFALLTGRLPF 231

Query: 247 EKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           ++  G        +   +F+ P     S   ++LI  +L+ +P  R    ++L+
Sbjct: 232 DEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa]
           {ON} some similarities with uniprot|Q03497 Saccharomyces
           cerevisiae YHL007c ser/thr protein kinase of the
           pheromone pathway
          Length = 867

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 111/236 (47%), Gaps = 31/236 (13%)

Query: 13  QILTVGSHHAKVIKYLT--SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
           +I T G+   K   YL    G    VY +  S SD    S    +K++ +  +P    + 
Sbjct: 555 KICTPGTPEDKFETYLKIGQGASGGVY-LSHSRSD---KSQCVAIKQMNLEKQPKKELIV 610

Query: 71  AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            E+  M   K+ +++V+YIDS+ S         +++V+ME+ E G L D +   +   LT
Sbjct: 611 NEIMVMSSSKH-QNIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +     QG+  +H     +LHRDIK +NVL+S N + K+ DFG  C  V     
Sbjct: 660 EGQIGAVCREVLQGLEFLH--SKGVLHRDIKSDNVLLSMNGDIKLTDFG-FCAQVN---- 712

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
               + V        T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 713 ----DTVIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 97/196 (49%), Gaps = 19/196 (9%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D +       L E ++  I  +  +G+  +H  +   +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEML-DLSKGLPI 223
           VL++ +   K+ DFG V G +R    +  F           T  + +PE++ + S G   
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTFV---------GTPYWMAPEIISNSSHGY-- 197

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEK-NGGEAA--ILQARFQYPSYPMYSDRLKNLIRVML 280
           NEK+DIW+LG+ +Y+L     P+ K + G+    I +   Q      +SD  K  I   L
Sbjct: 198 NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQ-DCMVSFSDAAKLFISACL 256

Query: 281 SKNPSDRPNVCQVLEE 296
            K+P +RP   ++L++
Sbjct: 257 IKDPDERPTATELLQQ 272

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 121/270 (44%), Gaps = 32/270 (11%)

Query: 28  LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVS 87
           L  G + +VY V   PS   +   +  + ++ + +       + E+D    L +      
Sbjct: 124 LGKGKFGKVYCVRHKPSG--LICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNLTKL 181

Query: 88  YIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAA 147
           Y   H SK+        V+++ME+   G L   +  +    + +      +   +  +  
Sbjct: 182 YAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTDALNY 231

Query: 148 MHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA 207
           MH+ +  ++HRD+K EN+LI  NN+ K+ DFG     +  P NQ+             T 
Sbjct: 232 MHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC-------GTI 279

Query: 208 QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA---ILQARFQYPS 264
            Y SPE++   +    +E  D+WALG+  Y+L     PFE++  E     I ++  ++P 
Sbjct: 280 DYLSPELISSRE---YDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDLKFP- 335

Query: 265 YPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            P  S   ++LI  +L   PS+R N+ QV+
Sbjct: 336 -PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 95/196 (48%), Gaps = 16/196 (8%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++ L+E+   G  +  +  +    L E       S     + ++H +   ++HRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNI--GIIHRDIKPEN 254

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT-----TAQYRSPEMLDLSK 219
           +L+ +N + K+ DFG+   +   P N  +    Y D+   +     TA+Y SPE+L+ + 
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGK-PYFDLYAKSKSFVGTAEYVSPELLNDNY 313

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ--ARFQYPSYPMYSDRLKNLIR 277
               + + DIWA G  LY++     PF K   E    Q   + QY     +   +K+L++
Sbjct: 314 ---TDSRCDIWAFGCILYQMLAGKPPF-KAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 278 VMLSKNPSDRPNVCQV 293
            +L ++P+DR  + Q+
Sbjct: 370 KLLVRDPNDRLTIKQI 385

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 132/294 (44%), Gaps = 47/294 (15%)

Query: 12   GQILTVGSHHAKVIKY-LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
            G+++  GS  A  +   +T+G    V +VE+ P     N  +            +++ LR
Sbjct: 1143 GEMIGKGSFGAVFLAMNITTGEMMAVKQVEV-PKYGLQNETVVN----------TVDALR 1191

Query: 71   AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
             EV  +K L ++ ++V Y+   A      NG Y +F  +E+   G +   +  R+  R  
Sbjct: 1192 LEVSTLKDL-DHLNIVQYLGFEAK-----NGIYSLF--LEYVAGGSVGSLI--RMYGRFD 1241

Query: 131  EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            +  I  +     QG++ +H     +LHRD+K +N+L+ Q+   K+ DF    GI R    
Sbjct: 1242 DILIRHLTIQVLQGLSYLH--SRGILHRDMKADNLLLDQDGVCKISDF----GISR---- 1291

Query: 191  QQEFNFVYHD---IMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTP-- 245
              + N +Y +    MK T   + +PEM+D  +G   + K DIW+LG  + ++     P  
Sbjct: 1292 --KSNDIYSNSEMTMKGTVF-WMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWS 1346

Query: 246  -FEKNGGEAAILQARFQYP----SYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
             FE       I QA+   P    + P+ S+  K  +      +P  RP   ++L
Sbjct: 1347 NFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 123/293 (41%), Gaps = 59/293 (20%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVI---------VPDKPSLNTLRAEVD 74
            +++ +  G Y +V  + I   + YI     C+K +          V D+  L T+ +E+ 
Sbjct: 1153 ILQKMGEGAYGKV-NLCIHKKEKYI----VCIKMIFKERILVDTWVRDR-KLGTIPSEIQ 1206

Query: 75   AMKLLKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSR 124
             M  L    H  ++  +D     +  Y         G  ++F L+EF             
Sbjct: 1207 IMATLNKKPHENILRLLDFFEDDNYYYIETPIHGETGCIDLFDLIEF------------- 1253

Query: 125  LQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
             +  +TE E   I      GI  +H     ++HRDIK ENV++      K+ DFGS   +
Sbjct: 1254 -KTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVKIIDFGSAAYV 1310

Query: 185  VRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYT 243
               P +     FV        T  Y +PE+L    G P   K  DIWALG+ LY + +  
Sbjct: 1311 KSGPFDV----FV-------GTIDYAAPEVL---SGEPYEGKPQDIWALGILLYTIVFKE 1356

Query: 244  TPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
             PF  N  E  IL+   ++ S    ++    LI+ +L +   +RP + ++ ++
Sbjct: 1357 NPF-YNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFDD 1406

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 103/223 (46%), Gaps = 33/223 (14%)

Query: 98  IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
           ++    E+++++E+ E G L D++ +R   +L E E +       QG++  H     + H
Sbjct: 132 VWENKSELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICH 187

Query: 158 RDIKIENVLISQNNE-YKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLD 216
           RD+K EN+L+ + N+  K+ DFG            +  N +        +  Y SPE++ 
Sbjct: 188 RDLKPENLLLDKKNKTVKIADFGMAA--------LETTNRLLE--TSCGSPHYASPEIVM 237

Query: 217 LSK--GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ---ARFQYPSYPMYSDR 271
             K  G P    SD+W+ G+ L+ L     PF  +     +L+    R+Q PS    S  
Sbjct: 238 GQKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKE 291

Query: 272 LKNLIRVMLSKNPSDRPNVCQVLEEVSRLQ-------GIPCPI 307
            K+LI  +L  +P  R  V ++LE    ++       G+ CP+
Sbjct: 292 AKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPL 334

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 99  YNGAY----EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPA 154
           Y G+Y    +++V+ME+C  G L   +      ++ E  I  IM       A MH  +  
Sbjct: 81  YYGSYLNDTKLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--TALMHIHKDG 135

Query: 155 LLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEM 214
           ++HRDIK  NVLI+ +   K+CDFG    + +    +Q             T  + +PE+
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM---------AGTPYWMAPEV 186

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSYP--MYSDR 271
             + +G+  + K DIW+LG+  Y++     P+ E     A  L  + + P      +S  
Sbjct: 187 --IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSA 244

Query: 272 LKNLIRVMLSKNPSDRPNVCQVLE 295
           LK +I + L ++P +RP+   +L+
Sbjct: 245 LKEIIALCLDEDPKERPSAEDLLK 268

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 100/223 (44%), Gaps = 26/223 (11%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +R E+  +  LK   ++  Y  S+   + ++       V+ME+C  G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTKLW-------VIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           + E  I  IM      + ++HR    ++HRDIK  N+LI+ N   K+CDFG    + +  
Sbjct: 109 IEEKYIGVIMREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQLSQSM 166

Query: 189 KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-- 246
             +Q             T  + +PE+  + +G+  + K DIW+LG+  Y++     P+  
Sbjct: 167 LKRQTM---------AGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 247 -EKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRP 288
            E       I +++        YS  LK  I + L ++P +RP
Sbjct: 216 MEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 128/293 (43%), Gaps = 41/293 (13%)

Query: 12  GQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRA 71
           G  L VGS    V+ Y  + G     K+ IS S    N+  + +     PD       R 
Sbjct: 20  GSTLGVGSTGKVVMAYNETKGQQAAVKI-ISKS--IFNAQGSTMIGGNDPDVLPYGIER- 75

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E+  MKLL N+ +V+   D       ++  + ++++++E+ E+G L + +  R    L E
Sbjct: 76  EIIIMKLL-NHPNVLRLYD-------VWETSKDLYMVLEYVEKGELFNLLVER--GPLPE 125

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
            E +        GI+  H L   ++HRD+K EN+L+      K+ DFG            
Sbjct: 126 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNVKLADFGMAA--------- 174

Query: 192 QEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
                   D +  T+     Y +PE++    GLP +  +SD+W+ GV LY L     PF+
Sbjct: 175 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 227

Query: 248 KNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           +  G        +   +F+ P     S   ++LI  +L+ +P  R    ++L+
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 98/195 (50%), Gaps = 19/195 (9%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D +    +  LTE ++  I     +G+  +H  +   +HRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L++ + + K+ DFG V G +   + +  F           T  + +PE++  S+    N
Sbjct: 163 ILLTDDGKVKLGDFG-VSGQMMATRRRDTF---------VGTPFWMAPEVIARSE-QGYN 211

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIR----VML 280
           EK+DIW+LG+ +++L     P  ++     ++    + P  P   DR  + IR    + L
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRP--PKLEDRYSHAIREFVSLCL 269

Query: 281 SKNPSDRPNVCQVLE 295
           +K+P+ RP   ++L+
Sbjct: 270 NKDPAKRPTASELLK 284

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 130/290 (44%), Gaps = 34/290 (11%)

Query: 6   IETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPS 65
           I+ F  G+IL  GS+    +   TS    + Y V++             L +  +  +  
Sbjct: 179 IKDFKFGEILGDGSY--STVMLATSNDSGKKYAVKV-------------LNKEYLIRQKK 223

Query: 66  LNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRL 125
           +  +  E + ++ L N+R V+    +   ++++Y        L+E+   G  +  M  + 
Sbjct: 224 VKYVNIEKNTLQRLNNSRGVIKLYFTFQDEASLY-------FLLEYAPNGDFLSVM--KK 274

Query: 126 QHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIV 185
              L E       +     I  +H+    ++HRDIK EN+L+ ++ + K+ DFG+   + 
Sbjct: 275 FGSLNEECCRYYGAQMLDAIDFIHK--NGVVHRDIKPENILLDEHMKVKLTDFGTAKLLD 332

Query: 186 RPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTP 245
           R  K+   +N +        TA+Y SPE+L+ +    +N K DIWA G  LY++     P
Sbjct: 333 RDEKSG--YNLLKKSRSFVGTAEYVSPELLNDN---CVNYKCDIWAFGCILYQMIAGKPP 387

Query: 246 FEKNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
           F K   E    Q   + QY     +   +++L++ +L K+P  R N  QV
Sbjct: 388 F-KATNEYLTFQKVMKVQYAFTAGFPLVIRDLVKQLLVKSPEARLNASQV 436

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 105/232 (45%), Gaps = 34/232 (14%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL +   +  Y         ++    E+++++E+ + G L D++ S+   +
Sbjct: 182 IEREIVIMKLLSHPNVMALY--------EVWENNNELYLVLEYVDGGELFDYLVSK--GK 231

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEY-KVCDFGSVCGIVRP 187
           LTE+E +        GI+  H     + HRD+K EN+L+ +     K+ DFG     V  
Sbjct: 232 LTESEAVHYFKQIINGISYCHSFN--ICHRDLKPENLLLDKKRRIIKIADFGMAALQVSN 289

Query: 188 PKNQQEFNFVYHDIMKNTTAQYRSPEML--DLSKGLPINEKSDIWALGVFLYKLCYYTTP 245
              Q              +  Y SPE++      G P    SDIW+ G+ L+ L     P
Sbjct: 290 RLLQTSCG----------SPHYASPEIVMGKCYNGAP----SDIWSCGIILFALLTGHLP 335

Query: 246 FEKNGGEAAILQ---ARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           F  +  +  +++    R+Q PSY   S   KNLI  +L  +PS R +  Q+L
Sbjct: 336 FNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNLISRILVVDPSKRISTEQIL 385

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 113/272 (41%), Gaps = 40/272 (14%)

Query: 23  KVIKYLTSGGYAQVYKVEISPSDPYINSNIAC-LKRVIVPDKPSLNT---LRAEVDAMKL 78
           ++ K L  G + +VY V       +I S   C LK +   D    N     R EV+    
Sbjct: 110 EIGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 79  LKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIM 138
           L++      Y   H  K         V++LME+   G L   +  R      +      +
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYV 213

Query: 139 SHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVY 198
              +  +  MH  +  +LHRDIK EN++I  NN  K+ DFG     V  PK  +      
Sbjct: 214 YQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFGWS---VITPKGSKRKTLC- 267

Query: 199 HDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA---I 255
                  T  Y SPE++   +    NEK D+WALGV  Y+L   + PFE+   E     I
Sbjct: 268 ------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRI 318

Query: 256 LQARFQYPSYPMYSDRLKNLIRVMLSKNPSDR 287
           L+    +P +       ++LI  +L  +P DR
Sbjct: 319 LKRNLIFPDH--VDTEARHLISRLLEYDPGDR 348

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 108/230 (46%), Gaps = 26/230 (11%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           ++ E+  + LL+   ++  Y  S+     I+       ++ME+C  G + + +      R
Sbjct: 49  IQNEIKFLSLLRYAPNITYYYHSYLINRKIW-------IIMEYCNGGSVRNLIKI---GR 98

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
             E  I  I+      +  +H     ++HRDIK  N+LI+QN   K+CDFG    +    
Sbjct: 99  FNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL---- 152

Query: 189 KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-E 247
               EF+      M   T  + +PE++ +   L  + K+DIW++G+  Y++     P+ E
Sbjct: 153 ----EFSKPKRQTMAG-TPYWMAPEVI-IESSL-YDTKADIWSVGITAYEITTGNPPYCE 205

Query: 248 KNGGEAAILQARFQYPSYP--MYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
            +  +A  L  + + P     MYS  LK  I + L ++PS+R    ++LE
Sbjct: 206 YDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 124/291 (42%), Gaps = 53/291 (18%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKLL 79
            +++ +  G Y +V  + +   + YI       K  I+ D       L T+ +E+  M +L
Sbjct: 979  ILQKMGEGAYGKV-NLCLHKKERYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMAVL 1037

Query: 80   KNNRH----VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQH 127
              N+H    ++  +D        Y         G+ ++F L+E              L+ 
Sbjct: 1038 --NKHPDENILRLLDFFEDDDYYYIETPVHGETGSIDLFDLIE--------------LKT 1081

Query: 128  RLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRP 187
             +TE E   I      GI  +H  +  ++HRDIK ENV++      K+ DFGS   +   
Sbjct: 1082 NMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSG 1139

Query: 188  PKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPF 246
            P           D+   T   Y +PE+L    G P   K  DIWA+G+ LY + +   PF
Sbjct: 1140 P----------FDVFVGTI-DYAAPEVLG---GEPYEGKPQDIWAVGILLYTIVFKENPF 1185

Query: 247  EKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
              N  E  I++   ++      S+   NLI+ +L+KN   RP +  + ++V
Sbjct: 1186 -YNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 130/291 (44%), Gaps = 41/291 (14%)

Query: 12   GQILTVGSHHAKVIKY-LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLR 70
            G+++  GS  A  +   +T+G    V +VE+     Y + N A L  V          LR
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALR 1226

Query: 71   AEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
            +EV  +K L ++ ++V Y+    +K  IY+      + +E+   G +   +  R+  R  
Sbjct: 1227 SEVSTLKDL-DHLNIVQYL-GFENKDNIYS------LFLEYVAGGSVGSLI--RMYGRFD 1276

Query: 131  EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            E  I  + +   +G+A +H     +LHRD+K +N+L+ Q+   K+ DF    GI R  K+
Sbjct: 1277 EPLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1330

Query: 191  QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
                 +   D+    T  + +PEM+D  +G   + K DIW+LG  + ++     P+    
Sbjct: 1331 I----YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLE 1384

Query: 251  GEAAILQARFQYPSYPMYSDRL-------KNLIRVMLSKNPSDRPNVCQVL 294
              AA+ +      + P+  D L       +  +      NP  RP   ++L
Sbjct: 1385 VVAAMFKIGKSKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 130/300 (43%), Gaps = 61/300 (20%)

Query: 9   FPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNT 68
           F S ++  VG++  K++K +  G + +VY     P+   +     CLK     DK   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNI 79

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNSRL 125
           +R      ++  + +    YI      + +Y       +V++ +E+C    L D + S  
Sbjct: 80  VR------EVFYHRQFDFPYI------TKLYEVIVTESKVWMALEYCPGKELYDHLLSLR 127

Query: 126 QHRLTE-AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
           +  L E  E+   +S       +MH      +HRD+K+EN+L+ +N   K+ DFG     
Sbjct: 128 RLSLLECGELFAQISGAVYYAHSMH-----CVHRDLKLENILLDRNGNAKLTDFG----- 177

Query: 185 VRPPKNQQEFNFVYHDIMKNT------TAQYRSPEMLDLS--KGLPINEKSDIWALGVFL 236
                      F    + K T      T  Y +PE+++     G  I    DIW+LGV L
Sbjct: 178 -----------FTRECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVIL 222

Query: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           Y L     PF+ +       +   + P Y      D  K+LI  +L+KNP +RP++ QVL
Sbjct: 223 YTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K ++H  +V++IDS+  K        +++V+ME+ E G L D +   +   LT
Sbjct: 642 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 691

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S   + K+ DFG  C  +     
Sbjct: 692 EGQIGAVCRETLSGLKFLH--SKGVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI----- 743

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 744 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 793

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 125/276 (45%), Gaps = 31/276 (11%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  VYK     S   +   +  L+         +N L  E+  +  LK+  ++ +YI 
Sbjct: 26  GNFGDVYKACEKVSGKVVAVKVVNLEHT----DEDINLLAQEIFFLAELKSP-YITNYIT 80

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
           +     +++       ++ME+C  G   D + +     L E++   I     +G+  +H 
Sbjct: 81  TMTEDVSMW-------IIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
            +   +HRDIK  N+L++   + K+ DFG V G +R    +  F           T  + 
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTF---------VGTPFWM 181

Query: 211 SPEMLDL-SKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS--YPM 267
           +PE++   S G   +EK+DIW+LG+ +Y+L   + P  K      ++    + P   +  
Sbjct: 182 APEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHGH 239

Query: 268 YSDRLKNLIRVMLSKNPSDRPNVCQVL--EEVSRLQ 301
           YS   K+ +   L KNP +RP+  ++L  E V+ LQ
Sbjct: 240 YSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 98/196 (50%), Gaps = 16/196 (8%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQP-ALLHRDIKIE 163
           ++ L+E+   G L+  +      +    +  + +  T+Q I ++H +    ++HRDIK E
Sbjct: 334 LYFLLEYASNGDLLTLLK-----KYGSFDETSTIYFTAQIIDSIHYIHSMGIIHRDIKPE 388

Query: 164 NVLISQNNEYKVCDFGSVCGI----VRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSK 219
           N+L++++ + K+ DFG+   +        ++Q  FN +        TA+Y SPE+L  S 
Sbjct: 389 NILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA--RFQYPSYPMYSDRLKNLIR 277
               + + DIWA G  L++L     PF K   E    Q   + QY     +   L++LI+
Sbjct: 449 ---TDSRCDIWAFGCILFQLIAGKPPF-KATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 278 VMLSKNPSDRPNVCQV 293
            +L KNP++R  + Q+
Sbjct: 505 KILIKNPNNRLTIHQI 520

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/287 (22%), Positives = 126/287 (43%), Gaps = 23/287 (8%)

Query: 13  QILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAE 72
           Q++ +G    K  + L  G Y+ V  V  +  D      +  L +  +  +  +  +  E
Sbjct: 115 QVVKMGIKDFKFGEQLGDGSYSSV--VLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVE 172

Query: 73  VDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEA 132
             A++ L   + ++    +   ++++Y        L+E+   G  +  +  +    L E 
Sbjct: 173 KLALQKLNGTKGIIRLFFTFQDEASLY-------FLLEYAPHGDFLALI--KKYGSLNEQ 223

Query: 133 EILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQ 192
                 S     + ++H +   ++HRDIK EN+L+ ++ + K+ DFG+   +   P N  
Sbjct: 224 CARYYASQIIDAVDSLHTI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDA 281

Query: 193 E----FNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
           +    F+          TA+Y SPE+L+ S     + + DIWA G  L+++     PF K
Sbjct: 282 DGKPCFDLNARSKSFVGTAEYVSPELLNDSY---TDSRCDIWAFGCILFQMVAGKPPF-K 337

Query: 249 NGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
              E    Q   + QY     +   +K+L++ +L K P+DR  + Q+
Sbjct: 338 ASNEYLTFQKVMKIQYAFTAGFPQIIKDLVKKLLVKEPNDRLTIEQI 384

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 97/200 (48%), Gaps = 16/200 (8%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQP-ALLHRDIKIE 163
           ++ L+E+   G   DF+   L  +      +    + SQ I A+  L    ++HRDIK E
Sbjct: 199 LYFLLEYAPHG---DFLG--LIKKYGSLNEICARYYASQIIDAVDSLHSIGIIHRDIKPE 253

Query: 164 NVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT----TAQYRSPEMLDLSK 219
           N+L+ ++ + K+ DFG+   +   P N  +    +    K+     TA+Y SPE+L+ S 
Sbjct: 254 NILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY 313

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ--ARFQYPSYPMYSDRLKNLIR 277
               + + DIWA G  LY++     PF K   E    Q   + QY     +   +K+L++
Sbjct: 314 ---TDSRCDIWAFGCILYQMLAGKPPF-KAANEYLTFQKVMKIQYAFTAGFPQIVKDLVK 369

Query: 278 VMLSKNPSDRPNVCQVLEEV 297
            +L ++P+DR  + Q+   V
Sbjct: 370 KLLVRDPNDRLAIEQIKAHV 389

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 124/274 (45%), Gaps = 45/274 (16%)

Query: 30   SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
            SGG    Y+V  + S          +K++ +  +P    +  E+  MK  K+ +++V++I
Sbjct: 1038 SGGVYTAYEVGTNAS--------VAVKQMNLEKQPKTELIINEIIVMKESKH-KNIVNFI 1088

Query: 90   DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
            DS+  K        +++V+ME+ E G L D +   +   LTE +I  +   T  G+  +H
Sbjct: 1089 DSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFLH 1138

Query: 150  RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA-- 207
                 ++HRDIK +N+L+S   + K+ DFG  C          + N V+   +K TT   
Sbjct: 1139 --SKGVIHRDIKSDNILLSMQGDIKLTDFG-FCA---------QINEVH---LKRTTMVG 1183

Query: 208  --QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPS 264
               + +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P 
Sbjct: 1184 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPE 1240

Query: 265  Y---PMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
                   S  L N +   L  +P  R    ++LE
Sbjct: 1241 LKEPEKLSSILHNFLDACLKVDPEVRATATELLE 1274

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 120/285 (42%), Gaps = 49/285 (17%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKLL 79
            +++ +  G Y +V  + +  ++ YI       K  I+ D       L T+ +E+  M  +
Sbjct: 1078 ILQNMGEGAYGKV-NLCLHKTERYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATI 1136

Query: 80   KNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
                H  +++ +D        Y         G+ ++F L+EF              +  +
Sbjct: 1137 SKEPHENILTLLDFFEDDDYYYIETPVHGETGSIDLFDLIEF--------------KTNM 1182

Query: 130  TEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPK 189
            TE E   +      G+  +H     ++HRDIK EN+++      K+ DFGS   +   P 
Sbjct: 1183 TEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGP- 1239

Query: 190  NQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFEK 248
                      D+   T   Y +PE+L    G P   K  DIWA+G+ LY + +   PF  
Sbjct: 1240 ---------FDVFVGTI-DYAAPEVL---GGSPYEGKPQDIWAIGILLYTIVFKENPF-Y 1285

Query: 249  NGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            N  E  IL+   ++ S  + S++   LI  +L++N   RP +  +
Sbjct: 1286 NIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDDI 1328

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 44/242 (18%)

Query: 66   LNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERG 115
            L T+ +E+  M  L  + H  ++  +D        Y         G  ++F L+EF    
Sbjct: 1154 LGTIPSEIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEF---- 1209

Query: 116  GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
                      +  +TE+E   I      GI  +H     ++HRD+K ENV++      K+
Sbjct: 1210 ----------KSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVKL 1257

Query: 176  CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP-INEKSDIWALGV 234
             DFGS   +   P +     FV        T  Y +PE+L    G P + +  DIWA+G+
Sbjct: 1258 IDFGSAAYVNSGPFDV----FV-------GTIDYAAPEVL---SGEPYLGKPQDIWAIGI 1303

Query: 235  FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
             LY + +   PF  N  E  IL+A  +  +    S    +LI+ +L+KNP+ RP + +++
Sbjct: 1304 LLYTIMFKENPF-YNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIV 1360

Query: 295  EE 296
             +
Sbjct: 1361 ND 1362

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 131/311 (42%), Gaps = 43/311 (13%)

Query: 6    IETFPSGQILTVGSH-HAK------VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRV 58
            I+T  + +   +GS  H K      V++ +  G Y +V  + +   D YI       K  
Sbjct: 946  IQTSNTSKSYVIGSQKHTKKFSDFLVLQKMGEGAYGKV-DLCMHKKDKYIVVIKRIYKER 1004

Query: 59   IVPD----KPSLNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFC 112
            I+ D      +L T+ +E+  M  L    H  ++  +D        Y       +  E  
Sbjct: 1005 ILVDTWVRDRTLGTIPSEIQIMVTLNRKPHENILRILDFFEDDDYYY-------LETEMH 1057

Query: 113  ERGGLIDFMN-SRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
               G ID  +   L+  +TE E   +    + GI  +H     ++HRDIK ENV++    
Sbjct: 1058 GETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKG 1115

Query: 172  EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIW 230
              K+ DFGS   +   P           D+   T   Y +PE+L    G P   K  DIW
Sbjct: 1116 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---GGEPYEGKPQDIW 1161

Query: 231  ALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNV 290
            A+GV LY + Y   PF  N  E  IL    +  S    S     LIR +L+++ S RP +
Sbjct: 1162 AIGVLLYTIIYKENPF-YNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTI 1218

Query: 291  CQVLEEVSRLQ 301
              ++E+ S LQ
Sbjct: 1219 DDIMED-SWLQ 1228

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (44%), Gaps = 31/209 (14%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILT------IMSHTSQGIAAMHRLQPALLH 157
           +V++++E+C RG +     ++L+ +     IL+      I+S    G+  +H     ++H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENQLEIKAVGPPILSFQQARNIVSDVVSGLEYLH--SQGIIH 187

Query: 158 RDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT---TAQYRSPEM 214
           RDIK  N+LIS N   K+ DFG          N Q     +  I+K+    T  + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVSILTAAESTNIQS---SHEPILKSKTFGTPAFFAPEL 244

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA---ILQARFQYPSY------ 265
                    +   DIW+LGV LY L + T PF  N G      I+     +PSY      
Sbjct: 245 CSTETYCCRSSAIDIWSLGVTLYCLLFGTLPFNANSGLELFDNIINKPLDFPSYEEILKH 304

Query: 266 -------PMYSDRLKNLIRVMLSKNPSDR 287
                    Y D  K+L+  +L KNPS R
Sbjct: 305 DSSNVTIEEYRDA-KDLLYKLLEKNPSRR 332

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 115/248 (46%), Gaps = 34/248 (13%)

Query: 70  RAEVDAMKLLKNNRHVVSYIDS--HASKSAIYNGAYE---VFVLMEFCERGGLIDFMNSR 124
           +AE+    L K  R  V    S  H + + +Y   ++   V++LME+   G L   + S 
Sbjct: 124 KAEIVQYNLQKQFRREVEIQTSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRS- 182

Query: 125 LQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
                 +      +   +  +  +H  Q  ++HRD+K EN+LI  NN  K+ DFG    I
Sbjct: 183 -HGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPENILIGFNNVIKLTDFG--WSI 237

Query: 185 VRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTT 244
           + P   +++            T  Y SPEM+   +    ++K D+WALGV  Y+L   + 
Sbjct: 238 INPRGVKRK--------TLCGTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSP 286

Query: 245 PFEKNGGEAA---ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQ 301
           PFE++  E     IL+   ++P     S  +K+LI  +L  NPS+R ++  V++      
Sbjct: 287 PFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLKYNPSERISMRDVMKH----- 339

Query: 302 GIPCPIRN 309
             P  IRN
Sbjct: 340 --PWIIRN 345

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 108/236 (45%), Gaps = 37/236 (15%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL N+ +V+   D       ++  + ++++++E+ E+G L + +  R    
Sbjct: 76  IEREITIMKLL-NHPNVLRLYD-------VWETSTDLYMVLEYVEKGELFNLLIER--GP 125

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG         
Sbjct: 126 LPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMAA------ 177

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE++    GLP +  +SD+W+ GV LY L     
Sbjct: 178 -------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRL 227

Query: 245 PFEKNGGEAAIL-----QARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           PF+++ G    L        F+ P     S   ++LI  +L+ +PS R    ++L+
Sbjct: 228 PFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 89/176 (50%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K ++H  +V++IDS+  K        +++V+ME+ E G L D +   +   LT
Sbjct: 704 INEILVMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 753

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S   + K+ DFG    I      
Sbjct: 754 EGQIGAVCRETLSGLKFLH--SKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI------ 805

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 806 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 855

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 133/308 (43%), Gaps = 52/308 (16%)

Query: 26  KYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHV 85
           K +  G +A VY+   S  DP     +  + +  + +K  L  L  E+  +K L N++H+
Sbjct: 136 KEIGKGSFAVVYR-GYSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSR----LQHRLTEA--------- 132
           V+ ID   +K+       +  ++ME+C  G L   +  R    + H L            
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 133 ------EILTIMSHTSQGIAAMHRLQPA-LLHRDIKIENVLISQ-----NNEYKVCDFGS 180
                  I  ++++  Q  +A+  L+   L+HRDIK +N+L+S      +++      G 
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGY 306

Query: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQ--------YRSPEMLDLSKGLPINEKSDIWAL 232
           +     P     +F F     + NT+          Y +PE+L+  K    N K+D+W++
Sbjct: 307 IGISCLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSV 361

Query: 233 GVFLYKLCYYTTPFEKNGGEAAILQAR-----FQYPSYPMYSDRLKNLIRVMLSKNPSDR 287
           G  LY++ Y   PF+ N     + + +       +PSY    D +K LI  +L  +P  R
Sbjct: 362 GTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKR 421

Query: 288 PNVCQVLE 295
            +  +  E
Sbjct: 422 MSFQEFFE 429

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 111/231 (48%), Gaps = 30/231 (12%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           ++ + ++K +RH  +V++IDS+     + +G  +++V+ME+ E G L D +   +   LT
Sbjct: 654 INEILVMKGSRHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I  +   T  G+  +H     +LHRDIK +N+L+S + + K+ DFG    I      
Sbjct: 704 EGQIGAVCRETLSGLQFLH--SKGVLHRDIKSDNILLSISGDIKLTDFGFCAQI------ 755

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKN 249
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+  + 
Sbjct: 756 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 809

Query: 250 GGEAAILQARFQYPSYPM---YSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
              A  L A    P        S  L+N +   L  +P  R +   +L +V
Sbjct: 810 PLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPEQRASATDLLNDV 860

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 116/254 (45%), Gaps = 39/254 (15%)

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEF 111
           +  +K++ +  +P    +  E+  MK  ++N +VV++I++H SK  ++       ++ME+
Sbjct: 542 LVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVVNFINAHLSKGNLW-------IVMEY 593

Query: 112 CERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNN 171
            E G L D +   L   L+E +I  +   T +G+  +H     ++HRDIK +NVL+S   
Sbjct: 594 MEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLH--SKGVIHRDIKSDNVLLSMKG 648

Query: 172 EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ-----YRSPEMLDLSKGLPINEK 226
           + K+ DFG    I              +DI  N T       + +PE++   +  P   K
Sbjct: 649 DIKLTDFGFCAQI--------------NDIDLNRTTMVGTPYWMAPEVVSRKEYGP---K 691

Query: 227 SDIWALGVFLYKLCYYTTPFEKNGGEAAI-LQARFQYPSYPM---YSDRLKNLIRVMLSK 282
            DIW+LG+ + ++     P+       A+ L A    P        SD   N +   L  
Sbjct: 692 VDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPKLKEPENLSDVFSNFLDRCLRV 751

Query: 283 NPSDRPNVCQVLEE 296
            P +R +  ++L +
Sbjct: 752 EPEERASAIELLAD 765

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 142/336 (42%), Gaps = 65/336 (19%)

Query: 15  LTVGSHHAKVIKYLTSGGYAQVYKVE-----ISPSDPYINSNIACLKRVIVP--DKPSLN 67
           L++      + K L    ++ +Y V+      + S P   +N+  LKR+  P  +  S++
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTP--RTNLYALKRIRCPFGNIESIS 83

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH 127
               EVD  K  ++  +++  +DS  ++    +G+  V++L+ +   G L D  +  L +
Sbjct: 84  GAMKEVDNYKRFQSP-YIIHLVDSQVAQQR--DGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 R--LTEAEILTIMSHTSQGIAAMH----RLQPA-------------------LL------ 156
              ++EAE + I+   ++G+  +H    R Q A                   LL      
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 157 ----------------HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
                           HRDIK  N+L S +    + + GS            +   +   
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 201 IMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK----NGG--EAA 254
           +  + T  Y +PE+L ++    ++ K DIW+LG   Y + +  +PFE+    +G   + A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 255 ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNV 290
           I    F +PS   YS+ L  LI   L  NP+ RP++
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 105/239 (43%), Gaps = 44/239 (18%)

Query: 66   LNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERG 115
            L T+ +E+  M  L  + H  ++  +D        Y         G  ++F L+EF    
Sbjct: 1084 LGTILSEIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEF---- 1139

Query: 116  GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
                      +  ++E E   I       I  +H     ++HRDIK ENV++      K+
Sbjct: 1140 ----------KTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIKL 1187

Query: 176  CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP-INEKSDIWALGV 234
             DFGS   +   P +     FV        T  Y +PE+L    G P + +  DIWA+G+
Sbjct: 1188 IDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVL---GGEPYVGKPQDIWAIGI 1233

Query: 235  FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
             LY + +   PF  N  E  IL+A  ++ +     +   +LI+ +L++NP+ RP + ++
Sbjct: 1234 LLYTIIFKENPF-YNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 106/227 (46%), Gaps = 34/227 (14%)

Query: 21  HAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSL--NTLRAEVDAMKL 78
           H ++I++L  G Y  V  V+    +P   + IA  K   + +K  L    +R E+  M  
Sbjct: 37  HYEIIQFLGKGAYGTVCSVKFKGQNP--PAKIAVKKISNIFNKEILLKRAIR-ELKFMNF 93

Query: 79  LKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH---RLTEAEIL 135
            K ++++V+ ID     S+ Y+G Y        C +  LID+  +++ H   +L+E  I 
Sbjct: 94  FKGHKNIVNLIDLEIVSSSPYDGLY--------CYQE-LIDYDLAKVIHSSVQLSEFHIK 144

Query: 136 TIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI------VRPPK 189
             +     G+  +H     ++HRD+K  N+L + N   K+CDFG   GI        P  
Sbjct: 145 YFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSV 202

Query: 190 NQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFL 236
                N+V        T  YR+PE+L  ++  P N+  DIWA+G  L
Sbjct: 203 QPHITNYV-------ATRWYRAPELLLSNQ--PYNKSIDIWAVGCIL 240

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 131/292 (44%), Gaps = 29/292 (9%)

Query: 11  SGQILTVGSHHAKVIKYLTSGGYAQV-YKVEISPSDPYINSNIACLKRVIVPDKPSLNTL 69
           S Q++  G    K  + L  G Y+ V     I     Y    +  L +  +  +  +  +
Sbjct: 200 SKQVILKGIKDFKFGEVLGDGSYSTVMLATSIETKKKYA---VKVLSKEYLIKQKKVKYV 256

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
             E +A++ L N+R +V    +   ++++Y        L+E+   G   DF++  L  + 
Sbjct: 257 NIEKNALQKLNNSRGIVRLFFTFQDEASLY-------FLLEYAPNG---DFLS--LIKKF 304

Query: 130 TEAEILTIMSHTSQGIAAMHRLQP-ALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
                     +++Q I A+H +    ++HRDIK EN+L+    + K+ DFG+   I+ P 
Sbjct: 305 GSMNEDCASYYSAQIIDAIHFVHSRGIIHRDIKPENILLDSEMKVKLTDFGT-AKILEPK 363

Query: 189 KNQQEFNFVYHDIMKNT-----TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYT 243
            +        +D++  +     TA+Y SPE+L+ S     + + DIWA G  ++++    
Sbjct: 364 SSSSSSKHETYDLLTRSKSFVGTAEYVSPELLNDSYA---DSRCDIWAFGCIVFQMIAGK 420

Query: 244 TPFEKNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            PF K   E    Q   + QY     +   +++L++ +L K P  R  + Q+
Sbjct: 421 PPF-KATNEYLTFQKVMKVQYAFTAGFPLVIRDLVKRILIKAPEQRLTISQI 471

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 125/280 (44%), Gaps = 48/280 (17%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E+  MKLL N+ +V+   D       ++  A ++++++E+ E+G L + +  R    L E
Sbjct: 78  EIIIMKLL-NHPNVLRLYD-------VWETAQDLYMVLEYVEKGELFNLLVQR--GPLPE 127

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
            E +        GI+  H L   ++HRD+K EN+L+      K+ DFG            
Sbjct: 128 NEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKLADFGMAA--------- 176

Query: 192 QEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
                   D +  T+     Y +PE++    GLP +  +SD+W+ GV LY L     PF+
Sbjct: 177 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 248 KNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQG 302
           +  G        +   +++ P     S   ++LI  +L+  P  R    ++L+    LQ 
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH-PLLQK 288

Query: 303 IPC-----PIRNF----YLLRAMENNKRTIEQPV-QNVYM 332
            P       IRN       L  +++N  TI+Q + QN+ +
Sbjct: 289 YPSIKDSKSIRNLPREDTYLNPLDHNDGTIDQAILQNLVV 328

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 106/236 (44%), Gaps = 37/236 (15%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL N+ +V+   D   + + +Y       +++E+ E+G L + +  +    
Sbjct: 90  IEREIIIMKLL-NHTNVLRLYDVWETNNNLY-------MVLEYAEKGELFNLLVEK--GP 139

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        G++  H L   ++HRD+K EN+L+   +  K+ DFG         
Sbjct: 140 LAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA------ 191

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE++    GLP N  ++DIW+ GV L+ L     
Sbjct: 192 -------LETEDKLLETSCGSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRL 241

Query: 245 PFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           PF++  G        + +  F+ P     S   ++LI  +L+ NP  R    ++L+
Sbjct: 242 PFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILK 297

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 117/248 (47%), Gaps = 33/248 (13%)

Query: 85  VVSYIDSHASKSA---IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHT 141
           V+  + SHA+  A   ++    E+++++E+ + G L D++ SR   +L E E +      
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 SQGIAAMHRLQPALLHRDIKIENVLISQNNE-YKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
            +G++  H     + HRD+K EN+L+ + N+  K+ DFG +  +  P K           
Sbjct: 224 VEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG-MAALELPNK----------- 269

Query: 201 IMKNTTA--QYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFEKNGGEAAILQ 257
           ++K +     Y SPE++    G P +   SD+W+ G+ L+ L     PF  +  +  +L+
Sbjct: 270 LLKTSCGSPHYASPEIV---MGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLK 326

Query: 258 ARFQYPSYPM-YSDRLKNLIRVMLSKNPSDRPNVCQVLEE--VSRLQGIPCPIRNFYLLR 314
            +      PM  S   +NLI  +L  +P  R    ++LE   + +   +P       +LR
Sbjct: 327 VQSGKYQMPMNLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV----NKMLR 382

Query: 315 AMENNKRT 322
            M+ +  T
Sbjct: 383 KMKGDSMT 390

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 125/272 (45%), Gaps = 26/272 (9%)

Query: 28  LTSGGYAQVYKVEISPSDPY-INSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVV 86
           L +G Y++VYK  +  SDP  + +   C KR I+ +   +  +  E + + LL    H  
Sbjct: 18  LGNGSYSRVYKA-VDRSDPQRVYAVKVCSKRHIIHEN-KVKYVTIEKNTLNLLARANHP- 74

Query: 87  SYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIA 146
             +  H++    ++    ++ +++F   G L+  +N     + TE      ++       
Sbjct: 75  GIVKLHST----FHDEENLYFVLDFAAGGELLSLLNR--VGKFTEPCARHFIAQLIDTTE 128

Query: 147 AMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTT 206
            +H     ++HRD+K ENVL+ ++    V DFG+   I +    +   +FV        T
Sbjct: 129 FIHSQ--GVIHRDLKPENVLLHRDGRLMVTDFGTATNITK-ENTEGGASFV-------GT 178

Query: 207 AQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ--ARFQYPS 264
           A+Y SPE+L  ++       SD+WALG  LY+      PF +   E    +     +YP 
Sbjct: 179 AEYVSPELLLYNQ---CQFASDVWALGCMLYQFIEGVPPF-RGENELHTFEKIVALEYPW 234

Query: 265 YPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
                  + +L+R +L+ +PS RP++  + ++
Sbjct: 235 ANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 84/157 (53%), Gaps = 8/157 (5%)

Query: 140 HTSQGIAAMHRL-QPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVY 198
           +++Q + A+  L Q  ++HRDIK EN+L+ ++ + K+ DFG+   +V   +  Q +N + 
Sbjct: 267 YSAQILDAIDYLHQKGVIHRDIKPENILLDKDMKVKLTDFGT-AKLVEKDETTQTYNLLE 325

Query: 199 HDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA 258
                  TA+Y SPE+L+ +    ++ K DIWA G  L+++     PF K   E    Q 
Sbjct: 326 RSKSFVGTAEYVSPELLNDNY---VDYKCDIWAFGCILFQMIAGKPPF-KATNEYLTFQK 381

Query: 259 --RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
             + QY     +   +++LI+ +L KNP  R +  QV
Sbjct: 382 VMKVQYAFTAGFPLIIRDLIKQILVKNPEQRLDTLQV 418

>KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa]
           {ON} Anc_3.60 YNL298W
          Length = 829

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 105/221 (47%), Gaps = 30/221 (13%)

Query: 33  YAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH--VVSYID 90
           Y   + V I  ++P    +   +K++I+  +P    +   V+ + ++KN+RH  +V++++
Sbjct: 558 YQNDHVVSIENNEPQAIGDKVAIKQMILSKQPRKELI---VNEILVMKNSRHKNIVNFLE 614

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFM-----NSRLQHRLTEAEILTIMSHTSQGI 145
           ++           +++V+MEF E G L D +     N      LTE +I  I+  T QG+
Sbjct: 615 AYLKTED------DLWVVMEFMEGGSLTDIIENSPTNGSNHSPLTEPQIAYIVRETCQGL 668

Query: 146 AAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNT 205
             +H     ++HRDIK +NVL+      K+ DFG    +    K  +    V        
Sbjct: 669 KFLHDKH--IIHRDIKSDNVLLDTRARVKITDFGFCAKLTD--KRSKRATMV-------G 717

Query: 206 TAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
           T  + +PE++   K    +EK D+W+LG+   ++     P+
Sbjct: 718 TPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPPY 755

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 138/320 (43%), Gaps = 62/320 (19%)

Query: 15  LTVGSHHAKVIKYLTSGGYAQVYKVEI-------SPSDPYINSNIACLKRVIVPDKPSLN 67
           +T+G     + K +  G +A V++  +         + P +N  I  + R  + +K  L 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLLE 89

Query: 68  TLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH 127
            L  E+  +K + N+ H+V  ID   + +  Y       ++ME+C  G L   +  R  H
Sbjct: 90  NLEIEIAILKKI-NHPHIVKLIDCERTTTDFY-------LIMEYCALGDLTFLIKKR--H 139

Query: 128 RLTEAEILT---------------------IMSHTSQGIAAMHRLQPA-LLHRDIKIENV 165
            L +   L                      I+++  Q  +A+  L+   L+HRDIK +N+
Sbjct: 140 ELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNL 199

Query: 166 L-----ISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ--------YRSP 212
           L     I+ N+       G + GI   P   +  +F +   + NT+          Y +P
Sbjct: 200 LLLTPLINYNDSKAFKKLGFI-GIYELPI-LKIADFGFARFLPNTSMAETLCGSPLYMAP 257

Query: 213 EMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA-----RFQYPSYPM 267
           E+L+  K    N K+D+W++G  LY++CY T PF+ +       +      +  +P+Y  
Sbjct: 258 EILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYIQ 314

Query: 268 YSDRLKNLIRVMLSKNPSDR 287
             + +K LI  +L+ +P  R
Sbjct: 315 IQNDMKILISKLLTFDPQRR 334

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 117/247 (47%), Gaps = 29/247 (11%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCE 113
            +K++ +  +P    +  E+  M+  K++ ++V++IDS+ +K        +++++ME+ E
Sbjct: 647 AIKQMNLEKQPKKELILNEILVMRESKHS-NIVNFIDSYLAKG-------DLWIVMEYME 698

Query: 114 RGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEY 173
            G L D +   L   L+E +I  +   T +G+  +H     +LHRDIK +N+L+S     
Sbjct: 699 GGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLH--SKGVLHRDIKSDNILLSLKGNI 753

Query: 174 KVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALG 233
           K+ DFG    I        E N     ++   T  + +PE++   +  P   K DIW+LG
Sbjct: 754 KLTDFGFCAQI-------NENNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLG 801

Query: 234 VFLYKLCYYTTPF-EKNGGEAAILQARFQYPSY---PMYSDRLKNLIRVMLSKNPSDRPN 289
           + + ++     P+  +    A  L A    P        SD L   +   L  +PS+R  
Sbjct: 802 IMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERAT 861

Query: 290 VCQVLEE 296
             ++L++
Sbjct: 862 ATELLDD 868

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 126/271 (46%), Gaps = 37/271 (13%)

Query: 30   SGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYI 89
            SGG    Y++         N+++A +K++ +  +P    +  E+  MK  K+ +++V++I
Sbjct: 847  SGGVYTAYEIGT-------NASVA-IKQMNLEKQPKKELIINEILVMKGSKH-KNIVNFI 897

Query: 90   DSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMH 149
            DS+  K        +++V+ME+ E G L D +   +   LTE +I  +   T +G+  +H
Sbjct: 898  DSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLH 947

Query: 150  RLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQY 209
                 ++HRDIK +N+L+S +   K+ DFG    I        E N     ++   T  +
Sbjct: 948  --SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQI-------NESNLKRTTMVG--TPYW 996

Query: 210  RSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSYP-- 266
             +PE++   +  P   K DIW+LG+ + ++     P+  +    A  L A    P     
Sbjct: 997  MAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDA 1053

Query: 267  -MYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
               S  LK  +   L  NP +R    ++L +
Sbjct: 1054 GSLSSVLKRFLNWCLHVNPENRATAVELLSD 1084

>NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa]
           {ON} Anc_3.60
          Length = 819

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 120/242 (49%), Gaps = 36/242 (14%)

Query: 19  SHHAKVIKYLTSGGYAQVY---KVEISPSD------PYINSNIACLKRVIVPDKPSLNTL 69
           + + ++I+    G    VY   ++ I P++      P I   +A +K++I+  +P    +
Sbjct: 526 TEYFQMIEKAGQGASGSVYLAKRINIPPAEFEESEIPGIGDKVA-IKQMILSKQPRKELI 584

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFM-NSRLQHR 128
             E+  MK   +++++V++++++           +++V+MEF E G L D + NS +   
Sbjct: 585 VNEILVMKD-SHHKNIVNFLEAYLKTED------DLWVVMEFMEGGSLTDIIENSPVDDT 637

Query: 129 ----LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
               LTE++I  I+  T QG+  +H     ++HRDIK +NVL+  N   K+ DFG  C  
Sbjct: 638 SHSPLTESQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDMNGRVKITDFG-FCAK 694

Query: 185 VRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTT 244
           +   ++++             T  + +PE++   K    +EK D+W+LG+   ++     
Sbjct: 695 LTDQRSKRATMV--------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEP 743

Query: 245 PF 246
           P+
Sbjct: 744 PY 745

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 128/300 (42%), Gaps = 41/300 (13%)

Query: 5   QIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKP 64
           Q+  +  G+ L +GS     + +  + G     KV IS S    N+N A    +  PD  
Sbjct: 14  QLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKV-ISKS--VFNNNSAQSSSLTTPDAL 70

Query: 65  SLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSR 124
                R E+  MKLL N+ +V+   D   + S +Y       +++E+ E+G L + +  +
Sbjct: 71  PYGIER-EIIIMKLL-NHPNVLRLYDVWETNSNLY-------MVLEYAEKGELFNLLVEK 121

Query: 125 LQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGI 184
               L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG     
Sbjct: 122 --GPLQEQEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA-- 175

Query: 185 VRPPKNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLC 240
                          D +  T+     Y +PE++    G+P +   SD+W+ GV L+ L 
Sbjct: 176 -----------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILFALL 221

Query: 241 YYTTPFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
               PF++  G        +    F+ PS    S   ++L+  +L+ +P  R     +L+
Sbjct: 222 TGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILK 281

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 118/289 (40%), Gaps = 49/289 (16%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKLL 79
            V++ +  G Y +V  + I     YI       K  I+ D       L T+ +E+  +  +
Sbjct: 948  VLQKMGEGAYGKV-NLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQILATI 1006

Query: 80   KNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
                H  ++  +D        Y         G+ ++F ++EF              +  +
Sbjct: 1007 NKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEF--------------KSNM 1052

Query: 130  TEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPK 189
            TE E   I      GI  +H     ++HRDIK ENV++      K+ DFGS   +   P 
Sbjct: 1053 TEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGP- 1109

Query: 190  NQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS-DIWALGVFLYKLCYYTTPFEK 248
                      D+   T   Y +PE+L    G P   KS DIWA+G+ LY L Y   PF  
Sbjct: 1110 ---------FDVFVGTI-DYAAPEVL---GGNPYEGKSQDIWAIGILLYTLIYKENPF-Y 1155

Query: 249  NGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
            N  E  IL+   ++      S   K LI  +L++    RP + ++ ++V
Sbjct: 1156 NIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 98/198 (49%), Gaps = 26/198 (13%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCE 113
            +K++I+  +P    +  E+  MK  K+ +++V++I+S+           +++V+ME+ E
Sbjct: 633 AIKQMILSKQPRKELIVNEIHVMKDSKH-KNIVNFIESYLKTED------DLWVVMEYME 685

Query: 114 RGGLIDFM-----NSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLIS 168
            G L D +     N      LTE +I  I+  T QG+  +H     ++HRDIK +NVL+ 
Sbjct: 686 GGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLD 743

Query: 169 QNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSD 228
            +   K+ DFG  C  +   +N++             T  + +PE++   K    +EK D
Sbjct: 744 THARVKITDFG-FCAKLTDQRNKRATMV--------GTPYWMAPEVV---KQREYDEKVD 791

Query: 229 IWALGVFLYKLCYYTTPF 246
           +W+LG+   ++     P+
Sbjct: 792 VWSLGIMAIEMLESEPPY 809

>NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa]
           {ON} Anc_3.60
          Length = 790

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 117/247 (47%), Gaps = 38/247 (15%)

Query: 14  ILTVGSHHAKVIKYLTSGGYAQVY---KVEISPSD----PYINSNIACLKRVIVPDKPSL 66
           I T  S + ++I+    G    VY   ++ I P +    P +   +A +K++I+  +P  
Sbjct: 494 INTDPSPYFQMIEKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVA-IKQMILSKQPRK 552

Query: 67  NTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMN-- 122
             +   V+ + ++K++RH  +V++++++           +++V+MEF E G L D +   
Sbjct: 553 ELI---VNEILVMKDSRHKNIVNFLEAYLKTED------DLWVVMEFMEGGSLTDIIENS 603

Query: 123 ---SRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179
                    LTE +I  I+  T QG+  +H     ++HRDIK +NVL+  N   K+ DFG
Sbjct: 604 PATGSSSSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDNNARVKITDFG 661

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239
               +    +  +    V        T  + +PE++   K    +EK D+W+LG+   ++
Sbjct: 662 FCAKLTD--QRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEM 709

Query: 240 CYYTTPF 246
                P+
Sbjct: 710 LESEPPY 716

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 104/224 (46%), Gaps = 17/224 (7%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E +A++ L N+R +V    +   +S++Y        L+E+   G  +  M  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESSLY-------FLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQ 191
                  +     I  +H     ++HRDIK EN+L+ ++ + K+ DFG+   +   P   
Sbjct: 266 DCACYYSAQIIDAIDFLH--SKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTT 323

Query: 192 QEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGG 251
             ++ +        TA+Y SPE+L+ +    ++ + DIWA G  L+++     PF K   
Sbjct: 324 DSYDLLSRSKSFVGTAEYVSPELLNDNY---VDYRCDIWAFGCILFQMIAGKPPF-KATN 379

Query: 252 EAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
           E    Q   + QY     +   +++L++ +L K P+ R  + Q+
Sbjct: 380 EYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 109/237 (45%), Gaps = 26/237 (10%)

Query: 62  DKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFM 121
           D+  +  ++ E+  +  LK   ++  Y  S+   ++++       ++ME+C  G L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSLW-------IIMEYCGGGSLRSLL 123

Query: 122 NSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSV 181
                 ++ E  I  IM      +  +H+    ++HRDIK  NVLI+ +   K+CDFG  
Sbjct: 124 RP---GKIDEKYIGVIMREILIALKYIHKDN--VIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 182 CGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCY 241
             + +    +Q             T  + +PE+  + +G+  + K+DIW+ G+  Y++  
Sbjct: 179 AQLNQTKSRRQTM---------AGTPYWMAPEV--IMEGVYYDTKADIWSTGITAYEVTT 227

Query: 242 YTTPF-EKNGGEAAILQARFQYPSYPM--YSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
              P+ +     A  L A+ + P      YS  +K  I   L ++PS+RP   ++L+
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 94/193 (48%), Gaps = 17/193 (8%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D + +   + L E ++  I     +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDL-SKGLPI 223
           +L++   + K+ DFG V G +R    +  F           T  + +PE+++  S G   
Sbjct: 144 ILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVVNKESNGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS--YPMYSDRLKNLIRVMLS 281
           NEK+DIW+LG+ +Y+L     P  K      ++    + P   +  YSD  K  +   L 
Sbjct: 192 NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKGFVAACLV 251

Query: 282 KNPSDRPNVCQVL 294
           K+P+ RP+   +L
Sbjct: 252 KDPNLRPSAEMLL 264

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 109/222 (49%), Gaps = 33/222 (14%)

Query: 25  IKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH 84
           I    SGG    Y++         N+++A +K++ +  +P    +  E+  MK  ++N +
Sbjct: 689 IGQGASGGVYTAYEIGT-------NASVA-IKQMNLEKQPKKELIINEILVMKGSRHN-N 739

Query: 85  VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQG 144
           +V++IDS+  K        +++V+ME+ E G L D +   +   LTE +I  +   T +G
Sbjct: 740 IVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRG 789

Query: 145 IAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN 204
           +  +H     ++HRDIK +N+L+S +   K+ DFG    I        E N     ++  
Sbjct: 790 LHFLH--SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQI-------NETNLKRTTMVG- 839

Query: 205 TTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
            T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 840 -TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 94/215 (43%), Gaps = 31/215 (14%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILT------IMSHTSQGIAAMHRLQPALLH 157
           +V++++E+C RG +     ++++ +     ILT      I+S    G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVRWCPENQMEIKAVGPSILTFEQSRKILSDVVSGLEHLH--SRGITH 187

Query: 158 RDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA---QYRSPEM 214
           RDIK  N+LIS N   K+ DFG          N Q     +  I+K+ T     + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAILSTTGSTNIQS---SHEQILKSKTLGTPAFLAPEL 244

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQARFQYPSY------ 265
                        DIW+LGV LY L + T PF  N        I+    + PSY      
Sbjct: 245 CSTDSEHCCTFAIDIWSLGVTLYCLLFGTLPFNANSVLELFDKIINKSLEVPSYEEMLNR 304

Query: 266 -------PMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
                    YSD  KNL+  +L KNP  R  + ++
Sbjct: 305 GTSDITIEEYSDA-KNLLYKLLQKNPDKRIALAEI 338

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 125/291 (42%), Gaps = 23/291 (7%)

Query: 13  QILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAE 72
            ++ +G    K  + L  G Y+ V  V  +  D      +  L +  +  +  +  +  E
Sbjct: 116 HVVKMGIKDFKFGEQLGDGSYSSV--VLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVE 173

Query: 73  VDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEA 132
             A++ L   + ++    +   ++++Y        L+E+   G  +  +  +    L E 
Sbjct: 174 KLALQKLNGTKGIIRLFFTFQDEASLY-------FLLEYASHGDFLGLI--KKYGSLNEK 224

Query: 133 EILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQ 192
                 S     + ++H +   ++HRDIK EN+L+ ++ + K+ DFG+   +   P N  
Sbjct: 225 CARYYASQIIDAVDSLHAI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNA 282

Query: 193 E----FNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
           +    F+          TA+Y SPE+L+ S     + + DIWA G  LY++     PF K
Sbjct: 283 DGKPCFDLYARSKSFVGTAEYVSPELLNDSY---TDSRCDIWAFGCILYQMVAGKPPF-K 338

Query: 249 NGGEAAILQ--ARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
              E    Q   + QY     +    K+L++ +L + P+DR  V Q+   V
Sbjct: 339 AANEYLTFQKVMKIQYAFTAGFPLIAKDLVKKLLVREPNDRLTVEQIKAHV 389

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 127/293 (43%), Gaps = 20/293 (6%)

Query: 7   ETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSL 66
           E F    I+  G    K    L  G Y+QV+ +  S +D      +  L +  +  +  +
Sbjct: 103 EIFRRQTIIRKGIKDFKFGDMLGDGSYSQVF-LATSKTDSSKTYAVKVLNKEYLIKQKKV 161

Query: 67  NTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQ 126
             +  E  A++ LK+   V++        S  +     ++ L+E+   G  +  +  +  
Sbjct: 162 KYVNIEKTALQNLKSVTGVINL-------SFTFQDEANLYFLLEYAPNGDFLSLI--KKF 212

Query: 127 HRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVR 186
             L E   +   +     I +MH     ++HRDIK EN+L+  N + K+ DFG+   + +
Sbjct: 213 GTLNEECTIYYSAQIIDAIGSMH--SHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQK 270

Query: 187 PP-KNQQ-EFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTT 244
              KN +  +N +        TA+Y SPE+L  +     + K DIWA G  +Y++     
Sbjct: 271 KSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY---TDYKCDIWAFGCLVYQMIAGKP 327

Query: 245 PFEKNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           PF K   E    Q   + Q+     +   +++L++ +L K P  R  + Q+ E
Sbjct: 328 PF-KATNEYLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKE 379

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 125/283 (44%), Gaps = 41/283 (14%)

Query: 26  KYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHV 85
           K L +G +  V +   S +D  +   I  LKR +  D+  LN L  E+  ++ L ++ H+
Sbjct: 58  KTLGAGAFGVVRQARNSNNDEDVAVKI-LLKRALKGDE--LNMLYDELMILQKL-DHPHI 113

Query: 86  VSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGI 145
           V + D   SK   Y       ++ +    G L D +  +   R TE + + I+    + I
Sbjct: 114 VKFKDWFESKDKFY-------IVTQLATGGELFDRILKK--GRFTETDAVKIVVQMLEAI 164

Query: 146 AAMHRLQPALLHRDIKIENVLI---SQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIM 202
             MH     ++HRD+K ENVL    S ++E  + DFG    I +   ++       H I 
Sbjct: 165 EYMH--SKNVVHRDLKPENVLYLNPSDDSELVISDFG----IAKQLSSED------HLIH 212

Query: 203 KNTTAQ-YRSPEMLDLS-KGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ--- 257
           +   +  Y +PE+L  S  G P     DIW+LGV  Y L    +PF     E  + +   
Sbjct: 213 RAAGSMGYVAPEVLTTSGHGKP----CDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTR 268

Query: 258 ----ARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
                 F  P +   S   K  I   L+ +PS+RP   ++L++
Sbjct: 269 SKYPVTFHKPYWNSISVEAKEFILKALTLDPSERPTATELLQD 311

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 97/207 (46%), Gaps = 32/207 (15%)

Query: 98  IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
           ++    E+++++E+ E G L D++ SR   +L E E +       QG++  H     + H
Sbjct: 135 VWENKPELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICH 190

Query: 158 RDIKIENVLISQNN-EYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA---QYRSPE 213
           RD+K EN+L+ + N   K+ DFG                    D +  T+     Y SPE
Sbjct: 191 RDLKPENLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPE 237

Query: 214 MLDLSK--GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ---ARFQYPSYPMY 268
           ++   K  G P    SD+W+ G+ L+ L     PF  +  +  +L+    ++Q P     
Sbjct: 238 IVMGQKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--I 291

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           S+  K+LI  +L  +P+ R  + +VLE
Sbjct: 292 SNEAKDLIAKILIVDPAMRITIDEVLE 318

>KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} similar
           to uniprot|P53104 Saccharomyces cerevisiae YGL180W ATG1
           Protein serine/threonine kinase required for autophagy
           and for the cytoplasm-to-vacuole targeting (Cvt) pathway
          Length = 873

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/380 (22%), Positives = 166/380 (43%), Gaps = 81/380 (21%)

Query: 24  VIKYLTSGGYAQVYKVEISPSDPYINSNIA--CLKRVIVPDKPSLNTLRAEVDAMKLLKN 81
           V K +  G +A VYK  ++ +  + N  IA   + R  + +K  L  L  E+  +K +K+
Sbjct: 22  VEKEIGKGSFATVYKGRLAANQDHNNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKIKH 81

Query: 82  NRHVVSYIDSHASKSAIYNGAYEVFVLMEFC----------ERGGLIDFMNSRLQHRLTE 131
             H+V  +D   + S       + F++ME+C          +RGGLI+      +H L  
Sbjct: 82  P-HIVGLMDCERTGS-------DFFLIMEYCALGDLTFLIKKRGGLIE------KHPLVR 127

Query: 132 AEI---------------LTIMSHTSQGIAAMHRLQPA-LLHRDIKIENVLISQ-----N 170
                             + ++S+  Q  +A+  L+   L+HRDIK +N+L+S      +
Sbjct: 128 TMFEKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVGYD 187

Query: 171 NEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ--------YRSPEMLDLSKGLP 222
           +       G V GI   P  +   +F +   + NT+          Y +PE+L+  K   
Sbjct: 188 DRETFHKMGYV-GIYNLPILKIA-DFGFARFLPNTSLAETLCGSPLYMAPEILNYQK--- 242

Query: 223 INEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQAR-----FQYPSYPMYSDRLKNLIR 277
            N K+D+W++G  LY++C    PF+ +       + +       +PS+     +++ LI 
Sbjct: 243 YNAKADLWSVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPSHCNIEPKMRELIC 302

Query: 278 VMLSKNPSDRPNVCQVL------EEVSRLQGIPCPIRNFYLLRAMENNKRTIEQPVQNVY 331
            +L+ +PS R    +        E++SR +    P         +EN  + + +   N++
Sbjct: 303 GLLTFDPSQRMGFSEFFGNEIVNEDLSRYEEEHIP--------DLENKSKDVAE--SNMF 352

Query: 332 MPTTLSQPSTQMNLASLNDT 351
           +   L++P+  + +  LN+ 
Sbjct: 353 ISEYLTKPTKTVFMEPLNEV 372

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 96/208 (46%), Gaps = 27/208 (12%)

Query: 106 FVLMEFCERGGLIDFMNSRLQH-RLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++L E+   G L+D++   +QH  L E          +  +  +H     ++HRD+KIEN
Sbjct: 179 YMLFEYVSGGQLLDYI---IQHGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIEN 233

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP-I 223
           ++IS + E K+ DFG +  +  P K    F    +         + +PE+L   K  P I
Sbjct: 234 IMISTSGEIKIIDFG-LSNMYDPKKQLHTFCGSLY---------FAAPELL---KAHPYI 280

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQARFQYPSYPMYSDRLKNLIRVML 280
             + D+W+ GV LY L     PF+          I Q + +YP +   S  + +L+  ML
Sbjct: 281 GPEVDVWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIEVISLLSKML 338

Query: 281 SKNPSDRPNVCQVL--EEVSRLQGIPCP 306
             +PS R  + QV+  + + R    P P
Sbjct: 339 VVDPSKRATLKQVVSHQWMQRGYDFPAP 366

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 133/300 (44%), Gaps = 60/300 (20%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFC 112
           +++++ P  D  S++    E+D  +  K+  +++  +DS   +    +G+  V +L+ + 
Sbjct: 88  VRQIMCPFGDIESVSNALKEIDNYRYFKSP-YIMQCLDSQVIQRR--DGSKTVLILLPYL 144

Query: 113 ERGGLIDFMNSRLQH--RLTEAEILTIMSHTSQGIAAMH----------RLQP------- 153
             G L D ++  L    R++E+E++ +M  T +G+  +H           + P       
Sbjct: 145 PLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAV 204

Query: 154 --------ALL----------------------HRDIKIENVLISQNNEYKVCDFGSVCG 183
                   A+L                      H +IK  N+L S +    + + GS+  
Sbjct: 205 SMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQK 264

Query: 184 IVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYT 243
           +    +N +    +     ++ T  Y  PE+L+L  G  ++   DIW+LG  LY L +  
Sbjct: 265 LDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGI 324

Query: 244 TPF--EKNGGEA----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297
           +PF  E+   E      I +AR+ +P   +YS +L ++I   L  NP+ RP V ++L ++
Sbjct: 325 SPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12003 Saccharomyces cerevisiae
           YPL236c
          Length = 399

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 7/151 (4%)

Query: 157 HRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLD 216
           H+ +   N++ S N    + + GS        K  ++ N +   +  N  + Y +PE LD
Sbjct: 249 HKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNS-YMAPEFLD 307

Query: 217 LSKGLPINEKSDIWALGVFLYKLCYYTTPFEKN----GGEA--AILQARFQYPSYPMYSD 270
           L     ++ K D+W+ G   Y L +   PFE+     G     AI   +F +PS   YSD
Sbjct: 308 LKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSD 367

Query: 271 RLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQ 301
            + ++IR  L  +PS+RP+V  VL  + +LQ
Sbjct: 368 SILDIIRSCLQVDPSERPSVSIVLNNLQQLQ 398

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (47%), Gaps = 11/191 (5%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++ L+E+   G  +  M  +    L E       +    GI  +HR    ++HRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLHRH--GIIHRDIKPEN 333

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L+ ++ + K+ DFG+   + R     +E++          TA+Y SPE+L+ S    ++
Sbjct: 334 ILLDKSMKVKLTDFGTAKLLNR-KDGTEEYDLTTRSKSFVGTAEYVSPELLNDSW---VD 389

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSK 282
            K DIWA G  L+++     PF K   E    Q   + QY     +   +++L++ +L K
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPF-KATNEYLTFQKVMKVQYAFTAGFPMVVRDLVKQILVK 448

Query: 283 NPSDRPNVCQV 293
            P  R  + Q+
Sbjct: 449 KPEHRLTIPQI 459

>AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAR019C
           (CDC15)
          Length = 902

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 126/280 (45%), Gaps = 42/280 (15%)

Query: 21  HAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLK 80
           H  + + +  G Y  VYK     +D      +  +K +   ++  L+    E+D   LLK
Sbjct: 18  HYALKQVIGKGAYGVVYKAVNRATD-----QVIAIKAIEYENEEELHEHMLEID---LLK 69

Query: 81  NNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIM 138
           N +H  +V Y             ++E+++L+E+C RG L D +    +  L+EA+  T +
Sbjct: 70  NLKHENIVKY-------HGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKAKTYV 119

Query: 139 SHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVY 198
             T +G+  +H     ++HRDIK  N+L+++N   K+ DFG     V    N     +  
Sbjct: 120 RQTLRGLQYLH--DQGVIHRDIKAANLLLTENGVVKLADFG-----VSTRVNNMAMTYA- 171

Query: 199 HDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AI 255
                  +  + +PE++ L KG   +  SDIW+LG  + +L     PF     EA   AI
Sbjct: 172 ------GSPNWMAPEVM-LGKG--ASTVSDIWSLGATVVELLTGNPPFYNLVNEAACYAI 222

Query: 256 LQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           +   +  P +   S   K  + +   KN   RP   Q+L+
Sbjct: 223 VNDVYYPPEH--LSAECKAFMELCFQKNMFKRPQAHQLLQ 260

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 122/267 (45%), Gaps = 26/267 (9%)

Query: 31  GGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVSYID 90
           G +  VYK   + +  Y+   +  L+         ++ L  E+  +  LK++ ++++YI 
Sbjct: 25  GNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHR 150
           +     +++       ++M++C  G   D +     + + E ++  I+ +   G+  +H 
Sbjct: 80  TIMEDVSMW-------IVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHE 132

Query: 151 LQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYR 210
            +   +HRDIK  N+L++ + + K+ DFG V G ++    +  F           T  + 
Sbjct: 133 QKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV---------GTPYWM 180

Query: 211 SPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS--YPMY 268
           +PE+++       +EK DIW+LG+  Y+L     P  K      +     + P   +  Y
Sbjct: 181 APEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPY 240

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           +D  K+ I   L K+P  RPNV  +L+
Sbjct: 241 NDFTKSFISFCLIKDPKLRPNVQNLLK 267

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 108/238 (45%), Gaps = 35/238 (14%)

Query: 23  KVIKYLTSGGYAQVYKVEISPSDPYIN---------SNIACLKRVIVPDKPSLNTLRAEV 73
           ++++    G    VY  E     PY +          N   +K++I+  +P    +  E+
Sbjct: 589 RMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVNEI 648

Query: 74  DAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFM-----NSRLQHR 128
             MK  K+N ++V++++++           +++V+ME+ E G L D +      S  Q  
Sbjct: 649 LVMKDSKHN-NIVNFLEAYLKTED------DLWVVMEYMEGGSLTDIIENSPTGSSGQSP 701

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           LTE +I  I+  T QG+  +H     ++HRDIK +NVL+      K+ DFG    +    
Sbjct: 702 LTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRGRVKITDFGFCAKLTD-- 757

Query: 189 KNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
           K  +    V        T  + +PE++   K    +EK D+W+LG+   ++     P+
Sbjct: 758 KRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPY 805

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 120/281 (42%), Gaps = 48/281 (17%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL++  +V+S  D   + S +Y       +++E+ E+G L + +  R    
Sbjct: 77  IEREIIIMKLLRHP-NVLSLYDVWETNSKLY-------MILEYAEKGELFNLLVER--GP 126

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKLNIKIADFGMAA------ 178

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D M  T+     Y +PE++    G+P +  +SD+W+ GV L+ L     
Sbjct: 179 -------LETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGRL 228

Query: 245 PFEKNGGEAAILQARFQYPSYPMYSD-----RLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299
           PF++  G    L  + Q   Y M  D       ++LI  +L+ +P  R     +L+    
Sbjct: 229 PFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKH-PL 287

Query: 300 LQGIP----------CPIRNFYLLRAMENNKRTIEQPVQNV 330
           LQ  P           P  + YL    ENN    +  +QN+
Sbjct: 288 LQKYPSIKDSRSIKNLPREDTYLYPLSENNSIIDDSILQNL 328

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 94/195 (48%), Gaps = 19/195 (9%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRL-QPALLHRDIKIE 163
           ++ L+E+   G  +  M      R           + +Q + A+H L +  ++HRD+K E
Sbjct: 276 LYFLLEYAPNGDFLSVMK-----RFGTLSEECTKYYGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 164 NVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPI 223
           N+L+ +  + K+ DFG+   I R  +N + ++          TA+Y SPE+L+ +    +
Sbjct: 331 NILLDKTMKIKLTDFGTAKLIGREDEN-KPYDLNTRSKSFVGTAEYVSPELLNDNY---V 386

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA--RFQY---PSYPMYSDRLKNLIRV 278
           + + DIWA G  L+++     PF K   E    Q   R QY     +PM    L++LI+ 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPF-KATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQ 442

Query: 279 MLSKNPSDRPNVCQV 293
           +L K P  R  + Q+
Sbjct: 443 LLVKKPEQRLTILQI 457

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 94/193 (48%), Gaps = 20/193 (10%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           V++++E+C    L + +    + RL+  E   + S  +  +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           VL+  N   K+ DF    G  R    + +   +        T  Y +PE+++  +     
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETIC------GTTVYMAPELIE--RKCYDG 206

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGG---EAAILQARFQYPSYPMYSDRLKNLIRVMLS 281
            K DIW+LG+ LY +     PF+++     +  I+     + +    SD   +LI+ ML 
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGMLR 265

Query: 282 KNPSDRPNVCQVL 294
           KNP++R ++ QVL
Sbjct: 266 KNPNERISLAQVL 278

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/347 (23%), Positives = 150/347 (43%), Gaps = 48/347 (13%)

Query: 12  GQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRV--IVPDKPSLNTL 69
           G+ L +GS     ++   +G   Q   V++     +   N++    V    PD       
Sbjct: 22  GETLGLGSTGK--VQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIE 79

Query: 70  RAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
           R E+  MKLL N+ +V+   D       ++    ++++++E+ E+G L + +  R    L
Sbjct: 80  R-EIIIMKLL-NHPNVLRLYD-------VWETNTDLYLVLEYAEKGELFNLLVER--GPL 128

Query: 130 TEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPK 189
            E E +        G++  H L   ++HRD+K EN+L+      K+ DFG          
Sbjct: 129 PEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAAL------ 180

Query: 190 NQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTTPFEK 248
            + E   +        +  Y +PE++    G+P     SD+W+ GV L+ L     PF++
Sbjct: 181 -ETEGKLLETSC---GSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLPFDE 233

Query: 249 NGGEAAIL-----QARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGI 303
             G    L     +  F+ PS    S   ++LIR +L+ +P  R     +L+    LQ  
Sbjct: 234 EDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH-PLLQKY 292

Query: 304 PCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLND 350
           P  IR+   +R +         P ++ Y+ T LS+ ++ ++   L +
Sbjct: 293 PS-IRDSKSIRGL---------PREDTYL-TPLSESNSSIDATILQN 328

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 106/236 (44%), Gaps = 37/236 (15%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL N+ +V+   D       ++    ++++++E+ E+G L + +  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFD-------VWETNSDLYLVLEYAEKGELFNMLVER--GP 125

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA------ 177

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE++    GLP     SD+W+ GV L+ L     
Sbjct: 178 -------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 245 PFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           PF++  G        + +  F+ P     +   ++L+  +L+ +PS R  + ++L+
Sbjct: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 91/176 (51%), Gaps = 26/176 (14%)

Query: 73  VDAMKLLKNNRH--VVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLT 130
           V+ + ++K +RH  +V++IDS+       NG   ++V+ME+ + G L D +   +   LT
Sbjct: 608 VNEILVMKASRHENIVNFIDSY-----FLNG--NLWVIMEYMKGGSLTDVVTHCI---LT 657

Query: 131 EAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
           E +I T+   T  G+  +H     ++HRDIK +NVL+S + + K+ DFG    I      
Sbjct: 658 EQQISTVTRETLNGLRFLH--SKGVIHRDIKSDNVLLSLSGDIKLTDFGFCAQI------ 709

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             E N     ++   T  + +PE++   +  P   K DIW+LG+ + ++     P+
Sbjct: 710 -NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 759

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 96/206 (46%), Gaps = 25/206 (12%)

Query: 106 FVLMEFCERGGLIDFMNSRLQH-RLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++L E+   G L+D++   +QH  L E          +  +  +H     ++HRD+KIEN
Sbjct: 201 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGVASALQYLHANN--IVHRDLKIEN 255

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP-I 223
           ++IS + E K+ DFG +  +    K    F           +  + +PE+L   K  P I
Sbjct: 256 IMISTSGEIKIIDFG-LSNVFDTRKQLHTF---------CGSLYFAAPELL---KANPYI 302

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQARFQYPSYPMYSDRLKNLIRVML 280
             + DIW+ GV LY L     PF+          I Q + +YP++   S  + +L+  ML
Sbjct: 303 GPEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKML 360

Query: 281 SKNPSDRPNVCQVLEEVSRLQGIPCP 306
             +P  R N+ +V+E    ++G   P
Sbjct: 361 VVDPLKRANLTKVIEHPWMIRGYDFP 386

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 96/220 (43%), Gaps = 49/220 (22%)

Query: 92  HASKSAIYNGAYE---VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAM 148
           H + + +Y   Y+   V++LME+   G L  F+ +     L E      +   +  +  M
Sbjct: 157 HKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKN--NGPLNETLASYFVYQMANALDYM 214

Query: 149 HRLQPALLHRDIKIENVLISQNNEYKVCDFG------------SVCGIVRPPKNQQEFNF 196
           H     +LHRDIK EN+LI  NN  K+ DFG            ++CG             
Sbjct: 215 H--SKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTLCG------------- 259

Query: 197 VYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA-- 254
                    T  Y SPE++   K    N K D+WALGV  Y+L   + PFE++  E    
Sbjct: 260 ---------TIDYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDTKEMTYR 307

Query: 255 -ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            IL+   ++P     S + ++LI  +L   PS R  + +V
Sbjct: 308 RILRCDLKFPL--NVSPQARDLIVRLLQFEPSKRIPLSEV 345

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 102/242 (42%), Gaps = 44/242 (18%)

Query: 66   LNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERG 115
            L T+ +E+  M  L    H  ++  ID        Y        +G  ++F L+EF    
Sbjct: 1086 LGTIPSEIQIMYTLNRKPHDNILRMIDFFEDDQYYYLETPVHGESGCIDLFDLIEF---- 1141

Query: 116  GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
                      +  +TE E   I    + G+  +H L   ++HRDIK ENV+I      K+
Sbjct: 1142 ----------RTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKGYVKI 1189

Query: 176  CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGV 234
             DFGS   +   P +     FV        T  Y +PE+L    G P   K  DIWALG+
Sbjct: 1190 IDFGSAAYVKNGPFDV----FV-------GTIDYAAPEVL---AGNPYEGKPQDIWALGI 1235

Query: 235  FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
             LY + +   PF  N  E  I++    + +    +     LI+ ML K    RP++ +V 
Sbjct: 1236 LLYTIIFKENPF-YNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVF 1292

Query: 295  EE 296
             +
Sbjct: 1293 SD 1294

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 110/225 (48%), Gaps = 20/225 (8%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E + ++ L + R V+    +   ++++Y        L+E+   G   DF++  +  +   
Sbjct: 206 EKNTLQRLNDGRGVIKLYFTFQDEASLY-------FLLEYAPNG---DFLS--VIKKFGS 253

Query: 132 AEILTIMSHTSQGIAAMHRLQ-PALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
                 + +++Q + A+  L    ++HRDIK EN+L+ ++ + K+ DFG+   I+   + 
Sbjct: 254 LSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGT-ARILEKDET 312

Query: 191 QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNG 250
            Q FN +        TA+Y SPE+L+ +    ++ K DIWA G  L+++     PF K  
Sbjct: 313 TQTFNLLERSKSFVGTAEYVSPELLNDNY---VDYKCDIWAFGCILFQMIAGKPPF-KAT 368

Query: 251 GEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
            E    Q   + QY     +   +++LI+ +L K+P  R +  Q+
Sbjct: 369 NEYLTFQKVMKVQYAFTAGFPLVIRDLIKKILVKSPEQRLDASQI 413

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 91/193 (47%), Gaps = 15/193 (7%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D +     + + E ++  I S   +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L++     K+ DFG V G +R    +  F           T  + +PE++   +    +
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTF---------VGTPYWMAPEVVS-KENDGYD 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPS--YPMYSDRLKNLIRVMLSK 282
           EK+DIW+LG+ +Y+L     P  K      ++    + P   +  YS   KN +   L K
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 283 NPSDRPNVCQVLE 295
           NP  R +  +++E
Sbjct: 253 NPVGRASAYEMVE 265

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 99/207 (47%), Gaps = 32/207 (15%)

Query: 98  IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
           ++    E+++++E+ + G L D++ S+   +LTE E +       +G+   H     + H
Sbjct: 228 VWENKNELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICH 283

Query: 158 RDIKIENVLISQNNEY-KVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA--QYRSPEM 214
           RD+K EN+L+ +  +  K+ DFG     V             + ++K +     Y SPE+
Sbjct: 284 RDLKPENLLLDKKRKLIKIADFGMAALQVS------------NTLLKTSCGSPHYASPEI 331

Query: 215 LDLSK---GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQ---ARFQYPSYPMY 268
           + + K   G P    SD+W+ G+ L+ L     PF  +  +  +++    R+Q P+Y   
Sbjct: 332 V-MGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--L 384

Query: 269 SDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           S   K+LI  +L  NP  R    Q+LE
Sbjct: 385 SKDAKDLISRILLVNPKARLTTEQILE 411

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 111/241 (46%), Gaps = 41/241 (17%)

Query: 98  IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
           + N  Y + +++E+   G    ++  +   RL E     + +    G+  MH     L+H
Sbjct: 117 LQNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMH--SKGLVH 171

Query: 158 RDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ--YRSPEML 215
           RD+K+EN+L+ +N    + DFG V           EFN   +++MK +     Y +PE++
Sbjct: 172 RDLKLENLLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELV 220

Query: 216 DLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKN-----GGEAA-----ILQARFQYPSY 265
             +K      K+DIW+ GV +Y +     P++ +     G + A     I +   ++P Y
Sbjct: 221 VTTKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEY 279

Query: 266 --PMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCPIRNFYLLRAMENNKRTI 323
             P+  D    L+R +L  NP  R N+ QV E+   LQ   CP    +L    E   RT+
Sbjct: 280 INPVPRD----LLRRILVSNPKKRLNLRQV-EQHQWLQPH-CP----FLTITPEEWDRTL 329

Query: 324 E 324
           E
Sbjct: 330 E 330

>KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.192
           YGR052W
          Length = 438

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 102/231 (44%), Gaps = 37/231 (16%)

Query: 25  IKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNR- 83
           IK L +G ++ VYK   S  + Y+        +V+  DK S   +  E+  M+ L N   
Sbjct: 11  IKKLQTGTFSTVYKAWSSERNEYV------ALKVMPKDKISEEAMLNEIKVMQKLGNTHP 64

Query: 84  HVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQH------RLTEAEILTI 137
           ++ S +  H  +S          + +++CE G + DF++   Q        L + +   I
Sbjct: 65  NICSMLSFHEDESC-------CILELQYCECGDMYDFLDIAKQQGDPVSPSLLQLDFQNI 117

Query: 138 MSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFV 197
           ++     +   H L   + HRDIK ENVL+++    K+ D+G      R      EFN  
Sbjct: 118 VNQLFSAVQYAHSL--GIAHRDIKPENVLLTKEGNVKLADWGHGTFDSR----SYEFNI- 170

Query: 198 YHDIMKNTTAQYRSPEMLDLSKGL-PINEKSDIWALGVFLYKLCYYTTPFE 247
                   T  YRSPE      G  P+   +D W++GV L  L + TTPF+
Sbjct: 171 -------GTDHYRSPETFYSEDGYDPV--LADYWSVGVTLLFLIFGTTPFK 212

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 91/196 (46%), Gaps = 23/196 (11%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           ++++ME+C  G   D +     + L E ++  I+   + G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L+++    K+ DFG V G +R    +  F           T  + +PE++   +    N
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV---------GTPYWMAPEVV-CCEVDGYN 195

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQA------RFQYPSYPMYSDRLKNLIRV 278
           EK+DIW+LG+  Y+L     P  K      +         + Q P    +SD  K+ +  
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDFVAG 251

Query: 279 MLSKNPSDRPNVCQVL 294
            L K P+DRP+   +L
Sbjct: 252 CLVKTPADRPSAYNLL 267

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 105/218 (48%), Gaps = 27/218 (12%)

Query: 85  VVSYIDSHASKSA---IYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHT 141
           V+  + SHA+  A   ++    E+++++E+ + G L D++ S+   +L E E +      
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQI 223

Query: 142 SQGIAAMHRLQPALLHRDIKIENVLISQNN-EYKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
            +G++  H     + HRD+K EN+L+ + N + K+ DFG +  +  P K           
Sbjct: 224 VEGVSFCHSFN--ICHRDLKPENLLLDKKNRKIKIADFG-MAALELPNK----------- 269

Query: 201 IMKNTTA--QYRSPEMLDLSKGLPINEK-SDIWALGVFLYKLCYYTTPFEKNGGEAAILQ 257
           ++K +     Y SPE++    G P +   SD+W+ G+ L+ L     PF  +  +  +L+
Sbjct: 270 LLKTSCGSPHYASPEIV---MGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLK 326

Query: 258 ARFQYPSYPM-YSDRLKNLIRVMLSKNPSDRPNVCQVL 294
            +      PM  S   ++LI  +L  NP  R    ++L
Sbjct: 327 VQSGKYQMPMNLSAEARDLISKILVINPEKRITTQEIL 364

>KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3.177
           YAR019C
          Length = 980

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 98/219 (44%), Gaps = 30/219 (13%)

Query: 28  LTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRHVVS 87
           +  G Y  VYK  ++ S       +  +K +       LN +  E+D +K    N H ++
Sbjct: 37  IGKGSYGIVYKA-VNKS----TKQVVAIKEINYTSDEELNEIMIEIDLLK----NLHHIN 87

Query: 88  YIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAA 147
            +  H     + N    +++++E+   G L   ++SR+ H L EAE    +  T  G+A 
Sbjct: 88  IVKYHGFIQKMSN----LYIILEYAAHGSLKGLLSSRIGHLLDEAETKIYVRQTLDGLAY 143

Query: 148 MHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTA 207
           +H  +  ++HRDIK  N+L+   N  K+ DFG    +    K                + 
Sbjct: 144 LH--EQGVIHRDIKAANLLLDSTNTVKLADFGVSTKVNNTAKTLA------------GSL 189

Query: 208 QYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246
            + +PE++  +KG   +  SDIW+LG  + +L     PF
Sbjct: 190 NWMAPEIVT-NKG--ASTLSDIWSLGATIVELMTGKPPF 225

>Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 114/241 (47%), Gaps = 23/241 (9%)

Query: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60
           +  PQ  T  + + +++  ++ ++I++L  G Y  V  V+    +P   + IA  K   +
Sbjct: 18  LGDPQQRTIFAKERISIPGYY-EIIQFLGKGAYGTVCSVKFKGQNP--PAKIAVKKISNI 74

Query: 61  PDKPSL--NTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLI 118
            +K  L    +R E+  M   K ++++V+ ID     S+ Y+G Y        C +  LI
Sbjct: 75  FNKEILLKRAIR-ELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLY--------CYQE-LI 124

Query: 119 DFMNSRLQH---RLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
           D+  +++ H   +L+E  I   +     G+  +H     ++HRD+K  N+L + N   K+
Sbjct: 125 DYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKI 182

Query: 176 CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVF 235
           CDFG   GI      Q       H      T  YR+PE+L  ++  P N+  DIWA+G  
Sbjct: 183 CDFGLARGI-HAGFFQCHSTIQPHITNYVATRWYRAPELLLSNQ--PYNKSVDIWAVGCI 239

Query: 236 L 236
           L
Sbjct: 240 L 240

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 130/312 (41%), Gaps = 57/312 (18%)

Query: 7   ETFPSGQILTVGSHHA-------KVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVI 59
           ET  +  + T+G+          +V+  L  G Y QV  V+   ++ ++       +R++
Sbjct: 85  ETLLTADVSTLGARKRVKKFSDYEVVLELGQGAYGQVSLVQNKSTEEFLILKKIFKERIL 144

Query: 60  ----VPDKPSLNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIY---------NGAYE 104
               V D+    T+ +E+  +  L    H  VVS ID        Y         +G  E
Sbjct: 145 LDTWVRDR-KYGTVPSEIHILTKLTELPHDNVVSMIDFFEDDDFYYVEMPIHGQGDGCIE 203

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           +F            DF++ R    +++ E   I+      I  +H     ++HRDIK EN
Sbjct: 204 LF------------DFIDIR--DEVSDWECKLIIKQLVSAIKYLH--DRDIVHRDIKDEN 247

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP-I 223
           +++      ++ DFGS    VR P       F+        T  Y  PE+   ++G P +
Sbjct: 248 IIMDARGHIQLIDFGSATNAVRGPFR----TFL-------GTIDYEPPEV---ARGEPFL 293

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKN 283
            +  DIWALG+ LY L +   PF     + AIL    ++P     +    +LI  +LS  
Sbjct: 294 GKPQDIWALGILLYILRFKEPPFLD---QKAILTGDLKFPQGTSVNTDCIDLINAILSPR 350

Query: 284 PSDRPNVCQVLE 295
             +RP +  ++E
Sbjct: 351 VDERPTIDDIVE 362

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 92/193 (47%), Gaps = 18/193 (9%)

Query: 105 VFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIEN 164
           V++ +E+C    L D++   L+ R+   E   + +     +   H LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPIN 224
           +L+ +N    + DF    G  R    + +   V        T  Y +PE+  + +     
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETVC------GTTVYMAPEL--IKREAYDG 206

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARFQYPSY--PMYSDRLKNLIRVMLSK 282
            K D W+LG+ LY + +   PF+++      L+   + P+      S + K+LI  +L K
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLDK 266

Query: 283 NPSDRPNVCQVLE 295
           N + RPN+ +VL+
Sbjct: 267 NAAQRPNLNEVLQ 279

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 103/228 (45%), Gaps = 37/228 (16%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL N+ +V+   D   + S++Y       +++E+ E+G L + +  R    
Sbjct: 84  IEREIIIMKLL-NHPNVLRLYDVWETNSSLY-------MVLEYVEKGELFNLLVDR--GP 133

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG         
Sbjct: 134 LPENEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA------ 185

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE++    GLP +  +SD+W+ G+ L+ L     
Sbjct: 186 -------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRL 235

Query: 245 PFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDR 287
           PF++  G        +   +F+ P     S   ++LI  +L+ +P+ R
Sbjct: 236 PFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAAR 283

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 107/236 (45%), Gaps = 37/236 (15%)

Query: 69  LRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHR 128
           +  E+  MKLL++  +V+S  D   + S +Y       +++E+ E+G L + +  +    
Sbjct: 81  IEREIIIMKLLRH-ANVLSLYDVWETNSNLY-------MILEYAEKGELFNLLVEK--GP 130

Query: 129 LTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPP 188
           L E E +        GI+  H L   ++HRD+K EN+L+      K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 189 KNQQEFNFVYHDIMKNTTA---QYRSPEMLDLSKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE++    G+P +  +SD+W+ GV L+ L     
Sbjct: 183 -------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 245 PFEKNGGEA-----AILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           PF++  G        +   +F+ P     S   ++LI  +L+ +P+ R    ++L+
Sbjct: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 108/244 (44%), Gaps = 62/244 (25%)

Query: 80  KNNRHVVSYIDSHASKSAIY-NGAYEVFV-------LMEFCERGGLIDFMNSRLQHRLTE 131
           KN+ +VV  +  H     +Y    YEV V        +E+C    L +++   ++ R+  
Sbjct: 70  KNDPNVVREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYL--LIKKRIPL 127

Query: 132 AEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG------------ 179
            E   + S     +   H ++   +HRD+K+EN+L+ +  + K+ DFG            
Sbjct: 128 DECSHLFSQIVGAVFYAHSMK--CVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILE 185

Query: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLS--KGLPINEKSDIWALGVFLY 237
           +VCG                      T  Y +PE+++    +G  I    D W+LG+ LY
Sbjct: 186 TVCG----------------------TTVYMAPELIERKPYEGYKI----DTWSLGIILY 219

Query: 238 KLCYYTTPFEKNGGEAAILQARFQYP-SYPMYSDRL-----KNLIRVMLSKNPSDRPNVC 291
            + +   PF+    E   ++ +++   + P Y D       K+LI  +L K+PS RP++ 
Sbjct: 220 TMIHGAMPFD----EEDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLT 275

Query: 292 QVLE 295
           QVL+
Sbjct: 276 QVLQ 279

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 105/222 (47%), Gaps = 35/222 (15%)

Query: 85  VVSYIDSHASKSAIYN---GAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHT 141
           V+  + SHA+   +Y       E+++++E+ + G L D++ SR   RL E E +      
Sbjct: 168 VIMKLISHANVLGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQI 225

Query: 142 SQGIAAMHRLQPALLHRDIKIENVLISQNNE-YKVCDFGSVCGIVRPPKNQQEFNFVYHD 200
            QG++  H     + HRD+K EN+L+ + N   K+ DFG     V             + 
Sbjct: 226 IQGVSYCHAFN--ICHRDLKPENLLLDKKNSTIKIADFGMAALEVS------------NK 271

Query: 201 IMKNTTA--QYRSPEMLDLSK---GLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAI 255
           +++ +     Y SPE++ + K   G P    SD+W+ G+ L+ L     PF  +  +  +
Sbjct: 272 LLQTSCGSPHYASPEIV-MGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLL 326

Query: 256 LQ---ARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           L+    ++Q P     S   ++LI  +L+ NP+ R    ++L
Sbjct: 327 LKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEIL 366

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 100/239 (41%), Gaps = 44/239 (18%)

Query: 66   LNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIY--------NGAYEVFVLMEFCERG 115
            L T+ +E+  M  L    H  ++  +D        Y         G+ ++F L+EF    
Sbjct: 1168 LGTIPSEIQIMATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSN- 1226

Query: 116  GLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKV 175
                         +TE EI  +      G+  +H     ++HRDIK EN+++      K+
Sbjct: 1227 -------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGFIKI 1271

Query: 176  CDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEK-SDIWALGV 234
             DFGS   +   P +     FV        T  Y +PE+L    G P   K  DIWALG+
Sbjct: 1272 IDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVL---GGNPYEGKPQDIWALGI 1317

Query: 235  FLYKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQV 293
             LY + +   PF  N  E  IL+   ++      S     LI+++L++N   RP +  +
Sbjct: 1318 LLYTIVFKENPF-YNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTIDDI 1373

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 103/212 (48%), Gaps = 29/212 (13%)

Query: 106 FVLMEFCERGGLIDFMNSRLQH-RLTEAEILTIMSHTSQGI-AAMHRLQPA-LLHRDIKI 162
           ++  EF   G L+D++   +QH  L E     +    S+GI +A+  L    ++HRD+KI
Sbjct: 167 YMFFEFISGGQLLDYI---IQHGSLKENHARKV----SRGILSALQYLHANNIVHRDLKI 219

Query: 163 ENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLP 222
           EN+++S+  E K+ DFG +  +  P K+ Q F           +  + +PE+L   K  P
Sbjct: 220 ENIMLSKTGEIKLIDFG-LSNMYDPRKSLQTF---------CGSLYFAAPELL---KAHP 266

Query: 223 -INEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQARFQYPSYPMYSDRLKNLIRV 278
            +  + D+W+ GV LY L     PF+     A    I + +  YP +   S  + +L+  
Sbjct: 267 YLGPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQF--LSIDVISLLSK 324

Query: 279 MLSKNPSDRPNVCQVLEEVSRLQGIPCPIRNF 310
           +L  +P  R  + QV+     L+G   P +++
Sbjct: 325 ILVVDPQKRATLQQVVNHQWMLKGYDFPPQSY 356

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 99  YNGAY----EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPA 154
           Y G+Y    +++V+ME+C  G L   +      ++ E  +  I+      +  +H+    
Sbjct: 87  YYGSYLYDTKLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVRKLLIALVYIHKDN-- 141

Query: 155 LLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEM 214
           ++HRDIK  NVLI+     K+CDFG    +      +Q             T  + +PE+
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTM---------AGTPYWMAPEV 192

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPF-EKNGGEAAILQARFQYPSYPM--YSDR 271
             + +G+  N K+DIW+LG+  Y++     P+ +     A  L  + + P      YS  
Sbjct: 193 --IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPL 250

Query: 272 LKNLIRVMLSKNPSDRPNVCQVL 294
           LK  I + L ++P +RP    +L
Sbjct: 251 LKEFIALCLDEDPEERPTAEDLL 273

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 108/230 (46%), Gaps = 23/230 (10%)

Query: 72  EVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTE 131
           E  A++ L N+  VV    +   +S++Y        L+E+   G   DF++  L  +   
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESSLY-------FLLEYAPNG---DFLS--LMKKYGS 274

Query: 132 AEILTIMSHTSQGIAAMHRLQP-ALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKN 190
            +      + +Q I A+  L    ++HRDIK EN+L+    + K+ DFG+   ++ P  N
Sbjct: 275 LDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNN 333

Query: 191 ---QQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFE 247
              + E++          TA+Y SPE+L+ S     + + DIWA G  L+++     PF 
Sbjct: 334 SVSKPEYDLSTRSKSFVGTAEYVSPELLNDSF---TDYRCDIWAFGCILFQMIAGKPPF- 389

Query: 248 KNGGEAAILQA--RFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLE 295
           K   E    Q   + QY   P +   +++L++ +L KN   R  + Q+ E
Sbjct: 390 KATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439

>YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}
           TOS3Protein kinase, related to and functionally
           redundant with Elm1p and Sak1p for the phosphorylation
           and activation of Snf1p; functionally orthologous to
           LKB1, a mammalian kinase associated with Peutz-Jeghers
           cancer-susceptibility syndrome
          Length = 560

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 104 EVFVLMEFCERGGLIDFMNSRLQHRLTEAEILT------IMSHTSQGIAAMHRLQPALLH 157
           +V++++E+C RG +     ++++ +     ILT      ++     G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLH--SQGITH 187

Query: 158 RDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKN---TTAQYRSPEM 214
           RDIK  N+LIS N   K+ DFG          N Q     +  ++K+    T  + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQS---SHEQLLKSRALGTPAFFAPEL 244

Query: 215 LDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEA---AILQARFQYPSY 265
               K    +   DIW+LGV +Y L +   PF  N G     +I+    ++PSY
Sbjct: 245 CSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFPSY 298

>YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}
           CLA4Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family, along with Ste20p and
           Skm1p; involved in septin ring assembly, vacuole
           inheritance, cytokinesis, sterol uptake regulation;
           phosphorylates Cdc3p and Cdc10p
          Length = 842

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 103/209 (49%), Gaps = 31/209 (14%)

Query: 45  DPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNRH--VVSYIDSHASKSAIYNGA 102
           +P++   +A +K++++  +P    +   V+ + ++K++RH  +V++++++          
Sbjct: 584 EPHVGDKVA-IKQMVLSKQPRKELI---VNEILVMKDSRHKNIVNFLEAYLRTDD----- 634

Query: 103 YEVFVLMEFCERGGLIDFM-----NSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLH 157
            +++V+MEF E G L D +     N      LTE +I  I+  T QG+  +H     ++H
Sbjct: 635 -DLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKH--IIH 691

Query: 158 RDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDL 217
           RDIK +NVL+      K+ DFG    +    K  +    V        T  + +PE++  
Sbjct: 692 RDIKSDNVLLDTRARVKITDFGFCARLTD--KRSKRATMV-------GTPYWMAPEVV-- 740

Query: 218 SKGLPINEKSDIWALGVFLYKLCYYTTPF 246
            K    +EK D+W+LG+   ++     P+
Sbjct: 741 -KQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 24/240 (10%)

Query: 4   PQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRV--IVP 61
           PQ  T  + + +++  ++ ++I++L  G Y  V  V+     P   + IA +K++  I  
Sbjct: 29  PQERTIFAKERISIPGYY-EIIQFLGKGAYGTVCSVKFKGQTP--PAKIA-VKKISNIFN 84

Query: 62  DKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFM 121
            +  L     E+  M   K ++++V+ ID     S+ Y+G Y        C +  LID+ 
Sbjct: 85  KEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVSSSPYDGLY--------CYQE-LIDYD 135

Query: 122 NSRLQH---RLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDF 178
            +++ H   +L+E  I   +     G+  +H     ++HRD+K  N+L + N   K+CDF
Sbjct: 136 LAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDF 193

Query: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTA--QYRSPEMLDLSKGLPINEKSDIWALGVFL 236
           G   GI       Q  N      + N  A   YR+PE+L LS   P ++  DIWA+G  L
Sbjct: 194 GLARGIHTEFFQCQTTNSAVQPHITNYVATRWYRAPELL-LSNQ-PYDKAIDIWAVGCIL 251

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 132/297 (44%), Gaps = 51/297 (17%)

Query: 26   KYLTSGGYAQVYK-VEISPSDPYINSNIACLKRVIVPDKPSLN----TLRAEVDAMKLLK 80
            K++  G + +VY  V +   +      +  +K + + D  S+     +++ E++ +++L 
Sbjct: 1212 KFVGGGTFGEVYSAVNLDTGE------VLAVKEIKIQDSKSMEKIFPSIKEEMNVLEMLS 1265

Query: 81   NNRHVVSY-IDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMS 139
            +   V  Y ++ H  +  I+         ME+CE G L     S L+H   E E++T + 
Sbjct: 1266 HPNIVQYYGVEVHRDRVNIF---------MEYCEGGSLA----SLLEHGRIEDEMVTQVY 1312

Query: 140  --HTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVR----------P 187
                 +G+A +H  +  ++HRDIK EN+L+  N   K  DFG+   I +          P
Sbjct: 1313 TLQLLEGLAYLH--ESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMP 1370

Query: 188  PKNQQEFNFV-----YHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYY 242
             +N  E   V     ++DI+   T  Y +PE +  S         DIWALG  + ++   
Sbjct: 1371 DENDDENGKVVGRNNFNDII--GTPMYMAPEAITGSPKKGHLGADDIWALGCVVLEMITG 1428

Query: 243  TTPFEKNGGEAAILQ--ARFQYPSYPM---YSDRLKNLIRVMLSKNPSDRPNVCQVL 294
              P+     E AI+   A  Q P  P     S    + ++  L +NP+ R +  ++L
Sbjct: 1429 KRPWANLDNEWAIMYHVAAGQIPQLPTNDEVSPAGMHFLKRCLKQNPAQRASAVELL 1485

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 105/220 (47%), Gaps = 45/220 (20%)

Query: 91  SHASKSAIYNGAYE---VFVLMEFCERGGLI----------DFMNSRLQHRLTEAEILTI 137
           +H + + +Y   Y+   V+++ME+   G L           D + SR  +++ +A     
Sbjct: 210 NHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADA----- 264

Query: 138 MSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEFNFV 197
           ++H       +H  +  ++HRD+K EN+LI  NN  K+ DFG    I+ P   +++    
Sbjct: 265 LNH-------LH--EKGIIHRDLKPENILIGFNNVLKLTDFG--WSIINPKGVKRK---- 309

Query: 198 YHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAA--- 254
                   T  Y SPEM+   +    ++  D+WALGV  Y+L     PFE++  E     
Sbjct: 310 ----TLCGTIDYLSPEMI---RSREYDDTVDVWALGVLTYELVAGDPPFEEDSKELTYKR 362

Query: 255 ILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
           IL+   ++P     S  +++LI  +L  +P +R  + +V+
Sbjct: 363 ILKGEIRFPG--TVSQDVRDLISRLLKNDPKERILLKEVM 400

>KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} similar
           to uniprot|P53104 Saccharomyces cerevisiae YGL180W ATG1
           Protein serine/threonine kinase required for autophagy
           and for the cytoplasm-to-vacuole targeting (Cvt) pathway
          Length = 831

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 127/303 (41%), Gaps = 55/303 (18%)

Query: 24  VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSLNTLRAEVDAMKLLKNNR 83
           V K +  G +A VYK  +S  D   N  I  + R  + +K  L  L  E+  +K +K+  
Sbjct: 23  VEKEIGKGSFAVVYK-GLSLRDGR-NIAIKAVSRSKLKNKKLLENLEVEIAILKKIKH-P 79

Query: 84  HVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSH--- 140
           H+V  ID   + S  Y       ++ME+C  G L  F+  R    L    I T+  H   
Sbjct: 80  HIVGLIDCERTSSDFY-------LIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPP 132

Query: 141 ----------------TSQGIAAMHRLQPA-LLHRDIKIENVLISQ-----NNEYKVCDF 178
                             Q  +A+  L+   L+HRDIK +N+L+       N+     + 
Sbjct: 133 PSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHEL 192

Query: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTAQ--------YRSPEMLDLSKGLPINEKSDIW 230
           G V GI   P  +   +F +   + NT+          Y +PE+L+  K    N K+D+W
Sbjct: 193 GFV-GIYNLPILKIA-DFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLW 247

Query: 231 ALGVFLYKLCYYTTPFEKNGGEAAILQA------RFQYPSYPMYSDRLKNLIRVMLSKNP 284
           ++G  LY++C    PF K      + Q           PS      +L NLIR +L+ +P
Sbjct: 248 SVGTVLYEMCCGRPPF-KASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDP 306

Query: 285 SDR 287
             R
Sbjct: 307 DSR 309

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 119/279 (42%), Gaps = 51/279 (18%)

Query: 49   NSNIACLKRVIVPDKPSLN----TLRAEVDAMKLLKNNRHVVSY--IDSHASKSAIYNGA 102
            N  I  +K + + D  ++     +++ E+  +++L ++ +VV Y  ++ H  K  I+   
Sbjct: 1285 NGEILAVKEIKIQDANAMKKFFPSIKEEMSVLEML-SHPNVVQYYGVEVHRDKVNIF--- 1340

Query: 103  YEVFVLMEFCERGGLIDFMNSRLQHRLTEAEILTIMSHTS--QGIAAMHRLQPALLHRDI 160
                  ME+CE G     M S L+H   E E++T +      +G+A +H  Q  ++HRDI
Sbjct: 1341 ------MEYCEGGS----MASLLEHGRIEDEMVTQVYTLELLEGLAYLH--QSGVVHRDI 1388

Query: 161  KIENVLISQNNEYKVCDFGSVCGIVRPPKNQQEF--------------------NFVYHD 200
            K EN+L+  N   K  DFG+   I +   + + F                         D
Sbjct: 1389 KPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFARSVASDSSTGSADNTSEQDGLALQD 1448

Query: 201  IMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPFEKNGGEAAILQARF 260
            +M   T  Y +PE +  S         DIW+LG  + ++     P+ K   E AI+    
Sbjct: 1449 MMG--TPMYMAPESITGSPNKGRLGADDIWSLGCVILEMITGRRPWAKLDNEWAIMYHVA 1506

Query: 261  -----QYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVL 294
                 Q PS    S   K  +R  L +NP  R +  ++L
Sbjct: 1507 AGHIPQLPSNDEVSSAGKKFLRRCLQENPFKRASAVELL 1545

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 121/289 (41%), Gaps = 51/289 (17%)

Query: 24   VIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPD----KPSLNTLRAEVDAMKLL 79
            +++ +  G Y +V  + I   + YI       K  I+ D       L T+ +E+  M  L
Sbjct: 843  ILQVMGEGAYGKV-NLCIHNREHYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATL 901

Query: 80   KNN--RHVVSYIDSHASKSAIY--------NGAYEVFVLMEFCERGGLIDFMNSRLQHRL 129
              N   +++  +D        Y         G+ ++F ++EF              +  +
Sbjct: 902  NKNSQENILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEF--------------KKDM 947

Query: 130  TEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVRPPK 189
             E E   +       I  +H     ++HRDIK ENV++  +   K+ DFGS   I   P 
Sbjct: 948  VEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPF 1005

Query: 190  NQQEFNFVYHDIMKNTTAQYRSPEMLDLS--KGLPINEKSDIWALGVFLYKLCYYTTPFE 247
            +     FV        T  Y +PE+L  S  KG P     DIWALGV LY + Y   P+ 
Sbjct: 1006 DV----FV-------GTMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY- 1049

Query: 248  KNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296
             N  E  IL+   ++      S+   +LI+ +L++    RP + ++ E+
Sbjct: 1050 YNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEIYED 1096

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,337,404
Number of extensions: 3667299
Number of successful extensions: 16705
Number of sequences better than 10.0: 1980
Number of HSP's gapped: 15969
Number of HSP's successfully gapped: 2059
Length of query: 780
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 662
Effective length of database: 39,950,811
Effective search space: 26447436882
Effective search space used: 26447436882
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)