Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J013602.287ON37337319720.0
NCAS0B062502.287ON37337416260.0
KNAG0A054202.287ON37237216060.0
NDAI0B035502.287ON37237315990.0
YIL094C (LYS12)2.287ON37137215960.0
Suva_9.1052.287ON37137215890.0
Smik_9.852.287ON37137215890.0
Skud_9.792.287ON37137215710.0
TDEL0G021802.287ON36937215570.0
SAKL0E07656g2.287ON36837215190.0
Kwal_27.115282.287ON36737215140.0
CAGL0G02585g2.287ON37237315040.0
KLTH0G10384g2.287ON36737214950.0
TBLA0B059402.287ON36937314880.0
Kpol_1003.392.287ON37037214840.0
ZYRO0A01914g2.287ON36837214780.0
TPHA0C034102.287ON37137214730.0
KLLA0E08339g2.287ON36935114530.0
Ecym_33262.287ON36636113670.0
ADL214C2.287ON36737213110.0
TPHA0D015602.278ON3603794742e-55
ADL223W2.278ON3623504594e-53
Skud_14.2932.278ON3613724585e-53
NCAS0H022505.473ON4223894592e-52
Smik_14.2902.278ON3603724533e-52
KLLA0F04103g2.278ON3613514533e-52
YNL037C (IDH1)2.278ON3603724524e-52
KLLA0E03125g5.473ON3683524509e-52
TDEL0C038402.278ON3613824481e-51
KAFR0B063705.473ON3783524457e-51
SAKL0E07876g2.278ON3613534438e-51
KNAG0B040705.473ON3733514431e-50
TPHA0J027705.473ON3763744412e-50
NDAI0B035902.278ON3593524403e-50
NCAS0B062902.278ON3593514403e-50
NDAI0C014105.473ON3693894403e-50
Ecym_23135.473ON3703524395e-50
Kpol_1039.352.278ON3593804385e-50
CAGL0I07227g5.473ON3683534386e-50
AFR137C5.473ON3673544377e-50
Kwal_23.50122.278ON3613714369e-50
KLTH0G10186g2.278ON3603524342e-49
Suva_8.1885.473ON3693914333e-49
ZYRO0D02838g2.278ON3613794316e-49
Ecym_33162.278ON3623504308e-49
TBLA0B069102.278ON3653524291e-48
Kpol_543.85.473ON3683534291e-48
KAFR0J014102.278ON3503814229e-48
Smik_15.3165.473ON3693914212e-47
SAKL0G03520g5.473ON3693914212e-47
TBLA0B022405.473ON3733934212e-47
KLTH0F15048g5.473ON3683524202e-47
Kpol_440.125.473ON3683884184e-47
TPHA0E014805.473ON3773524161e-46
Kwal_55.212735.473ON3683544151e-46
TBLA0C015001.402ON3653694132e-46
YOR136W (IDH2)5.473ON3693544115e-46
TDEL0B060001.402ON3623654107e-46
CAGL0G02673g2.278ON3583514097e-46
Skud_15.3005.473ON3693544091e-45
ZYRO0D11220g5.473ON3683884091e-45
KNAG0A052802.278ON3613804081e-45
Ecym_12961.402ON3633664063e-45
KLTH0H12188g1.402ON3643623975e-44
Smik_3.661.402ON3643683967e-44
TDEL0A033705.473ON3713793967e-44
YCL018W (LEU2)1.402ON3643683959e-44
KNAG0I012801.402ON4473773956e-43
Skud_3.431.402ON3643683871e-42
Kpol_1048.631.402ON3643633802e-41
AAL012C1.402ON3723663792e-41
CAGL0H03795g1.402ON3653643783e-41
KLLA0D04906g1.402ON3623653783e-41
NDAI0G042301.402ON3633623713e-40
Suva_3.31.402ON3643683705e-40
Kwal_0.2251.402ON3643663671e-39
ZYRO0E04796g1.402ON3623653634e-39
Suva_14.3022.278ON3003133585e-39
SAKL0D08690g1.402ON3643643494e-37
NCAS0C048701.402ON3653633373e-35
TPHA0B037301.402ON3653653355e-35
KAFR0I022001.402ON3653583302e-34
AAL022W1.396ON4151261612e-11
KLTH0H12012g1.396ON4132351569e-11
SAKL0D08426g1.396ON4111411514e-10
KAFR0G032604.254ON4212121514e-10
Ecym_13061.396ON4151261506e-10
CAGL0H03663g1.396ON4181261496e-10
Kwal_23.42104.254ON4221331496e-10
SAKL0H02860g4.254ON4211331496e-10
TDEL0E011604.254ON4232331497e-10
KAFR0H031601.396ON4211331488e-10
CAGL0D00770g4.254ON4231331489e-10
YDL066W (IDP1)4.254ON4281151481e-09
TBLA0C012901.396ON4181441471e-09
Kpol_1055.784.254ON4271821471e-09
Skud_4.1894.254ON4291151471e-09
NDAI0G008501.396ON4191301471e-09
ZYRO0E05016g1.396ON4112131461e-09
KNAG0H016701.396ON4241261452e-09
Smik_4.1694.254ON4281151452e-09
TDEL0B061001.396ON4141471442e-09
KNAG0I013201.396ON4121261443e-09
TPHA0B022104.254ON4331821443e-09
AER061C4.254ON4251331433e-09
Kwal_0.1911.396ON4111261424e-09
NCAS0A087201.396ON4131301425e-09
KNAG0D044104.254ON4281711425e-09
Skud_12.2391.396ON4121261416e-09
Suva_4.1844.254ON4291151417e-09
KLLA0B03355g4.254ON4292231417e-09
Skud_14.3181.396ON4201261408e-09
NCAS0A025104.254ON4261471408e-09
Smik_12.2351.396ON4121261401e-08
KAFR0I021301.396ON4081331401e-08
Suva_10.2711.396ON4121261391e-08
NDAI0D043604.254ON4241151391e-08
KLTH0D14476g4.254ON4201821391e-08
Suva_14.3391.396ON4171331391e-08
YLR174W (IDP2)1.396ON4121261381e-08
CAGL0B04917g1.396ON4111331382e-08
NCAS0G036201.396ON4181261372e-08
Kpol_1048.701.396ON4191061363e-08
Smik_14.3191.396ON4181261354e-08
YNL009W (IDP3)1.396ON4201331346e-08
ZYRO0B12496g4.254ON4221161336e-08
TPHA0B036601.396ON4221261328e-08
KLLA0F12342g1.396ON4152281273e-07
Ecym_32654.254ON4241331256e-07
NDAI0G051601.396ON4201221203e-06
TBLA0A080104.254ON4281141193e-06
Suva_14.303singletonON5351977e-05
KNAG0D012307.491ON65558712.7
Kwal_56.227343.83ON34490693.8
Skud_12.725.230ON70271686.9
TPHA0D011001.475ON62068677.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01360
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   764   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   630   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              623   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   620   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   619   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   616   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   616   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   609   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   604   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   589   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   587   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   583   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   580   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   577   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   576   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   573   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   572   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   564   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   531   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   509   0.0  
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   187   2e-55
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   181   4e-53
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   181   5e-53
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    181   2e-52
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   179   3e-52
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   179   3e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   178   4e-52
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   177   9e-52
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   177   1e-51
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   176   7e-51
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   175   8e-51
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   175   1e-50
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   174   2e-50
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   174   3e-50
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   174   3e-50
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   174   3e-50
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   173   5e-50
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   173   5e-50
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   173   6e-50
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   172   7e-50
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   172   9e-50
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   171   2e-49
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   171   3e-49
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   170   6e-49
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   170   8e-49
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            169   1e-48
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   169   1e-48
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   167   9e-48
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   166   2e-47
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   166   2e-47
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   166   2e-47
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   166   2e-47
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   165   4e-47
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   164   1e-46
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   164   1e-46
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   163   2e-46
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   162   5e-46
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   162   7e-46
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   162   7e-46
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   162   1e-45
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   162   1e-45
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              161   1e-45
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   160   3e-45
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   157   5e-44
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   157   7e-44
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   157   7e-44
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   156   9e-44
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   156   6e-43
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   153   1e-42
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   150   2e-41
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   150   2e-41
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             150   3e-41
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   150   3e-41
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   147   3e-40
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      147   5e-40
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   145   1e-39
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   144   4e-39
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   142   5e-39
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   139   4e-37
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   134   3e-35
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   133   5e-35
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   131   2e-34
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    67   2e-11
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    65   9e-11
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    63   4e-10
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    63   4e-10
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    62   6e-10
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    62   6e-10
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    62   6e-10
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    62   6e-10
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    62   7e-10
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    62   8e-10
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    62   9e-10
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    62   1e-09
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    61   1e-09
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    61   1e-09
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    61   1e-09
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     61   1e-09
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    61   1e-09
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    60   2e-09
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    60   2e-09
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    60   2e-09
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    60   3e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    60   3e-09
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    60   3e-09
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    59   4e-09
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    59   5e-09
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    59   5e-09
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    59   6e-09
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    59   7e-09
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    59   7e-09
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    59   8e-09
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    59   8e-09
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    59   1e-08
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    59   1e-08
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    58   1e-08
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    58   1e-08
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    58   1e-08
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    58   1e-08
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    58   1e-08
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    58   2e-08
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    57   2e-08
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    57   3e-08
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    57   4e-08
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    56   6e-08
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    56   6e-08
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    55   8e-08
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    54   3e-07
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    53   6e-07
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    51   3e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   3e-06
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    42   7e-05
KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.4...    32   2.7  
Kwal_56.22734 s56 complement(257152..258186) [1035 bp, 344 aa] {...    31   3.8  
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    31   6.9  
TPHA0D01100 Chr4 (231436..233298) [1863 bp, 620 aa] {ON} Anc_1.4...    30   7.6  

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRK 180
           ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRK
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRK 180

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQ 240
           IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQ
Sbjct: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQ 240

Query: 241 IIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHG 300
           IIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHG
Sbjct: 241 IIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHG 300

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360
           SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360

Query: 361 QNVVDDVLEKLAK 373
           QNVVDDVLEKLAK
Sbjct: 361 QNVVDDVLEKLAK 373

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/374 (80%), Positives = 341/374 (91%), Gaps = 4/374 (1%)

Query: 1   MLRSVVTK--SATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFN 58
           MLR+  ++  ++T R  +T  + K+LTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL F+
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 59  FIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQ 118
           FIDL+AGFQTFLDTGKALPDETV+VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKE+ 
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 119 LYANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVA 177
           L+AN+RPVKSV+G    +PVDMVIVRENTEDLYIKIEK+Y D+  G RVAEATKRI+E+A
Sbjct: 121 LFANVRPVKSVSGTKD-RPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179

Query: 178 TRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINY 237
           TR+IA IALD+ALQRLK NGKATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I Y
Sbjct: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP 297
           NEQI+DSMVYRMFREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEP
Sbjct: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299

Query: 298 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGN 357
           CHGSAPDIAGKGIANPIATIRSTALMLEFLGH +AAQDIH+AVE+NMRENKIKTPDLGGN
Sbjct: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359

Query: 358 SSTQNVVDDVLEKL 371
           S+TQ V +DVL +L
Sbjct: 360 STTQQVTEDVLARL 373

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/372 (80%), Positives = 339/372 (91%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLRS   K A  R L+T    KSLTIGLIPGDGIGKEVIPAGKQVLQ+L+ +HGLNF+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AGFQTF DTGKALPDETV++LKE+CQG LFGAVQSPTT+V+ YSSPIVALRK + LY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           ANIRPVKSV G++  +PVDM+IVRENTEDLYIKIEK+Y D+  G RVAEATKRI+E+AT+
Sbjct: 122 ANIRPVKSVEGSNE-RPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQ 180

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA IALD+ALQRL+ NGKATLTVTHKSNVLSQSDGLFRE+C+++Y+ANKDKYAGI YNE
Sbjct: 181 RIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNE 240

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYRMFREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH EAAQDIHKAV++N+R+  +KT DLGGN++
Sbjct: 301 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNAT 360

Query: 360 TQNVVDDVLEKL 371
           TQNVVDD+L +L
Sbjct: 361 TQNVVDDILARL 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/373 (79%), Positives = 338/373 (90%), Gaps = 3/373 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR+  ++ AT R  +T  I K+LTIGLIPGDGIGKEVIPAGKQVLQNL+S+HGLNF+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AGFQTFLDTGKALPDET++VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKE+ LY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLY-IKIEKSYKDQ-NGMRVAEATKRITEVAT 178
           AN+RPVKSV G  + KPVDMVIVRENT     IK+E++Y D+  G RVAEATKRI+E+AT
Sbjct: 121 ANVRPVKSVEGT-TDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIAT 179

Query: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238
           R+IA IALD+ALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  INYN
Sbjct: 180 RRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYN 239

Query: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298
           EQI+DSMVYRMFREP+ FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPC
Sbjct: 240 EQIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358
           HGSAPDIAGKGI+NPIATIRSTALMLEFLGH EAAQDIH+AVE+N++ENK+KTPDLGG S
Sbjct: 300 HGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKS 359

Query: 359 STQNVVDDVLEKL 371
           +TQ V +DVL +L
Sbjct: 360 TTQEVTEDVLARL 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/372 (79%), Positives = 337/372 (90%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           M RSV T+ +  R L++    KSLTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL+FNFI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL AGFQTF +TGKALPDETVKVLKEQCQG LFGAVQSPTT+V+ YSSPIVALR+E+ L+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G   GKP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+ATKRI+E+ATR
Sbjct: 121 ANVRPVKSVEG-EKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA IALD+AL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VY++NKDKY  I YNE
Sbjct: 180 RIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH EAAQDI+KAV++N+RE  IKTPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAS 359

Query: 360 TQNVVDDVLEKL 371
           TQ VVDDVL +L
Sbjct: 360 TQQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 335/372 (90%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           M RSV T+ +  R L++    KSLTIGLIPGDGIGKEVIPAGKQ+L+NL+S+HGL+FNFI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL AGFQTF +TGKALPDET+KVLK+QCQG LFGAVQSPTT+V+ YSSPIVALR+E+ LY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G    KP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+A KRI+EVATR
Sbjct: 121 ANVRPVKSVEGTKD-KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IAKIALD+ALQRL+T G+ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I YNE
Sbjct: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIV+GEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH +AAQDI+KAV++N+RE  I TPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 360 TQNVVDDVLEKL 371
           TQ VVDDVL +L
Sbjct: 360 TQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/372 (79%), Positives = 337/372 (90%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLRSV T+ +T R L+T    KSLTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL+FNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL AGFQTF +TGKALPDETVKVLKEQCQG LFGAVQSPTT+V+ YSSPIVALR+E+ L+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G    KP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+ATKRI+E+ATR
Sbjct: 121 ANVRPVKSVEGGKD-KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA IA+D+AL+RL+T G+ATLTVTHKSNVLSQSDGLFREICK+VY++NKDKY  I YNE
Sbjct: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH  AAQDI+KAV++N+RE  IKTPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359

Query: 360 TQNVVDDVLEKL 371
           TQ VV+DVL +L
Sbjct: 360 TQQVVEDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/372 (78%), Positives = 335/372 (90%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           M RSV T+ +  R L+T    KSLTIGLIPGDGIGKEVIPAGKQVL+NL+S+HGL+FNFI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL AGFQTF +TGKALPDETV VLK+QCQG LFGAVQSPTT+V+ YSSPIVALR+E+ L+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G+ + KP+DMVIVRENTEDLYIKIEK+Y D+  G RVA+ATKRI+E+ATR
Sbjct: 121 ANVRPVKSVEGSRN-KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA IALD+AL+RL+T G+ATLTVTHKSNVLSQ+DGLFREICK+VY++NKDKY  I YNE
Sbjct: 180 RIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGIANPIATIRSTALMLEFLGH  AAQDI+KAV++N+RE  I TPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 360 TQNVVDDVLEKL 371
           TQ VVDDVL +L
Sbjct: 360 TQQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/372 (78%), Positives = 334/372 (89%), Gaps = 4/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLRS + + AT R  ++    KS+ IGLIPGDGIGKEVIPAGKQVL+NLS +HGLNF+FI
Sbjct: 1   MLRSAIGRLATRRAYASA--PKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AG+ TF +TGKALP++TV+VLK QCQG LFGAVQSPTT+V+ YSSPIVALRKEL LY
Sbjct: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G    +PVDMVIVRENTEDLYIK+EK+Y D+  G RVAEATKRI+EVATR
Sbjct: 119 ANVRPVKSVEGTKD-RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATR 177

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA IALD+ALQRLKTNG ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  + YNE
Sbjct: 178 RIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNE 237

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYRMFREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 238 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 297

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NPIATIRST LMLEFLGH + AQDI++AV++N+RE+K+KTPDLGGNS+
Sbjct: 298 GSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNST 357

Query: 360 TQNVVDDVLEKL 371
           TQ VV+D+L KL
Sbjct: 358 TQQVVEDILSKL 369

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/372 (76%), Positives = 327/372 (87%), Gaps = 5/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLRS V++ A   + S     K LTIGLIPGDGIGKEVIPAGK VL+NLSS+H L FNFI
Sbjct: 1   MLRSTVSQFARRSYASAA---KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AG+QTFLDTGKALPDET+++LK  CQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV G +  +PVDM+IVRENTEDLYIK EK+Y D+  G RVAEA KRI+E AT 
Sbjct: 118 ANVRPVKSVQGTND-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATT 176

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
            IAKIAL+++LQRLK NGKATLTVTHKSNVLSQSDGLFRE+CK+VY++NK++Y  I YNE
Sbjct: 177 DIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNE 236

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D ++GEPCH
Sbjct: 237 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCH 296

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NPIATIRSTALMLEF+G+ EAAQDIHKAV++N+REN+IKTPDLGG S+
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKST 356

Query: 360 TQNVVDDVLEKL 371
           TQ VVDD+L K+
Sbjct: 357 TQQVVDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/372 (76%), Positives = 323/372 (86%), Gaps = 6/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR+   + A   + S     KSLTIGLIPGDGIG+EVIPAGK VL+NLSS+HGL FNFI
Sbjct: 1   MLRTSFNQLARRSYTSA---TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DLEAG+QTFLDTGKALPDET+ +LK +CQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV      KP+DMVIVRENTEDLYIK EK+Y D+  G RVAEA KRI+EVATR
Sbjct: 118 ANVRPVKSVLSQE--KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATR 175

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
            IA IAL++ALQR K NG ATLTVTHKSNVLSQSDGLFREIC+ VY++N+DK+  INYNE
Sbjct: 176 NIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNE 235

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCH
Sbjct: 236 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAV++N+R+N +KTPDLGG S+
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKST 355

Query: 360 TQNVVDDVLEKL 371
           TQ VVDDVL ++
Sbjct: 356 TQQVVDDVLSRM 367

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/373 (75%), Positives = 326/373 (87%), Gaps = 3/373 (0%)

Query: 1   MLRSVVTKSATIRHLS-TKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNF 59
           MLR   T+   +R  S T+   K+LTIGLIPGDGIGKEVIPAGKQ+L+ +  +  L+F F
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 60  IDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQL 119
           IDL AG++TF +TGKALPDETV+VL+  CQG LFGAVQSPTT+V+ YSSPIVALRK + L
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 120 YANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVAT 178
           +AN+RPVK+V G +  +PVDMVIVRENTEDLYIKIEK+Y D   G RVAEATKRI+EVAT
Sbjct: 121 FANVRPVKAVEGTND-RPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVAT 179

Query: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238
           R+IA IALD+ALQRL++ G ATLTVTHKSNVLSQSDGLFREICKDVY++NKDKY  I YN
Sbjct: 180 RRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYN 239

Query: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298
           EQI+DSMVYRMFREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPC
Sbjct: 240 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 299

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358
           HGSAPDIAG+GIANPIATIRSTALMLEFLG+ EAAQ I+KAV+SN+REN+IKTPDLGG S
Sbjct: 300 HGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKS 359

Query: 359 STQNVVDDVLEKL 371
           +TQ VVDD+L K+
Sbjct: 360 TTQQVVDDILSKI 372

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/372 (75%), Positives = 324/372 (87%), Gaps = 6/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR+  T+ A   + S    +KSLTIGLIPGDGIGKEVIPAG+QVL+NLSS+HGL F+FI
Sbjct: 1   MLRASFTQLARRSYASA---SKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AG+QTF +TGKALPDET+ +L+ QCQG LFGAVQSPT +V+ YSSPIVALRK+L LY
Sbjct: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV      +PVDM+IVRENTEDLYIK EK+Y D+  G RVAEA KRI+E AT+
Sbjct: 118 ANVRPVKSVLPQE--RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATK 175

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
            IA IAL++ALQR K NG+ATLTVTHKSNVLSQSDGLFRE+C+ VY++NKDK+  I YNE
Sbjct: 176 NIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNE 235

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYRMFREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG D V+GEPCH
Sbjct: 236 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCH 295

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NP+ATIRSTALMLEF+GH EAAQDIHKAV++N+R+N IKTPDLGG S+
Sbjct: 296 GSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKST 355

Query: 360 TQNVVDDVLEKL 371
           TQ VV+DVL ++
Sbjct: 356 TQQVVEDVLSRM 367

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/373 (75%), Positives = 330/373 (88%), Gaps = 6/373 (1%)

Query: 1   MLRSVVTK-SATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNF 59
           MLR+ V + S + R+ S+    K+LTIGLIPGDGIGKEVIPAGKQVLQNL+ +HGL F F
Sbjct: 1   MLRTSVRQFSVSARNASSL---KTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57

Query: 60  IDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQL 119
           IDL+AG+QTFLDTG ALP +TV +LK +CQG LFGAVQSPTT+V+ YSSPIV LRKEL L
Sbjct: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117

Query: 120 YANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVAT 178
           +AN+RPVK+V G  + KP+D+VIVRENTEDLYIKIEK+Y D ++G R+AEATKRITE AT
Sbjct: 118 FANVRPVKTVEGTDA-KPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETAT 176

Query: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238
           ++IAK ALD+ALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VY++NK  Y+G+ YN
Sbjct: 177 KRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYN 236

Query: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298
           EQI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP+IV+GEPC
Sbjct: 237 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPC 296

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358
           HGSAPDIAGKGIANPIATIRSTA MLE+LG+   AQDI+KAV++N+R+NKIKT DLGG+S
Sbjct: 297 HGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDS 356

Query: 359 STQNVVDDVLEKL 371
           +TQ V+DD+L KL
Sbjct: 357 TTQQVIDDILGKL 369

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/372 (74%), Positives = 323/372 (86%), Gaps = 3/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR+ V + A  R     G   +LTIGLIPGDGIGKEVIPAGK+VL+ +  ++ ++F FI
Sbjct: 1   MLRNGVYR-ACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL AG+QTFLDTGKALPDETV +LK+QCQG LFGAVQSPTT+V+ YSSPIVALRK+L LY
Sbjct: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           ANIRPVKSV+G +  +PVDMVIVRENTEDLYIK E++Y D+  G +VAEATKRI+EVATR
Sbjct: 120 ANIRPVKSVSGTND-RPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           KIAKIALD+ALQRLK  GKATLTVTHKSNVLSQSDGLFRE+C+DVY+ NKD Y  ++YNE
Sbjct: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+FREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGPDI++GEPCH
Sbjct: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDI+G+GI+NP+ATIRS ALML+FLG+ EAA+DI  AV+ N+R  KIKTPDLGG+SS
Sbjct: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358

Query: 360 TQNVVDDVLEKL 371
           T  V DD+L KL
Sbjct: 359 TTEVTDDILSKL 370

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/372 (75%), Positives = 318/372 (85%), Gaps = 5/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           M RS V K A  R  S     KS+ IGLIPGDGIGKEVIPAGKQVL+ L S+HGL F+FI
Sbjct: 1   MFRSSVAKVAARRAYSAP---KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFI 57

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AG++ F   GKALPD+TVKVLKEQCQG LFGAVQSPTT+V  YSSPIVALRKEL LY
Sbjct: 58  DLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLY 117

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           AN+RPVKSV   +  + VDM+IVRENTEDLYIK EK+Y D+  G RVAEA KRI+EVATR
Sbjct: 118 ANVRPVKSVEKGND-RNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATR 176

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           KIA IALD++LQRLK+ G ATLTVTHKSNVLSQSDGLFREICKDVY+ NKDKY  + YNE
Sbjct: 177 KIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNE 236

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYRMFREPE FDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCH
Sbjct: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 296

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NPIATIRSTALMLEFLGH E AQDI+KAV++N+ +  + TPDLGG ++
Sbjct: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKAT 356

Query: 360 TQNVVDDVLEKL 371
           TQ VVDD+L K+
Sbjct: 357 TQQVVDDILSKI 368

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/372 (75%), Positives = 318/372 (85%), Gaps = 2/372 (0%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR  V      R +       +LTIGLIPGDGIGKEVIP+G+QVL+ +  +HGL FNFI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
           DL+AG+QTFLDTGKALP ETVK L+E C G LFGAVQSPTT+V+ YSSPIVALRKEL LY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           ANIRPVKSV      K VDMVIVRENTEDLYIK+EK+Y D+  G RVA+ATKRI+EVATR
Sbjct: 121 ANIRPVKSV-DTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATR 179

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IAKIALD+ALQRLK NG   LTVTHKSNVLSQSDGLFRE+CK+V+++NK  Y+ I YNE
Sbjct: 180 RIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNE 239

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QIIDSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IV+GEPCH
Sbjct: 240 QIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCH 299

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAGKGI+NPIATIRSTALMLEFLGH +AAQDI  AV+SN+RE+KIKTPDLGG +S
Sbjct: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNS 359

Query: 360 TQNVVDDVLEKL 371
           T +VV+DV+ +L
Sbjct: 360 TSDVVNDVIRRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/351 (76%), Positives = 315/351 (89%), Gaps = 2/351 (0%)

Query: 22  KSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           K+LTIGLIPGDGIGKEVIPAGK++L++L+ ++GL+F FIDL+AG++TF +TGKALPDET+
Sbjct: 19  KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI 78

Query: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKPVDMV 141
            +LK QC+G LFGAVQSPTT+V+ YSSPIVALRK L L+AN+RPVKSV G    K VD+V
Sbjct: 79  DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRK-VDLV 137

Query: 142 IVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKAT 200
           IVRENTEDLYIK+EKSY D+  G RVA+ATKRITE+AT+ IA IAL +A QRL+ NG AT
Sbjct: 138 IVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHAT 197

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIV 260
           LTVTHKSNVLSQSDGLFRE+C++ Y+ANKDKY G+ YNEQI+DSMVYRMFREPE FDV+V
Sbjct: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVV 257

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           APNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCHGSAPDIAGKGI+NPIATIRST
Sbjct: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKL 371
           ALMLEFLG+ E A+DIHKAV++N+RE K  TPDLGGNS+TQ V++DVL KL
Sbjct: 318 ALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/361 (72%), Positives = 306/361 (84%), Gaps = 5/361 (1%)

Query: 14  HLSTKG--INKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLD 71
            LST+    +KS TIGLIPGDGIGKEVIP G++VL+ +  ++G++F +IDL+AG+QTFLD
Sbjct: 8   QLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLD 67

Query: 72  TGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAG 131
           TGKALPD+TV+ L+  CQG LFGAVQSPTT+V  YSSPIVALRK L LYANIRPVKSV G
Sbjct: 68  TGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG 127

Query: 132 AHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVATRKIAKIALDVAL 190
               +PVD+VI RENTEDLYIK E++Y D + G RVAEA KRI+E ATR IA IAL++AL
Sbjct: 128 TGD-RPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIAL 186

Query: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
           QRLK  G ATLTVTHKSNVLSQSDGLFREICK VYQ+NK K+A + YNEQI+DSMVYR+F
Sbjct: 187 QRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLF 245

Query: 251 REPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGI 310
           +EP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP+IV+GEPCHGSAPDI G+GI
Sbjct: 246 KEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGI 305

Query: 311 ANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEK 370
           ANPIATIRS AL+LEFLG  EAA+ I K V+ N+RENKIKTPDLGGNS+ + V +D+L +
Sbjct: 306 ANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSR 365

Query: 371 L 371
           +
Sbjct: 366 I 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/372 (64%), Positives = 310/372 (83%), Gaps = 6/372 (1%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           M RS  T   ++ H +T   +K+LTIGLIPGDGIGKEVIPAG++VL+ +  +H + F++ 
Sbjct: 1   MHRSSAT---SLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57

Query: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120
            L+AG+QTFL+TG ALP  TV+ L+E+CQG LFGAVQSPTT+V+ YSSPIVALR++L LY
Sbjct: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117

Query: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179
           ANIRPVKSV+G  +G+PVD+VIVRENTEDLY++ E++Y D   G RVAEA KRI+E AT 
Sbjct: 118 ANIRPVKSVSG--TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATE 175

Query: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239
           +IA+I+L +ALQR +  G+  LTVTHKSNVLSQ+DGLF+E+C++VY+ANK  Y  I YNE
Sbjct: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235

Query: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299
           QI+DSMVYR+F+EP  FDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG +I++GEPCH
Sbjct: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295

Query: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359
           GSAPDIAG+GIANPIATIRS +LML+FLG +EAA DI +AV  N+++ ++ +PDLGG ++
Sbjct: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355

Query: 360 TQNVVDDVLEKL 371
           TQ V+DD+L ++
Sbjct: 356 TQEVLDDILARI 367

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  187 bits (474), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 136/379 (35%), Positives = 204/379 (53%), Gaps = 30/379 (7%)

Query: 1   MLRSVVTK----SATIRH-LSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGL 55
           MLR VV+K    S T  H +  K      T+ LIPGDGIGKEV  +  ++     +  GL
Sbjct: 1   MLRQVVSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIF----ASQGL 56

Query: 56  NFNFIDLEA-GFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALR 114
             ++  ++  G     +  KA+  E++K  K   +G+   +          Y S  VALR
Sbjct: 57  PIDWERIDVPGMSNENEVKKAV--ESLKRNKIGLKGIWHTSADQ-----TGYGSLNVALR 109

Query: 115 KELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRI 173
           K+L ++AN+   KS+ G  +  P VD+V++RENTE  Y  +E     ++   V E+ K I
Sbjct: 110 KQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEH----ESVPGVVESLKII 165

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYA 233
           T+  T +IA+ A D AL+    N ++T+T  HK+N++  SDGLF+    +V    + +Y 
Sbjct: 166 TKPKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEV---GEKEYP 218

Query: 234 GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIV 293
            I  N  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN G +  
Sbjct: 219 DIKVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGANYGREHA 278

Query: 294 MGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTP 352
           + EP       DI  + IANP A I S  LML  LG +E ++ I  AV + + E K  T 
Sbjct: 279 VFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEGKTTTK 338

Query: 353 DLGGNSSTQNVVDDVLEKL 371
           D+GGN+ST    D V++KL
Sbjct: 339 DIGGNASTTEFTDAVIDKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  181 bits (459), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 188/350 (53%), Gaps = 22/350 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+ LIPGDGIGKEV  +  Q+ +  +    +++  ++L A     L+       + V+ L
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFE--AENVPVDWESVELSA-----LEENHEGVQKAVESL 83

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
           K    G L G   +P  +   + S  VA RK+L ++AN+   KS  G  +  + VD+VI+
Sbjct: 84  KRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVII 141

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  +E     ++   V E+ K +T+  + +IA+ A D AL   K N KA   V
Sbjct: 142 RENTEGEYSGLEH----ESVPGVVESLKIMTKAKSERIARFAFDFAL---KNNRKAVCAV 194

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAPN 263
            HK+N++   DGLFR    ++      +Y  +N +  I+D+   +   +P  FDV+V PN
Sbjct: 195 -HKANIMKLGDGLFRNTVSEI---GAKEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTPN 250

Query: 264 LYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTAL 322
           LYG IL +  AAL+G  G+VP AN G +  + EP C     DI G+ +ANP A I S+ L
Sbjct: 251 LYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTL 310

Query: 323 MLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
           ML  LG  E A  I +A    + E K  T D+GG ++T    + V++KLA
Sbjct: 311 MLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKLA 360

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  181 bits (458), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 133/372 (35%), Positives = 204/372 (54%), Gaps = 24/372 (6%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           R++ T +   R L  K      T+ LIPGDG+GKE+  + + + +  + R  +++  I++
Sbjct: 9   RTLATAAQAERTLPKK-YGGRFTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWETINI 65

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
           +   QT    G     E V+ LK    G L G   +P  +   + S  VALRK+L +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 IRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +   KS+ G  +  P +D++++RENTE  +  +E  ++   G  V E+ K +T+  T +I
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLE--HESVPG--VVESLKVMTKPKTERI 173

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
           A+ A D A    K N KA +T  HK+N++   DGLFR I  ++ Q    +Y  I+ +  I
Sbjct: 174 ARFAFDFAK---KYNRKA-VTAVHKANIMKLGDGLFRNIITEIGQT---EYPDIDVSSII 226

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHG 300
           +D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP    
Sbjct: 227 VDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360
              DI G+ +ANP A I S+ LML  LG  E A  I KAV   + E K  T D+GG+SST
Sbjct: 287 VGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSST 346

Query: 361 QNVVDDVLEKLA 372
            +  ++V+ KL+
Sbjct: 347 TDFTNEVINKLS 358

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  181 bits (459), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 203/389 (52%), Gaps = 38/389 (9%)

Query: 1   MLRSVVTKSATIRHLSTK---GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47
           M RS + ++ T R LS K    I K            T+  I GDGIG E+  + KQ+  
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107
             +++  + +   D+      F+D    +P+  V+ + +     L G + +P  +   + 
Sbjct: 114 --AAKVPIEWETCDVTP---LFIDGLTTIPEPAVQSINKNLVA-LKGPLATPIGK--GHR 165

Query: 108 SPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRV 166
           S  + LRK   L+AN+RP +SV G  +  P VD+V++RENTE  Y  IE          V
Sbjct: 166 SLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG----V 221

Query: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226
            ++ K IT  A+ ++ + A +      +  G+  L V HKS +   SDGLF  + K++ +
Sbjct: 222 VQSIKLITREASERVIRYAFEYC----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSK 277

Query: 227 ANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I +  ++ID+ V ++   P  Y D + V PNLYGDILSD  + L  GSLG+ 
Sbjct: 278 ----EYPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLT 333

Query: 284 PSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343
           PS N+G +I + E  HGSAPDIAGK +ANP A + S+ +ML  +G  + A  I  AV S 
Sbjct: 334 PSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLST 393

Query: 344 MREN-KIKTPDLGGNSSTQNVVDDVLEKL 371
           +    + +T DL G ++T    D V++KL
Sbjct: 394 IASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/372 (34%), Positives = 202/372 (54%), Gaps = 24/372 (6%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           R++ T +   R L  K      T+ LIPGDG+GKE+  + K + +  + +  +++  +++
Sbjct: 9   RTLATAAQAERALPKK-YGGRFTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETVNI 65

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
           +   QT    G     E V+ LK    G L G   +P  +   + S  VALRK+L +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 IRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +   KS+ G  +  P +D++++RENTE  +  +E     ++   V E+ K +T   T +I
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEH----ESVPGVVESLKIMTRPKTERI 173

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
           A+ A D A    K N KA +T  HK+N++   DGLFR I  ++ Q    +Y  I+ +  I
Sbjct: 174 ARFAFDFAK---KYNRKA-VTAVHKANIMKLGDGLFRNIITEIGQ---KEYPDIDVSSII 226

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHG 300
           +D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP    
Sbjct: 227 VDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360
              DI G+ +ANP A I S+ LML  LG  E A  I KAV   + E K  T D+GG+SST
Sbjct: 287 VGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSST 346

Query: 361 QNVVDDVLEKLA 372
            +  ++++ KL+
Sbjct: 347 TDFTNEIINKLS 358

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 191/351 (54%), Gaps = 23/351 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+ LIPGDG+GKEV  +  ++ +N      +++  ID+ +G +   +  +A     V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFEN--ENIPIDWETIDI-SGLENTENVQRA-----VESL 82

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
           K    G L G   +P  +   + S  VALRK+L ++AN+   KS+ G  +    +DMVI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  +E  ++   G  V E+ K +T   + +IA+ A D AL+    N + ++  
Sbjct: 141 RENTEGEYSGLE--HESVPG--VVESLKIMTRAKSERIARFAFDFALK----NNRKSVCA 192

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAPN 263
            HK+N++   DGLFR    ++     ++Y  ++    I+D+   +   +P  FDV+V PN
Sbjct: 193 VHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTPN 249

Query: 264 LYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTAL 322
           LYG IL +  +AL+G  G+VP AN G +  + EP       DI G+ +ANP A I S+ L
Sbjct: 250 LYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTL 309

Query: 323 MLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLAK 373
           ML  LG    A  I KA    + E K  T D+GG++ST    + V+EKLAK
Sbjct: 310 MLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKLAK 360

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  178 bits (452), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 201/372 (54%), Gaps = 24/372 (6%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           R++ T +   R L  K      T+ LIPGDG+GKE+  + + + +  +    +++  I++
Sbjct: 9   RTLATAAQAERTLPKK-YGGRFTVTLIPGDGVGKEITDSVRTIFE--AENIPIDWETINI 65

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
           +   QT    G     E V+ LK    G L G   +P  +   + S  VALRK+L +YAN
Sbjct: 66  K---QTDHKEGVY---EAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 IRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +   KS+ G  +  P +D++++RENTE  +  +E  ++   G  V E+ K +T   T +I
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLE--HESVPG--VVESLKVMTRPKTERI 173

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
           A+ A D A    K   + ++T  HK+N++   DGLFR I  ++ Q    +Y  I+ +  I
Sbjct: 174 ARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQ---KEYPDIDVSSII 226

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHG 300
           +D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP    
Sbjct: 227 VDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360
              DI G+ +ANP A I S+ LML  LG  E A  I KAV   + E K  T D+GG+SST
Sbjct: 287 VGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSST 346

Query: 361 QNVVDDVLEKLA 372
            +  ++++ KL+
Sbjct: 347 TDFTNEIINKLS 358

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  177 bits (450), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 194/352 (55%), Gaps = 25/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDG+G E+  + K +    +++  + +   D+   F   L T   +PD  V  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + V++V++
Sbjct: 92  NKNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT+ A+ ++ + A + A    +   ++ + V
Sbjct: 149 RENTEGEYSGIEHVVAPG----VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLV 200

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261
            HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + PE +D  V+V 
Sbjct: 201 VHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVC 256

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 257 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMREN-KIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E A  I KAV + +  + K +T DLGG++ST +  D V+E+L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  177 bits (448), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/382 (35%), Positives = 191/382 (50%), Gaps = 33/382 (8%)

Query: 1   MLRSVVTKS-----ATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQ--NLS-SR 52
           MLRS V K      A    +  K       + LIPGDG+GKEV  +   + +  NL    
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDW 60

Query: 53  HGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVA 112
             ++ + +D E G Q  +D+           LK    G L G   +         S  VA
Sbjct: 61  DRVDISGLDHEEGVQAAVDS-----------LKRNKIG-LKGIWHTSAADQAGKGSLNVA 108

Query: 113 LRKELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATK 171
           LRKEL +YAN+   KSV G  +  P VD+V++RENTE  Y  +E     ++   V E+ K
Sbjct: 109 LRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEH----ESVPGVVESLK 164

Query: 172 RITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDK 231
            +TE  T +IA+ A D A    K   +  +T  HK+N++   DGLFR +   V +  + +
Sbjct: 165 IMTEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNV---VTRVGEQE 217

Query: 232 YAGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD 291
           Y  +     I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G +
Sbjct: 218 YPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRE 277

Query: 292 IVMGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIK 350
             + EP       DI  K IANP A I S +LML+ LG   +A  I  AV   + E K  
Sbjct: 278 YAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKST 337

Query: 351 TPDLGGNSSTQNVVDDVLEKLA 372
           TPD+GG++ST      V+EKLA
Sbjct: 338 TPDIGGSASTTEFTQAVIEKLA 359

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  176 bits (445), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 186/352 (52%), Gaps = 23/352 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDGIG E+  + K + Q  S    + +   D+       +D    +PDE VK +
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
            +   G L G + +P  +   + S  + LRK   L+AN+RP KSV G  +    VD+V++
Sbjct: 100 NKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    K  G+  + V
Sbjct: 157 RENTEGEYSGIEHVVTPG----VVQSIKLITRDASERVIRYAFEYA----KAIGRPKVIV 208

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261
            HKS +   SDGLF  + K++ +  +  +  I  + ++ID+ V  +   P  +   V V 
Sbjct: 209 VHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVC 266

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  I + E  HGSAPDIAG+  ANP A + S+
Sbjct: 267 PNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLSS 326

Query: 321 ALMLEFLGHKEAAQDIHKAVESNM-RENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E    I  AV   +   +K +T DLGG ++T +  + V++ L
Sbjct: 327 VMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  175 bits (443), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 182/353 (51%), Gaps = 29/353 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLS---SRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           T+ LIPGDG+GKEV  +   + +  +       +N   +D E G Q           + V
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITGVDSEEGVQ-----------KAV 79

Query: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDM 140
           + LK    G L G   +P  +   + S  VA RK+L ++AN+   K+V G  +    +D+
Sbjct: 80  ESLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 141 VIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKAT 200
           V++RENTE  Y  +E     ++   V E+ K IT+  + +IA+ A D AL+    N + +
Sbjct: 138 VVIRENTEGEYSGLEH----ESVPGVVESLKIITKAKSERIARFAFDFALK----NNRKS 189

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIV 260
           +   HK+N++   DGLFR    +V      +Y  I+    I+D+   +   +P  FDV+V
Sbjct: 190 VCAVHKANIMKLGDGLFRNTVNEV---GASEYPEIDVKNIIVDNASMQAVAKPHQFDVLV 246

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRS 319
            PNLYG IL +  AAL+G  G+VP AN G +  + EP       DI GK +ANP A I S
Sbjct: 247 TPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILS 306

Query: 320 TALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
           + LML  LG    A  I KA    + E K  T D+GG+SST      V++KLA
Sbjct: 307 STLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKLA 359

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  175 bits (443), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 191/351 (54%), Gaps = 25/351 (7%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLK 85
           +  I GDGIG E+  + K + +  ++   +N+ F D+   F   L T   +PD  V  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVTPIFVNGLTT---IPDPAVASIN 97

Query: 86  EQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVR 144
           +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++R
Sbjct: 98  KNLIA-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 145 ENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVT 204
           ENTE  Y  IE          V ++ K IT  A+ ++ + A + A    K  G+  + V 
Sbjct: 155 ENTEGEYSGIEHVVAPG----VVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVV 206

Query: 205 HKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VAP 262
           HKS +   +DGLF  + K++ +    +Y  I    ++ID+ V  +   P  Y D + V P
Sbjct: 207 HKSTIQRLADGLFVNVAKELSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCP 262

Query: 263 NLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTA 321
           NLYGDILSD  + L  GSLG+ PSAN+G +I + E  HGSAPDIAG+  ANP A + S+ 
Sbjct: 263 NLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSV 322

Query: 322 LMLEFLGHKEAAQDIHKAVESNM-RENKIKTPDLGGNSSTQNVVDDVLEKL 371
           +ML  +G  + A  I +AV + +   +K +T DLGG+++T +  D V++ L
Sbjct: 323 MMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 195/374 (52%), Gaps = 25/374 (6%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           RS+  +    R       + + T+  I GDG+G E+  + K +    ++   + +   D+
Sbjct: 23  RSISNQPTIGRFTGKTNSSGTYTVPFIEGDGVGPEISKSVKDIFS--AANVPIQWQPCDV 80

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
              F   L T   +P+  VK +KE     L G + +P  +   + S  + LRK   L+AN
Sbjct: 81  GPIFVNGLTT---IPEPAVKAIKESLVA-LKGPLATPVGK--GHRSLNLTLRKTFDLFAN 134

Query: 123 IRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +RP KSV    S  + VD+V++RENTE  Y  IE          V ++ K IT  A+ K+
Sbjct: 135 VRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPG----VVQSIKLITREASEKV 190

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
            + A + A+      G+  L V HKS +    DGLF +I  ++    + +Y  I    QI
Sbjct: 191 IRYAYEYAIAV----GRPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQI 242

Query: 242 IDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPC 298
           +D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  
Sbjct: 243 LDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAV 302

Query: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMREN-KIKTPDLGGN 357
           HGSAPDIAG+  ANP A + S+ +ML  +G +E A  I  AV S +    + +T DLGG+
Sbjct: 303 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGS 362

Query: 358 SSTQNVVDDVLEKL 371
           ++T +  + V++KL
Sbjct: 363 ATTSSFTECVIKKL 376

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/352 (33%), Positives = 189/352 (53%), Gaps = 23/352 (6%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
            T+ L+PGDG+GKE+  +   + +  S    +++  +D+       LD  + +    V  
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFK--SENVPIDWETVDISG-----LDHTEGV-KAAVDS 79

Query: 84  LKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVI 142
           LK    G L G   +P  +V  + S  VA RK+L +YAN+   KS+ G  +  P VD+V+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 143 VRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLT 202
           +RENTE  Y  +E     ++   V E+ K IT+  + +IA+ A D A    K N + ++T
Sbjct: 138 IRENTEGEYSGLEH----ESVPGVVESLKIITKSKSERIARFAFDFA----KRNNRKSVT 189

Query: 203 VTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAP 262
             HK+N++  SDGLFR     +    +++Y  I  +  I+D+   +   +P  FDV+V P
Sbjct: 190 AVHKANIMKLSDGLFRNTVSKI---GEEEYPEIQTSSIIVDNASMQAVAKPHQFDVMVTP 246

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           ++YG I+ +  AAL+G  G+VP  N G D  + EP       DI G+ +ANP A + S  
Sbjct: 247 SMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSAT 306

Query: 322 LMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLAK 373
           L+L+ LG +++A  I  AV   + E K  T D+GG++ST      V+ KLA+
Sbjct: 307 LLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKLAR 358

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 190/351 (54%), Gaps = 24/351 (6%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
           +T+ L+PGDG+GKE+  +   + Q  +    +++  +D+       LD    + +  V+ 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQ--AENVPIDWETVDISQ-----LDHEDGV-NAAVES 80

Query: 84  LKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVI 142
           LK    G L G   +   +V  + S  VA RK+L +YAN+   KS+ G  +  P VD+VI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 143 VRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLT 202
           +RENTE  Y  +E     ++   V E+ K +T+V + +IAK A D A++    + +  +T
Sbjct: 139 IRENTEGEYSGLEH----ESVPGVVESLKIVTKVNSERIAKFAFDFAMR----HDRKMVT 190

Query: 203 VTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAP 262
             HK+N++  SDGLFR     V +A    Y  I  +  I+D+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVTP 246

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTA 321
           ++YG IL +  AAL+G  G+VP  N G +  + EP       DI G+ +ANP A I S+ 
Sbjct: 247 SMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 306

Query: 322 LMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
           L+L+ LG  + A  I KAV   ++E    T D+GGN+ST      V++KL+
Sbjct: 307 LLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKLS 357

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 130/389 (33%), Positives = 203/389 (52%), Gaps = 38/389 (9%)

Query: 1   MLRSVVTKSATIRHLSTK---GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47
           M R+++ ++ T R LS K    I K            T+  I GDGIG E+  + KQ+  
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107
             +++  +++   D+   F   L T   +P+  V+ + +     L G + +P  +   + 
Sbjct: 61  --AAKVPIDWEPCDVSPLFINGLTT---IPEPAVQSINKNLVA-LKGPLATPIGK--GHR 112

Query: 108 SPIVALRKELQLYANIRPVKSVAGAHS-GKPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166
           S  + LRK   L+AN+RP KS+ G  +    VD+VI+RENTE  Y  IE          V
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG----V 168

Query: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF ++ K++ Q
Sbjct: 169 VQSIKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ 224

Query: 227 ANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I    ++ID+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 225 ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLT 280

Query: 284 PSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343
           PSAN+G ++ + E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV S 
Sbjct: 281 PSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLST 340

Query: 344 MREN-KIKTPDLGGNSSTQNVVDDVLEKL 371
           +    + +T DL G ++T +  D V+ +L
Sbjct: 341 IASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  173 bits (439), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 190/352 (53%), Gaps = 25/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDGIG E+  + K +    +++  + + + D+   F   L T   +PD  V+ +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFS--AAKVPVEWEYCDVTPIFINGLTT---IPDPAVQSI 93

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + VD+V++
Sbjct: 94  NKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  + V
Sbjct: 151 RENTEGEYSGIEHVVSPG----VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVVV 202

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261
            HKS +   +DGLF  + ++V +    +Y  I    ++ID+ V  +  +PE +   V V 
Sbjct: 203 VHKSTIQRLADGLFVNVAQEVGK----EYPDIELQPELIDNTVLNVVSKPEKYSDSVAVC 258

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 259 PNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSS 318

Query: 321 ALMLEFLGHKEAAQDIHKAVESNM-RENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E A  I  AV + +  + K +T DL G ++T +    V+E+L
Sbjct: 319 VMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  173 bits (438), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 125/380 (32%), Positives = 197/380 (51%), Gaps = 33/380 (8%)

Query: 1   MLRSVVTKSATIRHLSTKGI-----NKSLTIGLIPGDGIGKEVIPAGKQVLQ--NLSSRH 53
           M R++++K A     S + I         T+ L+PGDG+G+E+  +   + +  NL    
Sbjct: 1   MFRNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLP--- 57

Query: 54  GLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVAL 113
            +++  ++L    Q  + T      E++K  K   +G+   +        D ++S  VAL
Sbjct: 58  -IDWERVELSGLEQEDVHTAV----ESLKRNKIGLKGIWHTSADH-----DGHTSWNVAL 107

Query: 114 RKELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKR 172
           RKEL +YAN+   KS  G  +  P VD+VI+RENTE  Y  +E     ++   V E+ K 
Sbjct: 108 RKELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEH----ESVPGVVESLKI 163

Query: 173 ITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKY 232
           +T   T +IA+ A D A++      + ++T  HK+N++   DGLFR +  ++      +Y
Sbjct: 164 MTAQKTERIARFAFDYAMKY----NRKSVTAVHKANIMKLGDGLFRNLVTEI---GAKEY 216

Query: 233 AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDI 292
             +  +  I+D+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G D 
Sbjct: 217 PEVGVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDY 276

Query: 293 VMGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKT 351
            + EP       DI  + IANP A I S  LML  LG +  A  I KAV   + E K  T
Sbjct: 277 AVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTT 336

Query: 352 PDLGGNSSTQNVVDDVLEKL 371
            D+GG+++T    + V+ KL
Sbjct: 337 RDIGGSATTTEFTNAVIAKL 356

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  173 bits (438), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 190/353 (53%), Gaps = 25/353 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
            T+  I GDGIG E+  + K++ Q  ++   + +   D+   F   L T   +PD  V+ 
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRIFQ--AADVPVEWETCDVTPIFVNGLTT---IPDPAVQS 90

Query: 84  LKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVI 142
           + +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + VD+V+
Sbjct: 91  INKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVL 147

Query: 143 VRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLT 202
           +RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  L 
Sbjct: 148 IRENTEGEYSGIEHLVSPG----VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLI 199

Query: 203 VTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-V 260
           V HKS +   +DGLF  + K++      +Y  I    ++ID+    +   P  Y D + V
Sbjct: 200 VVHKSTIQRLADGLFVNVAKELAA----EYPDIQLETELIDNTCLNVVSNPSSYTDAVSV 255

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 320 TALMLEFLGHKEAAQDIHKAVESNMR-ENKIKTPDLGGNSSTQNVVDDVLEKL 371
           + +ML  +G  E A  I KAV   +   ++ +T DLGG++ST +  D +++KL
Sbjct: 316 SVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  172 bits (437), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 191/354 (53%), Gaps = 29/354 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDG+G E+  + K +    S    + + + D+       L T   +P+  V  +
Sbjct: 36  TVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI 90

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++
Sbjct: 91  NKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +T G+  + V
Sbjct: 148 RENTEGEYSGIEHVVSPG----VVQSIKLITREASERVIRYAFEYA----RTVGRPKVVV 199

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VA 261
            HKS +   +DGLF  + +++ +    +Y  I    +++D+ V  +  +PE Y DV+ V 
Sbjct: 200 VHKSTIQRLADGLFVNVAQELGR----EYPDIELQTELLDNTVLNVVTKPEAYKDVVAVC 255

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 256 PNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSS 315

Query: 321 ALMLEFLGHKEAAQDIHKAVESNM---RENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E A  I KAV S +   REN  +T DL G +ST +  + V+E+L
Sbjct: 316 VMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  172 bits (436), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 193/371 (52%), Gaps = 25/371 (6%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           RS+ T +A    L  K      T+ LIPGDG+GKEV  +   + ++ +         ID 
Sbjct: 11  RSLATMAA--EQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIP-------IDW 61

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
           E    + LD  + +  + V+ LK    G L G   +P+ +   + S  VALRK+L ++AN
Sbjct: 62  ETVEISGLDNQEGV-QKAVESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFAN 118

Query: 123 IRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +   KSV G  S    VDMV++RENTE  Y  +E     ++   V E+ K +T+  + +I
Sbjct: 119 VALFKSVPGVPSRHSNVDMVVIRENTEGEYSGLEH----ESVPGVVESLKIMTKAKSERI 174

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
            + A D A++    N + ++   HK+N++   DGLFR    +V      +Y  I+    I
Sbjct: 175 GRFAFDFAVK----NNRKSVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNII 227

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHG 300
           +D+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G +  + EP    
Sbjct: 228 VDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRH 287

Query: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSST 360
              DI G+ +ANP A I S++LML  LG    A  I KA    + E K  T D+GG++ST
Sbjct: 288 VGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSAST 347

Query: 361 QNVVDDVLEKL 371
               + ++ KL
Sbjct: 348 TEFTEAIISKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 184/352 (52%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLS---SRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           T+ LIPGDG+GKEV  +   + ++ +       +  + +D E G Q  +D+         
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEISGLDNEEGVQKAVDS--------- 80

Query: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDM 140
             LK    G L G   +P+ +   + S  VALRK+L ++AN+   K+V G  S    VD+
Sbjct: 81  --LKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 141 VIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKAT 200
           V++RENTE  Y  +E     ++   V E+ K +T+  + +I + A D AL+    N + +
Sbjct: 137 VVIRENTEGEYSGLEH----ESVPGVVESLKIMTKAKSDRIGRFAFDFALK----NNRKS 188

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIV 260
           +   HK+N++   DGLFR    ++      +Y  I     I+D+   +   +P  FDV+V
Sbjct: 189 VCAVHKANIMKLGDGLFRNCINEI---GAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLV 245

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRS 319
            PNLYG IL +  AAL+G  G+VP AN G +  + EP       DI G+ +ANP A I S
Sbjct: 246 TPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILS 305

Query: 320 TALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKL 371
           +ALML  LG    A  I KA    + E K  T D+GG++ST +    ++EKL
Sbjct: 306 SALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  171 bits (433), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 203/391 (51%), Gaps = 42/391 (10%)

Query: 1   MLRSVVTKSATIRHLST---KGINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47
           MLR+   ++ + R LST     I +            T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107
             ++   +N+ F D+   F   L T   +PD  V+ + +     L G + +P  +   + 
Sbjct: 61  --AADVPINWEFCDVNPIFVNGLTT---IPDPAVQSITKNLVA-LKGPLATPIGK--GHR 112

Query: 108 SPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166
           S  + LRK   L+AN+RP KS+ G  +  + VD+V++RENTE  Y  IE          V
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----V 168

Query: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  + K++ +
Sbjct: 169 VQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELSK 224

Query: 227 ANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I +  ++ID+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 225 ----EYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLT 280

Query: 284 PSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343
           PSAN+G  + + E  HGSAPDIAGK  ANP A + S+ +ML  +G    A  I  AV S 
Sbjct: 281 PSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLST 340

Query: 344 MR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
           +    EN  +T DL G ++T +  + V+++L
Sbjct: 341 IASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 125/379 (32%), Positives = 197/379 (51%), Gaps = 27/379 (7%)

Query: 1   MLRSVVTKS-----ATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGL 55
           M R  +TK      AT   +  K      T+ LIPGDG+GKEV  +   + +  +    +
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFK--AENVPV 58

Query: 56  NFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRK 115
           +++ +D+ +G     D   A+  E++K  +   +G+      SP  +   + S  VALRK
Sbjct: 59  DWDRVDI-SGVDRAEDVKSAV--ESLKRNRIGLKGIWH---TSPADQA-GHGSLNVALRK 111

Query: 116 ELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRIT 174
           EL +YAN+   KS+ G     P VD+V++RENTE  +  +E     ++   V E+ K +T
Sbjct: 112 ELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEH----ESVPGVVESLKIMT 167

Query: 175 EVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAG 234
           +    +IA+ A D A    K N +  +   HK+N++   DGLF+ + ++V    + +Y  
Sbjct: 168 QDNIERIARFAFDYA----KKNDRKQVVAVHKANIMKMGDGLFKNLVQEV---GEKEYPE 220

Query: 235 INYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVM 294
           +     I+D+   +    P  FDV+V P++YG IL +  AAL+G  G+V  AN G D+ +
Sbjct: 221 LQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDVAL 280

Query: 295 GEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPD 353
            EP       DI G+ +ANP A I S+ L+L  LG   +A  I KAV + + E K  T D
Sbjct: 281 FEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRD 340

Query: 354 LGGNSSTQNVVDDVLEKLA 372
           +GG +ST    + V+ KLA
Sbjct: 341 IGGTASTTEFTEAVINKLA 359

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  170 bits (430), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 183/350 (52%), Gaps = 22/350 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+ LIPGDG+GKEV  +   + +  +         ID E+   + L+       + V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP-------IDWESVELSGLEENMEGVQKAVESL 83

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
           K    G L G   +P  +   + S  VA RK+L ++AN+   KS  G  +  K VD+VI+
Sbjct: 84  KRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  +E     ++   V E+ K +T+  + +IA+ A D AL+    N + ++  
Sbjct: 142 RENTEGEYSGLEH----ESVPGVVESLKIMTKAKSERIARFAFDFALK----NNRRSVCA 193

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAPN 263
            HK+N++   DGLFR    ++      +Y  +     I+D+   +   +P  FDV+V PN
Sbjct: 194 VHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVTPN 250

Query: 264 LYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTAL 322
           LYG IL +  AAL+GS G+VP AN G +  + EP       DI G+ +ANP A I S+ L
Sbjct: 251 LYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTL 310

Query: 323 MLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
           ML  LG  + A  I KA    + E K  T D+GG++ST      +++KL+
Sbjct: 311 MLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKLS 360

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 190/352 (53%), Gaps = 27/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVL--QNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVK 82
           T+ LIPGDG+GKEV  +   +   +NL     +++  +D+       LD  + + +  V 
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAENLP----IDWERVDISG-----LDHEEGV-EAAVN 84

Query: 83  VLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMV 141
            LK    G L G   +   + D + S  VALRK+L +YAN+   K++ G  +  P VD+V
Sbjct: 85  SLKRNKIG-LKGIWHTSAGQSD-HGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 142 IVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATL 201
           I+RENTE  Y  +E     ++   V E+ K IT+  + +IA+ A D A    K   +  +
Sbjct: 143 IIRENTEGEYSGLEH----ESVPGVVESLKIITKEKSERIARFAFDFA----KRFDRKLV 194

Query: 202 TVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVA 261
           T  HK+N++   DGLFR     V    + +Y  I  +  I+D+   +   +P  FDV+V 
Sbjct: 195 TAVHKANIMKLGDGLFR---NSVTSIGETEYPDIKVSSIIVDNASMQSVAKPHQFDVLVT 251

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRST 320
           P++YG IL +  AAL+G  G+VP AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 252 PSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSS 311

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
            L+L+ LG    A+ I  AV   + E K+ T D+GG++ST    +++++KLA
Sbjct: 312 TLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKLA 363

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 115/353 (32%), Positives = 190/353 (53%), Gaps = 25/353 (7%)

Query: 24  LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
            T+  I GDG+G E+  + K++     S   +   ++  + G   F++    +P+  V++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIF----SAAKVPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 84  LKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVI 142
           + +     L G + +P  +   + S  + LRK   L+AN+RP +S+    S  + VD+V+
Sbjct: 91  INKHLIA-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 143 VRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLT 202
           +RENTE  Y  IE          V ++ K IT  AT ++ + A +      +  G+  L 
Sbjct: 148 IRENTEGEYSGIEHVITPG----VIQSIKLITREATERVVRYAFEYT----QAIGRPRLL 199

Query: 203 VTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIV 260
           V HKS +   +DGLF ++ +++      +Y  I    +IID  +  +  +PE +   V V
Sbjct: 200 VIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVSV 255

Query: 261 APNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRS 319
            PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 320 TALMLEFLGHKEAAQDIHKAVESNMRE-NKIKTPDLGGNSSTQNVVDDVLEKL 371
           + +ML+ +G  E A  I  AV + +   ++ +T DL G +ST +  ++V+++L
Sbjct: 316 SVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  167 bits (422), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/381 (32%), Positives = 194/381 (50%), Gaps = 45/381 (11%)

Query: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60
           MLR+ + +  +I  +S K       I LIPG+GIGKEV  + + + Q  +    +++  +
Sbjct: 1   MLRNTLLRR-SISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQ--AENLPIDWEIV 57

Query: 61  DLEA---GFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPI-----VA 112
           ++E+   G +T +D+        +K  K   +G+               S PI     VA
Sbjct: 58  NIESHRDGIKTAVDS--------IKRNKIALKGIW-------------SSDPIDGSLNVA 96

Query: 113 LRKELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATK 171
           LRK+L ++AN+   KS    ++  P VD+V++RENTE  +  +E    D     V E+ K
Sbjct: 97  LRKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG----VVESLK 152

Query: 172 RITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDK 231
            +T+  T +IA+ A D A    K + +  +T  HK+N++   DGLF+ I   V     ++
Sbjct: 153 IVTKPKTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNI---VAHIGNNE 205

Query: 232 YAGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD 291
           Y  I  +  I+D+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G D
Sbjct: 206 YPEIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRD 265

Query: 292 IVMGEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIK 350
             + EP       DI G+ +ANP A I S   ML  LG    A+ I  AV+  + +    
Sbjct: 266 YAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTV 325

Query: 351 TPDLGGNSSTQNVVDDVLEKL 371
           T D+GG +ST    D V+ +L
Sbjct: 326 TKDIGGTASTTEFTDAVINEL 346

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 202/391 (51%), Gaps = 42/391 (10%)

Query: 1   MLRSVVTKSATIRHLST---KGINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47
           MLR+   ++ + R L+T     I K            T+  I GDGIG E+  + K++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107
             ++   + + F D+   F   L T   +PD  V+ + +     L G + +P  +   + 
Sbjct: 61  --AANVPIEWEFCDVNPIFVNGLTT---IPDPAVQSITKNLVA-LKGPLATPIGK--GHR 112

Query: 108 SPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166
           S  + LRK   L+AN+RP KSV G  +  + VD+V++RENTE  Y  IE          V
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----V 168

Query: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF  + K++ +
Sbjct: 169 VQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSK 224

Query: 227 ANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I    ++ID+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+ 
Sbjct: 225 ----EYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLT 280

Query: 284 PSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343
           PSAN+G  I + E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I  AV S 
Sbjct: 281 PSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLST 340

Query: 344 MR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
           +    EN  +T DL G ++T +  + V+++L
Sbjct: 341 IASGPEN--RTGDLAGAATTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 201/391 (51%), Gaps = 42/391 (10%)

Query: 1   MLRSVVTKSATIRHLSTK---GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQ 47
           MLRS V +    R LS+K    I +            T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 48  NLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYS 107
             ++   + +   D+   F   L T   +P   V  + +     L G + +P  +   + 
Sbjct: 61  --AAEVPVEWESCDVTPLFINGLTT---IPQPAVDSINKNLIA-LKGPLATPIGK--GHR 112

Query: 108 SPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRV 166
           S  + LRK   L+AN+RP KSV G  +  + VD+V++RENTE  Y  IE          V
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPG----V 168

Query: 167 AEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQ 226
            ++ K IT  A+ ++ + A + A    +  G+  + V HKS +   +DGLF ++ K++  
Sbjct: 169 VQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL-- 222

Query: 227 ANKDKYAGINYNEQIIDSMVYRMFREP-EYFDVI-VAPNLYGDILSDGAAAL-VGSLGVV 283
               +Y  I    Q++D+ V  +   P  Y D + V PNLYGDILSD  + L  GSLG+ 
Sbjct: 223 --SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLT 280

Query: 284 PSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESN 343
           PSAN+G  + + E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV S 
Sbjct: 281 PSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLST 340

Query: 344 MR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
           +    EN  +T DL G++ST +  + V+++L
Sbjct: 341 IASGPEN--RTADLAGSASTSSFTEAVIKRL 369

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/393 (31%), Positives = 206/393 (52%), Gaps = 42/393 (10%)

Query: 1   MLRSVVTKSATIRHLSTKGI--------------NKS---LTIGLIPGDGIGKEVIPAGK 43
           MLR++  K +  R  ST                 N S    T+  I GDG+G E+  + K
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 44  QVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRV 103
            + +  +++  +++ + D+       L T   +P+  V+ + +  +  L G + +P  + 
Sbjct: 61  DIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQINKH-KIALKGPLATPIGK- 113

Query: 104 DNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQN 162
             + S  + LRK   L+AN+RP +S+ G  +  K VD+V++RENTE  Y  IE       
Sbjct: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPG- 171

Query: 163 GMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK 222
              V ++ K IT  A+ ++ + A + A    +  G+  L V HKS +   +DGLF  I K
Sbjct: 172 ---VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIAK 224

Query: 223 DVYQANKDKYAGINYNEQIIDSMVYRMFREP-EYFD-VIVAPNLYGDILSDGAAAL-VGS 279
           ++      ++  I    ++ID+ V  + R+P  Y D V V PNLYGDILSD  + L  GS
Sbjct: 225 EL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGS 280

Query: 280 LGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKA 339
           LG+ PSAN+G ++ + E  HGSAPDIAG+  ANP A + S+ +ML ++G +  +  I  A
Sbjct: 281 LGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENA 340

Query: 340 VESNMRE-NKIKTPDLGGNSSTQNVVDDVLEKL 371
           + + +   ++ +T DL G ++T +  + V++ L
Sbjct: 341 ILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 188/352 (53%), Gaps = 25/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDG+G E+  A K +    +++  + +   D+   F   L T   +P      +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSPLFINGLTT---IPQPAQDSI 91

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KSV G  +    VD+V++
Sbjct: 92  NKNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT+ A+ ++ + A + A    +   +  + V
Sbjct: 149 RENTEGEYSGIEHVVSPG----VVQSIKLITQDASERVIRYAFEYA----RAVERPKVVV 200

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP-EYFDVIV-A 261
            HKS +   +DGLF  + + + +    +Y  I    ++ID+ V    R+P +Y DV+V  
Sbjct: 201 VHKSTIQRLADGLFVSVAEQLSK----EYPDIELQTELIDNTVLHTVRDPTKYSDVVVVC 256

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMREN-KIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E A  I KAV + +    + +T DLGG++ST +  + V+ +L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  165 bits (418), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 199/388 (51%), Gaps = 37/388 (9%)

Query: 1   MLRSVVTKSATIRHLST------------KGINKSLTIGLIPGDGIGKEVIPAGKQVLQN 48
           MLR+ + + +  R ++T              +    T+  I GDG+G E+  + K +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFA- 59

Query: 49  LSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSS 108
            +++  + +   D+   F   L T   +PD  V+ + +     L G + +P  +   + S
Sbjct: 60  -AAKVPIEWEPCDVGPIFVNGLTT---IPDAAVQSINKHLVA-LKGPLATPIGK--GHRS 112

Query: 109 PIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVA 167
             + LRK   L+AN+RP +SV    +  + VD+V++RENTE  Y  IE          V 
Sbjct: 113 LNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPG----VI 168

Query: 168 EATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQA 227
           ++ K IT+ A+ ++ + A +      +  G+  L V HKS +   +DGLF  + K++   
Sbjct: 169 QSIKLITKDASERVIRYAFEYT----RAIGRPRLVVVHKSTIQRMADGLFVNVAKEL--- 221

Query: 228 NKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VAPNLYGDILSDGAAAL-VGSLGVVP 284
              +Y  I    ++ID+ +  +   PE Y D + V PNLYGDILSD  + L  GSLG+ P
Sbjct: 222 -ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTP 280

Query: 285 SANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNM 344
           SAN+G  + + E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I  A+ S +
Sbjct: 281 SANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTI 340

Query: 345 RE-NKIKTPDLGGNSSTQNVVDDVLEKL 371
              ++ +T DL G ++T +  + V+ KL
Sbjct: 341 ASGSENRTGDLAGTATTSSFTEAVINKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  164 bits (416), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 188/352 (53%), Gaps = 26/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDG+G E+  + + + +       +  ++++ + G    ++    +P   V  +
Sbjct: 46  TVPFIEGDGVGPEISKSVRTIFKAAK----VPIDWVNCDIG-PLLINGETTIPQTAVDQI 100

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAG-AHSGKPVDMVIV 143
                  L G + +P  +   + S  + LRK   L+AN+RP KS+   A + + VD++++
Sbjct: 101 NNSLIA-LKGPLATPVGQ--GHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVI 157

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ K+ K A +      ++ G++ L V
Sbjct: 158 RENTEGEYSGIEHEIVPG----VVQSIKLITRKASEKVIKYAFEYT----RSIGRSNLIV 209

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYF--DVIVA 261
            HK+ +  + DGLF +  +++     DKY  +N   ++ID+ V      PE +   V V 
Sbjct: 210 VHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVC 265

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G + V+ E  HGSAPDIAG+  ANP A + S+
Sbjct: 266 PNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLSS 324

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMRENK-IKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G ++ A  I  AV + +   K  +T DLGG+++T +    V+E L
Sbjct: 325 VMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 189/354 (53%), Gaps = 29/354 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDG+G E+  A K +    +++  + +   D+   F   L T   +P      +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTPLFINGLTT---IPQPAQDSI 91

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++
Sbjct: 92  NKNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT+ A+ ++ + A + A    +   +  + V
Sbjct: 149 RENTEGEYSGIEHVVAPG----VVQSIKLITQDASERVIRYAFEYA----RAVERPKVLV 200

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP-EYFDVIV-A 261
            HKS +   +DGLF  + + + +    +Y  I    ++ID+ V    R+P +Y DV+V  
Sbjct: 201 VHKSTIQRLADGLFVSVAEKLAK----EYPDIELQTELIDNTVLHTVRDPLKYSDVVVVC 256

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ + E  HGSAPDIAG+  ANP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G  E A  I KAV S +    EN  +T DL G++ST +  + V+ +L
Sbjct: 317 VMMLNHMGLTEHADKIEKAVFSTIASGPEN--RTGDLAGSASTSSFAEAVISRL 368

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 127/369 (34%), Positives = 196/369 (53%), Gaps = 36/369 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E++    +VL+ +   RHG+ FNF     G      TG  LPDET++  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 85  KEQCQGVLFGAVQSP---TTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG------ 135
           K Q   VL GAV  P   T +V      ++ +RKEL LY N+RP K ++    G      
Sbjct: 67  K-QSDAVLLGAVGGPKWGTGKV-RPEQGLLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 136 ---KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQR 192
              K  D V+VRE    +Y   E+   D +G+        I EV  ++I K+A   A   
Sbjct: 125 EVCKGTDFVVVRELVGGIYFG-ERQEDDGSGVAWDSEKYSIEEV--KRITKMA---AFLS 178

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFRE 252
           L+ +    +    K+NVL+ S  L+R    +       ++  +    Q+IDS    + + 
Sbjct: 179 LQNDPPLPIWSLDKANVLASSR-LWRAAVDETIA----EFPNLKVQHQLIDSAAMMLVKN 233

Query: 253 PEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDI 305
           P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+
Sbjct: 234 PTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDL 293

Query: 306 AGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVV 364
           A +G  NP+ATI S A+ML+  L   +  + I +AV S + +  I+T DLGGNS+T  + 
Sbjct: 294 A-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV-SVVLDRGIRTADLGGNSTTSELG 351

Query: 365 DDVLEKLAK 373
           D V ++L +
Sbjct: 352 DAVAQELGR 360

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 189/354 (53%), Gaps = 29/354 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDGIG E+  + K++    ++   + +   D+   F   L T   +PD  V+ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFS--AANVPIEWESCDVSPIFVNGLTT---IPDPAVQSI 92

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + VD+V++
Sbjct: 93  TKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  + V
Sbjct: 150 RENTEGEYSGIEHIVCPG----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VA 261
            HKS +   +DGLF  + K++ +    +Y  +    ++ID+ V ++   P  Y D + V 
Sbjct: 202 VHKSTIQRLADGLFVNVAKELSK----EYPDLTLETELIDNSVLKVVTNPSAYTDAVSVC 257

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  I + E  HGSAPDIAG+  ANP A + S+
Sbjct: 258 PNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G    A  I  AV S +    EN  +T DL G ++T +  + V+++L
Sbjct: 318 VMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  162 bits (410), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 194/365 (53%), Gaps = 33/365 (9%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           S  I ++PGD +G+E+     +VL+ +S  R    FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 82  KVLKEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPVK---------SVA 130
           +  K +   VL GAV  P   T        ++ +RKELQLYAN+RP           S  
Sbjct: 62  EASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPL 120

Query: 131 GAHSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVAL 190
            A   +  D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +AL
Sbjct: 121 KAQYAQGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLAL 177

Query: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
           Q    N    +    K+NVL+ S  L+R   K V +  K+++  ++ N Q+IDS    + 
Sbjct: 178 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILV 230

Query: 251 REPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAP 303
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 231 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 290

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQN 362
           D+A KG  NP+ATI S A+ML+  L   E    I KAV+  + ++ I+T DLGG++ST  
Sbjct: 291 DLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVK-KVLDDGIRTGDLGGSNSTSE 348

Query: 363 VVDDV 367
           V D V
Sbjct: 349 VGDAV 353

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  162 bits (409), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 191/351 (54%), Gaps = 23/351 (6%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+ LIPGDG+GKE+  +   + +  +    +++  +D+        D  +A+  E++K  
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFE--AENIPVDWERVDISTS-DNIQDVSQAV--ESLKRN 82

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKP-VDMVIV 143
           K   +G+        +  + ++ S  VALRK+L ++A++   KSV G  +  P VD+V++
Sbjct: 83  KIGLKGIW-----HTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVI 137

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  +E  ++   G  V E+ K IT+  + +IA+ A D A    K   + ++  
Sbjct: 138 RENTEGEYSGLE--HESVPG--VVESLKIITKAKSERIARFAFDFA----KKYNRKSVCA 189

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAPN 263
            HK+N++   DGLFR    ++     ++Y  I  +  I+D+   +   +P  FDV+V P+
Sbjct: 190 VHKANIMKMGDGLFRNTVTEI---GANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVTPS 246

Query: 264 LYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHGSAPDIAGKGIANPIATIRSTAL 322
           +YG I+ +  AAL+G  G+V  A+ G +  + EP       DI GK +ANP A I S+ L
Sbjct: 247 MYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTL 306

Query: 323 MLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLAK 373
           ML+ LG  E+A+ I KA    +   ++ T D+GG++ST    + ++++L +
Sbjct: 307 MLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRLGE 357

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  162 bits (409), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 187/354 (52%), Gaps = 29/354 (8%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           T+  I GDGIG E+  + K++    ++   + +   D+   F   L T   +PD  V+ +
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFN--AANVPIEWESCDVNPIFVNGLTT---IPDAAVQSI 92

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143
                  L G + +P  +   + S  + LRK   L+AN+RP KSV G  +  + VD+V++
Sbjct: 93  TNNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +  G+  + V
Sbjct: 150 RENTEGEYSGIEHIVCPG----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201

Query: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261
            HKS +   +DGLF  + K++ +    +Y  I    ++ID+ V ++   P  +   V V 
Sbjct: 202 VHKSTIQRLADGLFVNVAKELSK----EYPDIILETELIDNSVLKVVTNPSAYTNAVSVC 257

Query: 262 PNLYGDILSDGAAAL-VGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320
           PNLYGDILSD  + L  GSLG+ PSAN+G  I + E  HGSAPDIAG+  ANP A + S+
Sbjct: 258 PNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317

Query: 321 ALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPDLGGNSSTQNVVDDVLEKL 371
            +ML  +G    A  I  AV S +    EN  +T DL G ++T +  + V+++L
Sbjct: 318 VMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKRL 369

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  162 bits (409), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 203/388 (52%), Gaps = 37/388 (9%)

Query: 1   MLRSVVTKSATIRHLSTK--GINK----------SLTIGLIPGDGIGKEVIPAGKQVLQN 48
           M +S V + A  R  S+K   I K          +  +  I GDGIG E+  + K +   
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA- 59

Query: 49  LSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSS 108
            +++  ++F  + ++      ++   ++P+E  K +       L G + +P  +   + S
Sbjct: 60  -AAKVPVDFESVVVKP---ILVNGVTSIPEEAQKSINTNLVA-LKGPLATPVGK--GHRS 112

Query: 109 PIVALRKELQLYANIRPVKSVAGAHS-GKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVA 167
             + LRK   L+AN+RP KSV G  +    V++V++RENTE  Y  IE +        V 
Sbjct: 113 MNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPG----VV 168

Query: 168 EATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQA 227
           ++ K IT  A+ ++ + A + A    +   +  L V HKS +   SDGLF ++ K++   
Sbjct: 169 QSIKLITREASERVIRFAYEYA----RAAERPRLIVVHKSTIQRLSDGLFVDVAKEL--- 221

Query: 228 NKDKYAGINYNEQIIDSMVYRMFREP-EYFDVI-VAPNLYGDILSDGAAAL-VGSLGVVP 284
            + ++  I    ++ID+ V     +P +Y D + V PNLYGDILSD  + L  GSLG+ P
Sbjct: 222 -QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTP 280

Query: 285 SANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNM 344
           S N+G  + + E  HGSAPDIAGK  ANP A + S+ +ML  +G  E A  I KAV + +
Sbjct: 281 SGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTI 340

Query: 345 REN-KIKTPDLGGNSSTQNVVDDVLEKL 371
               + +T DL G++ST +  + V++KL
Sbjct: 341 AAGPESRTGDLKGSASTSSFTEAVIKKL 368

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 192/380 (50%), Gaps = 29/380 (7%)

Query: 1   MLRSVVTKSATIRHLSTKGINK---SLTIGLIPGDGIGKEVIPAGKQVL--QNLSSRHGL 55
           MLR +V+K +      T   NK     T+ L+PGDG+GKE   +   V   +N+      
Sbjct: 1   MLRRLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIP----- 55

Query: 56  NFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRK 115
               ID E    + LD  + +    V+ L+    G L G   +       + S  VA RK
Sbjct: 56  ----IDWEIVNISGLDHKEGVA-AAVQSLRRNKIG-LKGLWHTSNADQSGHGSLNVAFRK 109

Query: 116 ELQLYANIRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRIT 174
           +L +YAN+   KS+ G  +  P VD+V++RENTE  +  +E    +     V E+ K  T
Sbjct: 110 QLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEG----VVESLKVTT 165

Query: 175 EVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAG 234
              T +IA+ A + A    + NG+  +   HK+N++   DGLFR     +    + +Y  
Sbjct: 166 LPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSI---GEKEYPD 218

Query: 235 INYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVM 294
           I  +  I+D+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G +  +
Sbjct: 219 IETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGREYAV 278

Query: 295 GEP-CHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPD 353
            EP       DI G+ IANP A + S+ALML  LG  ++ + I  AV   + E  ++T D
Sbjct: 279 FEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDVRTKD 338

Query: 354 LGGNSSTQNVVDDVLEKLAK 373
           +GG+++T      V+EKL++
Sbjct: 339 IGGDATTTEFTQAVIEKLSQ 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  160 bits (406), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 194/366 (53%), Gaps = 33/366 (9%)

Query: 28  LIPGDGIGKEVIPAGKQVLQNL-SSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKE 86
           ++PGD IG+EVI    +VL  +  +R  +NF F     G      TG  L D+T++  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 87  QCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPV----KSVAGAHSGKP--- 137
               VL GAV  P   +        ++A+RKEL LYAN+RP     KS+ G    KP   
Sbjct: 68  AADAVLLGAVGGPEWDSGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEIA 127

Query: 138 --VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKT 195
              D VI+RE    +Y       K+ +G  VA  +++ T     +I ++   +ALQ    
Sbjct: 128 QGTDFVILRELVGGIYFG---ERKEDDGDGVAWDSEKYTVSEVERITRMGAFLALQH--- 181

Query: 196 NGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEY 255
           +    L    K+NVL+ S  L+R   + V +  K ++  ++   Q+IDS    M + P  
Sbjct: 182 DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNPRK 237

Query: 256 FD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIAGK 308
           F+ +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+  K
Sbjct: 238 FNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE-K 296

Query: 309 GIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDV 367
           G ANPIA I S A+ML+  L   +  + I  AV+  + E+ I+T DLGGN++T  V D V
Sbjct: 297 GQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNNTTTEVGDAV 355

Query: 368 LEKLAK 373
              L K
Sbjct: 356 THALKK 361

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  157 bits (397), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 190/362 (52%), Gaps = 33/362 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R  + F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPVK---------SVAGAH 133
           K +   VL GAV  P   T        ++ +RKELQLYAN+RP           S   A 
Sbjct: 67  K-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKAE 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             +  D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +ALQ  
Sbjct: 126 HARGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
             N    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    M + P
Sbjct: 182 --NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + VI+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 TQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            KG  NPIATI S A+MLE  L   E    + +AV   + ++ I+T DL G++STQ V D
Sbjct: 296 -KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVR-RVLDSGIRTGDLRGSNSTQEVGD 353

Query: 366 DV 367
            V
Sbjct: 354 AV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  157 bits (396), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 196/368 (53%), Gaps = 33/368 (8%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R  +NF+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVKSVAGA---------H 133
           K +   VL GAV  P     +      ++ +RKELQLYAN+RP    + +          
Sbjct: 67  K-KADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             K  D V+VRE    +Y       K+ +G  VA  +++ T    ++I ++A  +ALQ  
Sbjct: 126 FAKGTDFVVVRELVGGIYFG---KRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
                  +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
            + + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 THLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            K   NPIATI S A+ML+  L   E  + I  AV+  + +  I+T DLGG++ST  V D
Sbjct: 296 -KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEVGD 353

Query: 366 DVLEKLAK 373
            V +++ K
Sbjct: 354 AVAKEVKK 361

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  157 bits (396), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 123/379 (32%), Positives = 191/379 (50%), Gaps = 29/379 (7%)

Query: 1   MLRSVVTKSATIRHLSTKGINKS--LTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFN 58
           ML S   K  +I   + K   K+   T+  I GDG+G E+  + K +             
Sbjct: 14  MLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDIFA------AAKVP 67

Query: 59  FIDLEAGFQTFLDTG-KALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKEL 117
            +         L  G   +P++  + +       L G + +P  +   + S  + LRK  
Sbjct: 68  IVWESCPVTPLLVNGVTTIPEQAQESINRNLVA-LKGPLATPIGK--GHRSMNLTLRKTF 124

Query: 118 QLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEV 176
            L+AN+RP KSV G  +  + VD+V++RENTE  Y  IE          V ++ K IT  
Sbjct: 125 GLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPG----VVQSIKLITRE 180

Query: 177 ATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGIN 236
           A+ ++ + A + A    +  G+  L V HKS +   +DGLF  + K++      ++  I 
Sbjct: 181 ASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLFVTVAKELAH----EFPDIQ 232

Query: 237 YNEQIIDSMVYRMFREP-EYFDVI-VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPDIV 293
              ++ID+ V  +   P +Y DV+ V PNLYGDILSD  + L  GSLG+ PS N+G  + 
Sbjct: 233 LQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVS 292

Query: 294 MGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMREN-KIKTP 352
           + E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV + +    + +T 
Sbjct: 293 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTG 352

Query: 353 DLGGNSSTQNVVDDVLEKL 371
           DL G++ST +  + V+ +L
Sbjct: 353 DLAGSASTSSFTEAVISRL 371

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  156 bits (395), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 195/368 (52%), Gaps = 33/368 (8%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVKSVAGA---------H 133
           K +   VL GAV  P     +      ++ +RKELQLYAN+RP    + +          
Sbjct: 67  K-KADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKPQ 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             K  D V+VRE    +Y       K+ +G  VA  +++ T    ++I ++A  +ALQ  
Sbjct: 126 FAKGTDFVVVRELVGGIYFG---KRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
                  +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
            + + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 THLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            K   NPIATI S A+ML+  L   E  + I  AV+  + +  I+T DLGG++ST  V D
Sbjct: 296 -KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEVGD 353

Query: 366 DVLEKLAK 373
            V E++ K
Sbjct: 354 AVAEEVKK 361

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  156 bits (395), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 199/377 (52%), Gaps = 33/377 (8%)

Query: 11  TIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTF 69
           +  H +T     +  I ++PGD +G+E+     +VL  +SS R  +NF+F     G    
Sbjct: 75  STHHSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAI 134

Query: 70  LDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVK 127
             TG  LPDE ++  K +   VL GAV  P     +      ++ +RKELQLYAN+RP  
Sbjct: 135 DATGVPLPDEALEASK-KADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCN 193

Query: 128 ----SVAGAHSGKP-----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVAT 178
               S+      KP      D+ IVRE    +Y       K+  G  VA  +++ +    
Sbjct: 194 FASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFG---ERKEDEGDGVAWDSEKYSVSEV 250

Query: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238
           ++I ++A  +ALQ    N    +    K+NVL+ S  L+R   K V +  K+++  +   
Sbjct: 251 QRITRMAGFLALQH---NPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQ 303

Query: 239 EQIIDSMVYRMFREPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD---- 291
            Q+IDS    + + P + + V++A N++GDI+SD A+ + GSLG++PSA++   PD    
Sbjct: 304 HQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTA 363

Query: 292 IVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIK 350
             + EPCHGSAPD+  KG  NP+ATI S A+ML+  L   E    + KAV+  + ++ ++
Sbjct: 364 FGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVR 421

Query: 351 TPDLGGNSSTQNVVDDV 367
           T DL G++ST  V D +
Sbjct: 422 TADLRGSNSTSEVGDAI 438

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 193/368 (52%), Gaps = 33/368 (8%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R  + F+F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVK---------SVAGAH 133
           K +   VL GAV  P     +      ++ +RKELQLYAN+RP           S     
Sbjct: 67  K-KADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKPQ 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             K  D V+VRE    +Y       K+ +G  VA   ++ T    ++I ++A  +ALQ  
Sbjct: 126 FAKGTDFVVVRELVGGIYFG---ERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
                  +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
            + + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 THLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            K   NP+ATI S A+ML+  L   E  + I  AV+  + +  I+T DLGG++ST  V D
Sbjct: 296 -KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVK-RVLDAGIRTGDLGGSNSTTEVGD 353

Query: 366 DVLEKLAK 373
            V +++ K
Sbjct: 354 AVAKEVKK 361

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  150 bits (380), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 189/363 (52%), Gaps = 34/363 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNL--SSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
           I ++PGD +G+E++    +VL+ +  SS  G+ F F     G  +   TG  LPDE +  
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 84  LKEQCQGVLFGAVQSPTTRVDNY--SSPIVALRKELQLYANIRPVKSVAGAHSG------ 135
            K     VL GAV  P     +      ++ +RKELQLYAN+RP   V+ +  G      
Sbjct: 66  AK-NSDAVLLGAVGGPKWGTGDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLKE 124

Query: 136 ---KPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQR 192
              K  D  +VRE    +Y       K+ +G   A   ++ T    ++I ++A  +ALQ 
Sbjct: 125 EIAKGTDFTVVRELVGGIYFG---DRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQH 181

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFRE 252
              +    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + 
Sbjct: 182 ---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMILVKS 234

Query: 253 PEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDI 305
           P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+
Sbjct: 235 PRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDL 294

Query: 306 AGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVV 364
             KG  NPIATI S A+ML+  L   +    I +AV+  + +  I+T DL G++ST  V 
Sbjct: 295 P-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVK-QVLDAGIRTADLKGSNSTSEVG 352

Query: 365 DDV 367
           D V
Sbjct: 353 DAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 196/366 (53%), Gaps = 41/366 (11%)

Query: 26  IGLIPGDGIGKEVIPAGKQVL----QNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           I ++PGD IG+EV+    +VL    Q+LS  H   F+F     G      TG ALPDE +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 82  KVLKEQCQGVLFGAVQSPTTR--VDNYSSPIVALRKELQLYANIRPVKSVAGA------- 132
              KE    VL GAV  P  +         ++ LR+EL +YAN+RP    A +       
Sbjct: 64  GAAKE-ADAVLLGAVGGPKWQGGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPL 122

Query: 133 --HSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVAL 190
                +  D+++VRE     Y    + ++D+ G  VA  T + T    ++IA++A  +AL
Sbjct: 123 RPEIARDTDIMVVRELLGGSYFG--ERHEDE-GDGVAWDTDKYTVKEVQRIARMAGFLAL 179

Query: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
           Q    +    +    K+NVL+ S  L+R+  ++ +Q+   ++  +    Q+IDS    + 
Sbjct: 180 QH---DPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMILV 232

Query: 251 REPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAP 303
           + P  F+ V+V  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 233 KNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAP 292

Query: 304 DI-AGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQ 361
           D+ AGK  ANPI  I S A+ML+  L    A + + +AV+  + ++ ++T DL G+SST 
Sbjct: 293 DLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSSTS 349

Query: 362 NVVDDV 367
            V D +
Sbjct: 350 EVGDAI 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 190/364 (52%), Gaps = 34/364 (9%)

Query: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRH--GLNFNFIDLEAGFQTFLDTGKALPDETVK 82
           TI ++PGD +G+E+     +VL  +       +NF F     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 83  VLKEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPVK----SVAGAHSGK 136
             K +   VL GAV  P   T        ++ +RKELQLYAN+RP      S+      K
Sbjct: 66  ASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 137 P-----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQ 191
           P      D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +ALQ
Sbjct: 125 PEIARGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQ 181

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFR 251
               N    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + +
Sbjct: 182 H---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMILVK 234

Query: 252 EPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPD 304
            P + + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD
Sbjct: 235 NPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 294

Query: 305 IAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNV 363
           +  KG  NP+ATI S A+ML+  L   E  + I +AV+  + ++ I+T DL G +ST  V
Sbjct: 295 LP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTTEV 352

Query: 364 VDDV 367
            D V
Sbjct: 353 GDAV 356

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           S  I ++PGD +GKEV     +VL  ++  R  + FNF     G      TG  LPDE +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 82  KVLKEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPVKSVAGA------- 132
           +  K +   VL GAV  P   T        ++ +RKEL LYAN+RP    + +       
Sbjct: 62  EASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPL 120

Query: 133 --HSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVAL 190
                K  D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +AL
Sbjct: 121 KPEYAKGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLAL 177

Query: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
           Q+   N    +    K+NVL+ S  L+R   K V +  K ++  +    Q+IDS    + 
Sbjct: 178 QQ---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILV 230

Query: 251 REPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAP 303
           + P   + V++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 231 KSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAP 290

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQN 362
           D+    + NPIATI S A+ML+  L   E  + + +AV  N+ +  ++T DLGG++ST  
Sbjct: 291 DLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNSTTE 348

Query: 363 VVDDV 367
           V D +
Sbjct: 349 VGDAI 353

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  147 bits (371), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 192/362 (53%), Gaps = 33/362 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ ++   + +NF+F     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 85  KEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPV----KSVAGAHSGKP- 137
           K     VL GAV  P   T        ++ +RKEL LYAN+RP     +S+ G    +P 
Sbjct: 66  K-NSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRPE 124

Query: 138 ----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
                D ++VRE    +Y       K+  G  VA  +++ +    ++I ++A  +ALQ  
Sbjct: 125 IAKGTDFMVVRELVGGIYFG---KRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQH- 180

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
             N    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 181 --NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVKNP 234

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 235 TQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP 294

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            KG  NPIATI S A+ML+  L   +    I +AV+  + +  I+T DLGG++ST  V D
Sbjct: 295 -KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVK-KVLDAGIRTGDLGGSNSTTEVGD 352

Query: 366 DV 367
            +
Sbjct: 353 AI 354

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 193/368 (52%), Gaps = 33/368 (8%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R  + F+F     G      TG  L DE ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPV----KSVAGAHSGKP- 137
           K +   VL GAV  P     +      ++ +RKELQLYAN+RP     +S+      KP 
Sbjct: 67  K-KADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKPQ 125

Query: 138 ----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
                D V+VRE    +Y       K+ +G  VA  +++ T    ++I ++A  +ALQ  
Sbjct: 126 FARGTDFVVVRELVGGIYFG---KRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
                  +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --QPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 TQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            K   NPIATI S A+ML+  L      Q I  AV+  + +  I+T DLGG++ST  V D
Sbjct: 296 -KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSNSTIEVGD 353

Query: 366 DVLEKLAK 373
            V +++ K
Sbjct: 354 AVAKEVKK 361

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  145 bits (367), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 192/366 (52%), Gaps = 33/366 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL+ +S  R    F F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  KEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPV----KSVAGAHSGKP- 137
           K +   VL GAV  P   T        ++ +RKELQLYAN+RP     +S+      KP 
Sbjct: 67  K-KSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKPE 125

Query: 138 ----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
                D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +ALQ  
Sbjct: 126 CARGTDFVVVRELVGGIYFG---ERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
             +    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --SPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVKNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + VI+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 TQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            KG  NPIATI S A+ML+  L   E    + +AV   + ++ ++T DL G S+T  V +
Sbjct: 296 -KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADLKGTSTTSEVGE 353

Query: 366 DVLEKL 371
            V++ L
Sbjct: 354 AVVKAL 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 189/365 (51%), Gaps = 33/365 (9%)

Query: 23  SLTIGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETV 81
           S  I ++PGD  G+E+     +VL+ +S       FNF     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVK---------SVA 130
              K+    VL GAV  P     +      ++ +RKELQLYAN+RP           S  
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPL 120

Query: 131 GAHSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVAL 190
                K  D V+VRE    +Y       K+  G  VA  +++ T+   +++ ++A  +AL
Sbjct: 121 KPQHAKGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEKYTKPEVQRLTRMAAFLAL 177

Query: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
           Q    N    +    K+NVL+ S  L+R   K V +  K+++  +  N Q+IDS    + 
Sbjct: 178 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILV 230

Query: 251 REPEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAP 303
           + P   + +++  NL+GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAP
Sbjct: 231 KSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAP 290

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQN 362
           D+  KG  NPIA I S A+ML+  L   +  + + KAV+  + ++ ++T DLGG++ST  
Sbjct: 291 DLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK-QVLDSGVRTGDLGGSNSTSE 348

Query: 363 VVDDV 367
           V D +
Sbjct: 349 VGDAI 353

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  142 bits (358), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 168/313 (53%), Gaps = 24/313 (7%)

Query: 3   RSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDL 62
           RS+ T +A + H+  K      T+ LIPGDG+GKEV  + K + +  +    +++  I++
Sbjct: 9   RSLAT-AAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFE--AENIPIDWETINI 65

Query: 63  EAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYAN 122
           +   QT    G    +E V+ L+    G L G   +P  +   + S  VALRK+L +YAN
Sbjct: 66  K---QTDHKEGV---NEAVESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYAN 117

Query: 123 IRPVKSVAGAHSGKP-VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKI 181
           +   KS+ G  +  P +D++++RENTE  +  +E     ++   V E+ K +T+  T +I
Sbjct: 118 VALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEH----ESVPGVVESLKIMTKPKTERI 173

Query: 182 AKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQI 241
           A+ A D A    K   +  +T  HK+N++   DGLFR I  ++ Q    +Y  I+ +  I
Sbjct: 174 ARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQ---KEYPDIDVSSII 226

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEP-CHG 300
           +D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G D  + EP    
Sbjct: 227 VDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 301 SAPDIAGKGIANP 313
              DI G+ +ANP
Sbjct: 287 VGLDIKGQNVANP 299

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 186/364 (51%), Gaps = 33/364 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I ++PGD +G+E+     +VL  +S  R  + F++     G      TG  LPDE +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 85  KEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVKSVAGA---------H 133
           K+    VL GAV  P            ++ +RKELQLYAN+RP    + +          
Sbjct: 67  KKADA-VLLGAVGGPKWGTGQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKPE 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             K  D V+VRE    +Y       K+  G  VA  +++ +    ++I ++A  +ALQ+ 
Sbjct: 126 YAKGTDFVVVRELVGGIYFG---ERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQ- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
             N    +    K+NVL+ S  L+R   K V +  K+++  +    Q+IDS    + + P
Sbjct: 182 --NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVKSP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + +++  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+ 
Sbjct: 236 TKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVD 365
            K   NPIATI S A+ML+  L   E    + +AV   + +  I+T DL G +ST  V D
Sbjct: 296 -KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVR-RVLDAGIRTADLRGENSTSEVGD 353

Query: 366 DVLE 369
            V++
Sbjct: 354 AVVK 357

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  134 bits (337), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 185/363 (50%), Gaps = 34/363 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSSRHG--LNFNFIDLEAGFQTFLDTGKALPDETVKV 83
           I ++PGD +G E+     +VL+ +       + F+F     G       G  L DE ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 84  LKEQCQGVLFGAVQSPT--TRVDNYSSPIVALRKELQLYANIRPV----KSVAGAHSGKP 137
            K +   VL GAV  P   T        ++ +RKEL LYAN+RP     + + G    +P
Sbjct: 67  SK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLRP 125

Query: 138 -----VDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQR 192
                 D ++VRE    +Y       K+ +G  VA  +++ +     +I ++A  +ALQ 
Sbjct: 126 EIAKGTDFMVVRELVGGIYFG---ERKEDDGDGVAWDSEKYSVPEVERITRMAAFLALQH 182

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFRE 252
              N    +    K+NVL+ S  L+R   K V    K+++  +    Q+IDS    + + 
Sbjct: 183 ---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILVKN 235

Query: 253 PEYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDI 305
           P   + +I+  N++GDI+SD A+ + GSLG++PSA++   PD      + EPCHGSAPD+
Sbjct: 236 PTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDL 295

Query: 306 AGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVV 364
             K   NP+ATI S A+ML+  L   +  + + +AV   + +  ++T DLGG++STQ V 
Sbjct: 296 P-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVR-RVLDAGVRTGDLGGSNSTQEVG 353

Query: 365 DDV 367
           D +
Sbjct: 354 DAI 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  133 bits (335), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 113/365 (30%), Positives = 184/365 (50%), Gaps = 38/365 (10%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS--RHGLNFNFIDLEAGFQTFLDTGKALPDETVKV 83
           I ++PGD +G EV     ++L+ +     + + FNF     G      TG  LPDE+++ 
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 84  LKEQCQGVLFGAVQSPTTRVDNYSSP--IVALRKELQLYANIRPVKSVAGA--------- 132
            K +   VL GAV  P     +      ++ +RKELQLYAN+RP    + +         
Sbjct: 67  SK-RADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKE 125

Query: 133 HSGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQR 192
              K  D  +VRE    +Y       K+ +G  VA  +++ +    ++I ++A  +A+Q 
Sbjct: 126 KYAKGTDFTVVRELVGGIYFG---KRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQH 182

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFRE 252
              N    +    K+NVL+ S  L+R+  ++  Q   +++  +  + Q+IDS    + + 
Sbjct: 183 ---NPPLPIWSLDKANVLASSR-LWRKTVEETIQ---NEFPSLKVSHQLIDSAAMILVKN 235

Query: 253 PEYFD-VIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPDIVMGEPCHGSAP 303
           P   + +I+  N++GDI+SD A+ + G        SL  +P  N      + EPCHGSAP
Sbjct: 236 PTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYEPCHGSAP 293

Query: 304 DIAGKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQN 362
           D+  KG  NPI TI S A+ML+  L  KE    + +AV   + +N I+T DLGG++ST +
Sbjct: 294 DLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVR-RVLDNNIRTADLGGSNSTSD 351

Query: 363 VVDDV 367
           + D V
Sbjct: 352 IGDAV 356

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 184/358 (51%), Gaps = 33/358 (9%)

Query: 26  IGLIPGDGIGKEVIPAGKQVLQNLSS-RHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84
           I + PGD IG E++    +VL  ++     ++F +     G      TG+ L DE ++V 
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQVA 66

Query: 85  KEQCQGVLFGAVQSPTTR--VDNYSSPIVALRKELQLYANIRPVKSVAGA---------H 133
           K     +L GAV  P     +      ++ +RKEL +YAN+RP + V+            
Sbjct: 67  K-NSDAILLGAVGGPKWGHGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKRE 125

Query: 134 SGKPVDMVIVRENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRL 193
             +  D VIVRE    +Y   E+     +G+   + +  + E+  ++I ++A  +ALQ  
Sbjct: 126 IVQGTDFVIVRELVGGIYFG-ERQEAGDDGVAWDKESYSVPEI--QRITRMAAFLALQH- 181

Query: 194 KTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREP 253
             N    +    K+NVL+ S  L+R   K V +  K+++  +  N  +IDS    + + P
Sbjct: 182 --NPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLVQNP 235

Query: 254 EYFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG--PD----IVMGEPCHGSAPDIA 306
              + V++  N++GDI+SD A+ + GSLG++PSA++   PD    + + EPCHGSAPD+ 
Sbjct: 236 TKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPDLP 295

Query: 307 GKGIANPIATIRSTALMLEF-LGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNV 363
               ANPIATI S A+M +  L   +    I +AV+  + +  IKT DLGG ++T  V
Sbjct: 296 ADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGKNTTTEV 351

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY--AGINY 237
            AK + ++ALQR     K  L  T K+ +L + DG F++I + +Y A  K+K+  AGI Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 109/235 (46%), Gaps = 34/235 (14%)

Query: 166 VAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY 225
           VA A    TE + R  A+ + ++ALQR     K  L  T K+ +L + DG F++  + +Y
Sbjct: 180 VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 226 QAN-KDKY--AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGV 282
           +A  ++++  AGI Y  ++ID MV +M +    F VI   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 283 VPSANVGPD--IVMGEPCHGS----------APDIAGKGIANPIATIRSTALMLEFLGHK 330
           + S  V PD      E  HG+            + +   IA+  A  R         G  
Sbjct: 293 MTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTP 352

Query: 331 EA---AQDIHKAVESNMRENKIKTPDLG---GNS------STQNVVDDVLEKLAK 373
           E    A+ +  A  + + E+ I T DL    G +      +T++ +D V ++L +
Sbjct: 353 EVEGFARALETATVATVNEDGIMTKDLALMLGRTDRASYVTTEDFIDAVEQRLIR 407

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 12/141 (8%)

Query: 166 VAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY 225
           VA A    TE  T   AK + ++AL+R     K  L  T K+ +L + DG F++I + +Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 226 QAN-KDKYA--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGV 282
            ++ +DK+   GI Y  ++ID MV +M +    + +I   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 283 VPSANVGPD--IVMGEPCHGS 301
           + S  V PD      E  HG+
Sbjct: 291 MSSVLVTPDGKTFESEAAHGT 311

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 93/212 (43%), Gaps = 24/212 (11%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T+ +    A  +  VAL     N K  L +  K+ +L + DG F++I + +Y    K K+
Sbjct: 197 TDESIEGFAHSSFQVAL-----NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKF 251

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 252 EQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSP 310

Query: 291 D--IVMGEPCHGS----------APDIAGKGIANPIATIRSTALMLEFLGHKEA---AQD 335
           D      E  HG+            + +   IA+  A  R  A   E  G K+    A  
Sbjct: 311 DGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANK 370

Query: 336 IHKAVESNMRENKIKTPDLGGNSSTQNVVDDV 367
           +  A   +++E+ I T DL   S   N  D V
Sbjct: 371 LEAATLDSVQEDGIMTKDLALASGKNNRSDYV 402

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY--AGINY 237
            AK + ++AL+R     K  L  T K+ +L + DG F++I + +Y+   K K+   GI Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 308 EAAHGT 313

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN---KDKYAGINY 237
            A+ + ++A++R     K  L  T K+ +L + DG F++I + +Y  +   K K  GI+Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + PD  I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 307 EAAHGT 312

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKY 232
           T+ + R  A  +  +AL +     +  L ++ K+ +L Q DG F++I ++VY Q  + ++
Sbjct: 195 TDESIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIFQEVYAQEYQTQF 249

Query: 233 --AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI+Y  ++ID MV +M +    F V+   N  GD+LSD  A   GSLG++ S  V P
Sbjct: 250 RDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGSLGLMTSMLVTP 308

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 309 DGKTFESEAAHGT 321

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKY- 232
           TE + R  A  +  +AL +     K  L ++ K+ +L + DG F++I +++Y A   K  
Sbjct: 195 TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQF 249

Query: 233 --AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
             AGI Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 250 EAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 308

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 309 DGKTFESEAAHGT 321

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 107/233 (45%), Gaps = 36/233 (15%)

Query: 153 KIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDV------------ALQRLKTNGKAT 200
           K+E  YK ++G   +E TK   EV   K A +AL +            A  +L  N K  
Sbjct: 164 KLELVYKPEDG---SEPTK--LEVYDYKGAGVALAMYNTDESIRGFAHASFKLALNKKLN 218

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY--AGINYNEQIIDSMVYRMFREPEYFD 257
           L ++ K+ +L + DG F++I ++++ A  K ++  A I+Y  ++ID MV +M +    F 
Sbjct: 219 LFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF- 277

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS----------APDI 305
           ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+            + 
Sbjct: 278 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKET 337

Query: 306 AGKGIANPIATIRSTALMLEFLGHKEA---AQDIHKAVESNMRENKIKTPDLG 355
           +   IA+  A  R  A   E  G  E    A  +  A  + ++E+ I T DL 
Sbjct: 338 STNSIASIFAWTRGLAKRGELDGTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T  + +  A+ + ++AL+R     K  L  T K+ VL + DG F++I +++Y+++ K ++
Sbjct: 188 TRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQF 242

Query: 233 --AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 243 DEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAP 301

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T+ + R  A  +  +ALQ+     K  L ++ K+ +L + DG F++I ++VY +  K K+
Sbjct: 197 TDESIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 233 AGIN--YNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
           A +N  Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 311 DGKTFESEAAHGT 323

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYR 248
           +L  + K  L ++ K+ +L + DG F++I ++VY+A  K K+   GI+Y  ++ID MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 74/144 (51%), Gaps = 16/144 (11%)

Query: 163 GMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK 222
            M +   T+ IT+      AK + + AL+R     K  L  T K+ +L Q DG F++I +
Sbjct: 185 AMTMYNTTESITD-----FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFE 234

Query: 223 DVY-QANKDKYAGIN--YNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGS 279
           ++Y +  +DK+  +N  Y  ++ID MV +M +    F +I   N  GD+ SD  A   GS
Sbjct: 235 EMYAKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGS 293

Query: 280 LGVVPSANVGPD--IVMGEPCHGS 301
           LG++ S  + PD      E  HG+
Sbjct: 294 LGLMTSVLLTPDGSSFESEAAHGT 317

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 91/182 (50%), Gaps = 19/182 (10%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYR 248
           +L  N K  L ++ K+ +L + DG F++I +++Y+++ K ++   GI+Y  ++ID MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGSAP--- 303
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+     
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 327

Query: 304 ---DIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHK-------AVESNMRENKIKTPD 353
              +   +   N IA+I + +  L   G  ++  D+ K       A  + ++++ I T D
Sbjct: 328 RQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLNTVQQDGIMTKD 387

Query: 354 LG 355
           L 
Sbjct: 388 LA 389

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYR 248
           +L  + K  L ++ K+ +L + DG F++I ++VY+A  K K+   GI+Y  ++ID MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 11/130 (8%)

Query: 177 ATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA-- 233
           + +  AK +  +AL+R     K  L +  K+ +L + DG F+ I  D+YQ   K+K+   
Sbjct: 191 SIKGFAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKL 245

Query: 234 GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD-- 291
           G+ Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + PD  
Sbjct: 246 GLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGK 304

Query: 292 IVMGEPCHGS 301
               E  HG+
Sbjct: 305 TFQSEAAHGT 314

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 96/213 (45%), Gaps = 26/213 (12%)

Query: 106 YSSPIVALRKELQLYANIRPVKSVAGAHSG----KPVDMVIVRENTEDLYIKIEKSYKDQ 161
           +  PIV  R    +    +P+    G H+     K  D VI  E    L  K +    DQ
Sbjct: 109 FREPIVIPRIPRMVSQWEKPI--TIGRHAFGDQYKATDTVIPDEGELKLVFKSKDGKHDQ 166

Query: 162 N--------GMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQS 213
           +        G  VA A    TE +    AK + ++AL+R     K  L  T K+ +L + 
Sbjct: 167 DLQVFEFPKGGGVAMAMYNTTE-SIEGFAKASFELALER-----KQPLYSTTKNTILKKY 220

Query: 214 DGLFREICKDVYQA---NKDKYAGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILS 270
           DG F++I + +Y+    ++ +  GI Y  ++ID MV +M +    + +I   N  GD+ S
Sbjct: 221 DGKFKDIFEAMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQS 279

Query: 271 DGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           D  A   GSLG++ S  V PD      E  HG+
Sbjct: 280 DIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 312

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINY 237
            AK + ++AL+R     K  L    K+ +L + DGLF++I + +Y+ + K K+   GI +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V PD  +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYR 248
           +L  + K  L ++ K+ +L + DG F++I + VY+A  K K+   GI+Y  ++ID MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 72/147 (48%), Gaps = 22/147 (14%)

Query: 163 GMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK 222
           GM +   T+ IT       AK + ++AL+R     K  L  T K+ +L + DG F+++ +
Sbjct: 178 GMAMYNTTESIT-----GFAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFE 227

Query: 223 DVYQANKDKYA------GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAAL 276
            +Y    D+Y       GI Y  ++ID MV +M +    F +I   N  GD+ SD  A  
Sbjct: 228 QMY---ADQYQSRFEELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQG 283

Query: 277 VGSLGVVPSANVGPD--IVMGEPCHGS 301
            GSLG++ S  V PD      E  HG+
Sbjct: 284 FGSLGLMTSVLVTPDGKTFESEAAHGT 310

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINY 237
            AK +  +A++R     K  L  T K+ +L + DG+F++I + +Y+   K+K+   GI Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 89/182 (48%), Gaps = 19/182 (10%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYAGIN--YNEQIIDSMVYR 248
           +L  + K  L ++ K+ +L + DG F+++ ++V+ +  KDK+  +N  Y  ++ID MV +
Sbjct: 220 KLAIDKKLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQ 279

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGSAP--- 303
           M +    + ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+     
Sbjct: 280 MIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHY 338

Query: 304 --DIAGKGIA-NPIATIRSTALMLEFLGH-------KEAAQDIHKAVESNMRENKIKTPD 353
                GK  + N IA+I + +  L   G         + AQ + KA    ++E+ I T D
Sbjct: 339 RQHQQGKQTSTNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKD 398

Query: 354 LG 355
           L 
Sbjct: 399 LA 400

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 70/133 (52%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           TE + R  A  +  +AL +     +  L ++ K+ +L Q DG F+++ +++YQA  K ++
Sbjct: 202 TEESIRGFAHASFRLALAK-----QLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEF 256

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 257 ERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 316 DGKTFESEAAHGT 328

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQA---NKDKYAGINY 237
            A+ + ++ALQR     +  L  T K+ +L + DG F+++ + +Y A   ++ +  GI Y
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELGIWY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 177 ATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA-- 233
           A    A+ +  +AL+R     +  L  T K+ +L + DG F+ + +D+Y+   K ++   
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 234 GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD-- 291
           GI Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V PD  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 292 IVMGEPCHGS 301
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 83/171 (48%), Gaps = 18/171 (10%)

Query: 158 YKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLF 217
           YK  NG  V  A    T+ + R  A  +  +AL +     K  L ++ K+ +L + DG F
Sbjct: 187 YKFANGGGVGLAMYN-TDESIRGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRF 240

Query: 218 REICKDVYQAN-KDKY--AGINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAA 274
           +++ ++++ A  K ++  +GI Y  ++ID MV +M +    F ++   N  GD+ SD  A
Sbjct: 241 KDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVA 299

Query: 275 ALVGSLGVVPSANVGPD--IVMGEPCHGSAPDIAGK------GIANPIATI 317
              GSLG++ S  V PD      E  HG+      K         NPIA+I
Sbjct: 300 QGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASI 350

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINY 237
            AK + ++A++R     K  L  T K+ +L + DG F+++ + +Y  N K+K+   GI Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 64/115 (55%), Gaps = 6/115 (5%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYR 248
           ++  + K  L ++ K+ +L + DG F++I +++Y+A  K K+   GI+Y  ++ID MV +
Sbjct: 216 KMAIDKKLNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQ 275

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 276 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 103/223 (46%), Gaps = 29/223 (13%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T+ + R  A  +  +A+ +     K  L ++ K+ +L + DG F++I +++Y +  K ++
Sbjct: 203 TDESIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEF 257

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 258 EKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 316

Query: 291 D--IVMGEPCHGS----------APDIAGKGIANPIATIRSTALMLEFLGHKEA---AQD 335
           D      E  HG+            + +   IA+  A  R  A   E     E    A  
Sbjct: 317 DGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELDNTPEVVEFANL 376

Query: 336 IHKAVESNMRENKIKTPDLG---GNSSTQNVV--DDVLEKLAK 373
           + K+  + ++E+ I T DL    GN+   + V  D+ L+ + K
Sbjct: 377 LEKSTLNTVQEDGIMTKDLALACGNTDRSSYVNTDEFLDAVEK 419

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINY 237
            AK + ++AL+R     +  L  T K+ +L   D  F+EI   ++ A  K+K+   GI Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 75/147 (51%), Gaps = 12/147 (8%)

Query: 160 DQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFRE 219
           D  G  VA A    T+ + R  A  +  +AL +     K  L ++ K+ +L + DG F++
Sbjct: 187 DYQGSGVALAMYN-TDESIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKD 240

Query: 220 ICKDVYQAN-KDKYA--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAAL 276
           I ++++    K K+A  GI+Y  ++ID MV +M +    F ++   N  GD+ SD  A  
Sbjct: 241 IFQEIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQG 299

Query: 277 VGSLGVVPSANVGPD--IVMGEPCHGS 301
            GSLG++ S  V PD      E  HG+
Sbjct: 300 FGSLGLMTSILVTPDGKTFESEAAHGT 326

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKYA--GINY 237
            AK + ++A++R     K  L  T K+ +L + DG F+++ + +Y ++ K+K+   GI Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T  +    A+ +  +A++R     K  L  T K+ +L Q DG F++I K VY+   K+ +
Sbjct: 183 TRESIESFARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETF 237

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  
Sbjct: 238 EELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAA 296

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 297 DGKTFESEAAHGT 309

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKYA--GINY 237
            AK + ++AL+R     K  L  T K+ +L + DG F+++ + +Y +  K+K+   GI Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN---KDKYAGINYNEQIIDSMVYR 248
           +L  + K  L ++ K+ +L + DG F++I + +Y+ +   K +   INY  ++ID MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQ 274

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           M +    F ++   N  GD+ SD  A   GSLG++ S  V PD      E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (45%), Gaps = 19/182 (10%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY--AGINYNEQIIDSMVYR 248
           RL  + +  L +  K+ +L Q DG F+++ + +Y A  ++ +  AGI+Y  ++ID MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 249 MFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS----- 301
           M +    F V+   N  GD+ SD  A   GSLG++ S  + PD      E  HG+     
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHF 325

Query: 302 -----APDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMR---ENKIKTPD 353
                  + +   IA+  A  R  A   +  G    A   H    + +R   ++ I T D
Sbjct: 326 RLHQQGKETSTNSIASIFAWTRGLARRADLDGTPAVADFAHALEGATLRTVQDDAIMTKD 385

Query: 354 LG 355
           L 
Sbjct: 386 LA 387

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T  + +  AK + ++AL+R     K  L  T K+ +L   D  F++I   ++ A  K+++
Sbjct: 185 TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQF 239

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 240 QALGITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITP 298

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKYA--GINY 237
            AK + ++A++R     K  L  T K+ +L + DG F+++ + +Y ++ K+K+   GI Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    + +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T  + R  A+ + ++AL+      +  L  T K+ +L + DG F++  + +Y+A  K+++
Sbjct: 185 TTESIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQF 239

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 240 EAKGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISP 298

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKY--AGINY 237
            A+ +  +A+++     K  L  T K+ +L + DG F++I  ++Y    KD++   GI Y
Sbjct: 196 FARASFQMAIKK-----KIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFY 250

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + PD      
Sbjct: 251 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQS 309

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 310 EAAHGT 315

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 201 LTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYRMFREPEYFD 257
           L  T K+ +L + DG +++I  D+Y+ + KDK+   GI Y  ++ID MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           VI   N  GD+ SD  A   GSLG++ S  +  D      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKYA--GINY 237
            AK + ++AL+R     K  L  T K+ +L   D  F++I   ++ +  ++K+   GI Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  V PD      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY-QANKDKY 232
           T  + +  AK + ++AL+R     K  L  T K+ +L   D  F++I  +++ +  K+K+
Sbjct: 185 TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKF 239

Query: 233 AG--INYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
               I Y  ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 240 QALKITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITP 298

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 63/116 (54%), Gaps = 8/116 (6%)

Query: 192 RLKTNGKATLTVTHKSNVLSQSDGLFREICKDVY----QANKDKYAGINYNEQIIDSMVY 247
           +L  + K  L ++ K+ +L + DG F++I +++Y    +A  +K AGI Y  ++ID MV 
Sbjct: 209 KLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEK-AGIFYEHRLIDDMVA 267

Query: 248 RMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
           +M +    F ++   N  GD+ SD  A   GSLG++ S  + PD      E  HG+
Sbjct: 268 QMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKYAGIN--Y 237
            A+ + + AL+R     K  L  T K+ +L + DG F++I + +Y+   ++K+  +N  Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 238 NEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMG 295
             ++ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 317 EAAHGT 322

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 106/228 (46%), Gaps = 26/228 (11%)

Query: 146 NTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTH 205
           NTE++ + +   + +++   VA A     E  T   A  +  +AL+R        L  T 
Sbjct: 162 NTENIELSV-YDFDEESKGGVAMAMYNTLESIT-GFAHASFKMALER-----GLPLYSTT 214

Query: 206 KSNVLSQSDGLFREICKDVYQAN-KDKYA--GINYNEQIIDSMVYRMFREPEYFDVIVAP 262
           K+ +L + DG F+++ + +Y++  K  +   GI Y  ++ID MV +M +    + +I   
Sbjct: 215 KNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMK 273

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGSAP-----DIAGKGIA-NPI 314
           N  GD+ SD  A   GSLG++ S  + PD      E  HG+          GK  + N I
Sbjct: 274 NYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSI 333

Query: 315 ATIRSTALMLEFLGHKEAAQDIHKAVE-------SNMRENKIKTPDLG 355
           A+I +    L   G  ++  D+ K  E       + ++E++I T DL 
Sbjct: 334 ASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLA 381

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 174 TEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQAN-KDKY 232
           T+ + R  A  +  +AL +     K  L ++ K+ +L   DG F++I +++Y    K ++
Sbjct: 198 TDESIRGFAHASFKLALTK-----KLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 233 A--GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
              GI Y  ++ID MV +M +    F ++   N  GD+ SD  A   GSLG++ S    P
Sbjct: 253 ENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATP 311

Query: 291 D--IVMGEPCHGS 301
           D      E  HG+
Sbjct: 312 DGKTFESEAAHGT 324

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 11/122 (9%)

Query: 185 ALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYA---GINYNEQI 241
           +  +AL+R     K  L  T K+ +L + DG F++I +++Y+    +     GI Y  ++
Sbjct: 204 SFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 242 IDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCH 299
           ID MV +M +    F +I   N  GD+ SD  A   GSLG++ S  +  D      E  H
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAH 317

Query: 300 GS 301
           G+
Sbjct: 318 GT 319

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDK---YAGINYNEQIIDSMVYRM 249
           L  N    L +  K+ +L + DG F++I +++Y+    K      I Y  ++ID MV +M
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 250 FREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPD--IVMGEPCHGS 301
            +    + ++   N  GD+ SD  A   GSLG++ S    PD      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 32/51 (62%)

Query: 322 LMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKLA 372
           LML  LG  E+A  I KAV   + E K  T D+GG+SST +  ++++ KL+
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKLS 51

>KNAG0D01230 Chr4 (207381..209348) [1968 bp, 655 aa] {ON} Anc_7.491
           YJR110W
          Length = 655

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 193 LKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250
            KTN K TLT   K   L  +  +F++    VYQ +        +NE+ +  +VY ++
Sbjct: 485 FKTNNK-TLTFATKDRTLKFASPIFQQFLDCVYQLHTQNPTQFEFNERFLRRLVYHVY 541

>Kwal_56.22734 s56 complement(257152..258186) [1035 bp, 344 aa] {ON}
           YDR498C (SEC20) - membrane glycoprotein, sorted by HDEL
           retrieval system [contig 184] FULL
          Length = 344

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 207 SNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYR-MFREPEYFDVIVAPNLY 265
           S VL+ S  + + I +   +  +  Y G+ +    I  +++R +F+ P    + V    +
Sbjct: 222 SGVLNTSSKVVKIINESSGRERRQIYTGLAFLGLCISWVLWRRIFKMPVKLMLWVWFRFF 281

Query: 266 GDILSDGAAALVGSLGVVPSANVGPDIVMG 295
             IL        G LGVVP  +VG  +V G
Sbjct: 282 RSIL--------GVLGVVPKVHVGTSVVPG 303

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
           YLR006C (REAL)
          Length = 702

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 228 NKDKYA------GINYNEQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLG 281
           NK KYA      G+NY  + ++   Y++  EP+   + +   L+G +   G+ +   SL 
Sbjct: 212 NKTKYARPLMRKGLNYKTESVNDSTYKIIFEPDELAINIYKELFGTM---GSQSASQSLR 268

Query: 282 VVPSANVGPDI 292
           +  + N+  DI
Sbjct: 269 IFSNVNLRQDI 279

>TPHA0D01100 Chr4 (231436..233298) [1863 bp, 620 aa] {ON} Anc_1.475
           YJR046W
          Length = 620

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 16/68 (23%)

Query: 312 NPIATIRSTALMLEFLGHKEAAQDIHKAVE----------------SNMRENKIKTPDLG 355
           NP+AT+ S +  L+F+ H E     HK  E                S+    K KTPDL 
Sbjct: 391 NPLATLTSKSRKLDFVHHAEKWLQKHKTSEPIPSDVPILKYNKRRLSDSNTKKQKTPDLR 450

Query: 356 GNSSTQNV 363
              + +N+
Sbjct: 451 NGKTVENL 458

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,486,804
Number of extensions: 1538731
Number of successful extensions: 5088
Number of sequences better than 10.0: 144
Number of HSP's gapped: 4858
Number of HSP's successfully gapped: 144
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)