Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J013502.290ON26424112960.0
Ecym_33292.290ON2582427831e-105
NDAI0B035402.290ON2612417821e-104
ZYRO0A01958g2.290ON2632417821e-104
SAKL0E07590g2.290ON2602387781e-104
Smik_9.862.290ON2642427761e-103
YIL093C (RSM25)2.290ON2642427741e-103
TBLA0B059602.290ON2662417701e-102
TDEL0G022002.290ON2612417661e-102
Skud_9.802.290ON2642427651e-102
KLTH0G10450g2.290ON2612427621e-101
Suva_9.1062.290ON2642427491e-99
Kpol_1003.402.290ON2612417473e-99
KNAG0A054102.290ON2662417413e-98
Kwal_27.115092.290ON2612367371e-97
NCAS0B062402.290ON2602407333e-97
KLLA0E08273g2.290ON2612457135e-94
CAGL0D04158g2.290ON2722386962e-91
TPHA0C034202.290ON2682456692e-87
ADL211C2.290ON2251915698e-73
SAKL0H12430gna 1ON41582711.7
NDAI0I022406.21ON35049666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01350
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   503   0.0  
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   306   e-105
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   305   e-104
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   305   e-104
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   304   e-104
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   303   e-103
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   302   e-103
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   301   e-102
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   299   e-102
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   299   e-102
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   298   e-101
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   293   1e-99
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   292   3e-99
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   290   3e-98
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   288   1e-97
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   286   3e-97
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   279   5e-94
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   272   2e-91
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   262   2e-87
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   223   8e-73
SAKL0H12430g Chr8 (1059187..1060434) [1248 bp, 415 aa] {ON} cons...    32   1.7  
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    30   6.9  

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  503 bits (1296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
           RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
           RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 241 A 241
           A
Sbjct: 241 A 241

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 185/242 (76%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNATNILERTS++L+ GLL   P +YDVI + PPSTKF R+PKLVNPSTG    + 
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  RELTDKVNWR-GLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
           RE +D  N   G YKTR    ++  S S +Y+A +L Y ED LR LFY QHPWELSRPKI
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           ++EN  D    DWS IQQLGKP+DGESVVQRTL+L+ + +H NL D YDQARFEFY++RM
Sbjct: 121 LVENQGDEKH-DWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRM 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239
           Q++ EEQ+A EEA M GS+FGP+A+E+G+++EQ+VI  WK++A+++ EL+ AKR++ S +
Sbjct: 180 QQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSAN 239

Query: 240 WA 241
           W 
Sbjct: 240 WG 241

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/241 (58%), Positives = 194/241 (80%), Gaps = 1/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N++ERTSAYL +GLL+N PA+YDV+A +PP+ KFTREPK+ NP+TG+++T F
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
           ++   +VN +GLYKTR    DR  S + LYK  +L YLED LR LF++QHPWELSRPKI+
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           IEN+++  + DWS+IQQ  K +DGESVVQRTL+L+KN+   N+   Y++ARFEFY++R+Q
Sbjct: 121 IENSLE-ENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
           +D  +Q+A EEA MFGSIF  T+ E+GI++EQ VI +WK++AI+ET+L++ + +NPSDSW
Sbjct: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSW 239

Query: 241 A 241
           A
Sbjct: 240 A 240

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 137/241 (56%), Positives = 189/241 (78%), Gaps = 1/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MK+QTNA N+LERTSAYL++GLLR  PA+Y V+A VPP+TKFTRE + +NPSTG+   ++
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
           +E  + +N +G YKTR ++ DR    SRLYKA +L++LED LR++FY QHPWE SRPK++
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           +EN I N + DWS + QLGKP+DGESVVQRT++L++      + D YD+ RFEFY++RMQ
Sbjct: 121 VENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
            + E+Q+A EEA MFGS+F  +A++YG+++EQ VI  WKQ+AI ETELL A+RA+P++SW
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239

Query: 241 A 241
            
Sbjct: 240 G 240

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  304 bits (778), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 183/238 (76%), Gaps = 2/238 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MK+QTNA N+LERTSAYL+AGLL  APA+Y+V+A VPPS  F REPK+ NPS  ++    
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  RELTDKVNWR-GLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
            E ++ V  + G YKTR + SDR  S ++LYKA +L Y ED LR+LFY QHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           +IEN     S DWS IQQLGKP+DGESVVQRTL+L+K KK   L + YDQARFEFY+VR+
Sbjct: 121 LIENT-GEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPS 237
           Q++  EQ+A EEA MFGS+FG +++EYG+++EQ VI  WK++AI++TEL+ A+ + PS
Sbjct: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  303 bits (776), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 186/242 (76%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+L+RTSAYL++GLL++ PA+Y+V+A +PPSTKFTREP   NPS G    R 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  RELTD--KVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPK 118
            ++ +    N  GLYKTR   +D+   V +LYK  +L Y+ED LR LFY QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 IVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVR 178
           I++EN I +   DWS++ QLGKP+DGESV+QRT++L+K K+++N  + YD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 MQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSD 238
           MQ ++++Q+A EEA MFGSIFG +A+E+GIQ+EQ+V+  W+++ I ETEL+ A+ +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 191/242 (78%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+L+RTSAYL++GLL+  PA+Y+V+A +PPSTKFTREP+  NPS G    + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  RELTDK--VNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPK 118
            ++T++   N +GLYKTR  +SD+   V RLY+  +L Y+ED LR LFY QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 IVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVR 178
           I++EN I + + DWS++ Q+G+P+DGESV+QRT++L+K K++ ++ + YD AR+EFY +R
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 MQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSD 238
           MQ ++E+Q+A EEA MFGS+FG +A+E+GIQ+EQ+V+  W+++ + ETEL+ A+ +NP+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  301 bits (770), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 184/241 (76%), Gaps = 2/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQ NA N+LERTSAYLQAG+++  P +YDV+A  PPS KFTREPK +NPST +    F
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  RELTDKVN-WRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
           + L D +N   GLYKTR  + D+  +VS LYK  +L Y+ED LR+LFY+QHPWEL+RPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           V+EN+    + DWS + QLGKP+DGESVVQRTLFL+K K+H  L D Y+QARFEFY++RM
Sbjct: 121 VMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239
             + +EQ+A EE+ MFG++FG T +E+GI++EQ++I  WK  AI+ETE+ +AKR+  S S
Sbjct: 180 AEEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVS 239

Query: 240 W 240
           W
Sbjct: 240 W 240

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 196/241 (81%), Gaps = 1/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+LERTSAYL++GLLRN PA+YDV+A +PP TKFTREP+L+NPS  +     
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
           ++  D+ N +G +KTR +  D+  + ++LY+A +LK++ED LR++FY QHPWELSRPK++
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           +EN+ +    DWS+IQQL KP+DGESV+QRTLFL+KN +  +L + YDQARFEFY++RMQ
Sbjct: 121 VENDAE-EEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
           ++ E+Q+A EE+ MFGSI+GP+A+++G+Q+EQ  I  WKQ+AI ET+LL A+RANPS++W
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239

Query: 241 A 241
           A
Sbjct: 240 A 240

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 185/242 (76%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+L+RTSAYL++GLL+  PA+Y+V+A +PPSTKFTREP+  NPS G      
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  RELTDK--VNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPK 118
            ++T +   N  GLYKTR   +D+  SV +LYK  +L Y+ED LR LFY QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 IVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVR 178
           I++EN I +   DW  + QLGKP+DGESVVQRT+ L+K K+++++ + YD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 MQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSD 238
           MQ ++++Q+A EEA MFGSIFG +A+E+GIQ+EQ+V+  W+++ I ETEL+ AK +NP+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  298 bits (762), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 187/242 (77%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MK+Q NA N+LERTS+YL+AGLL+  PA+YDV+A VPPS +F REP+LVNPST ++  + 
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  RELTDKVNWRG-LYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
            E  ++ +     YKTR + S+R  S S+L+ A +LKY ED LR++FY+QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           ++EN+      DWS IQQLGKP+DGESVVQRTL+L++ K H  L   YDQARFEFY++R+
Sbjct: 121 LVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239
           Q + + Q+A EEA MFGS+FGP+A+++G+++EQ +I  WKQ+AI +TE++ A+  NPS+S
Sbjct: 180 QEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239

Query: 240 WA 241
           W+
Sbjct: 240 WS 241

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  293 bits (749), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 189/242 (78%), Gaps = 2/242 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+L+RTSAYL++GLL++ PA+Y+V+A +PPSTKFTREP+  NPS G+   + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  RELTDK--VNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPK 118
            ++T++   N  GLYKTR   +DR   V +LYK  +L Y+ED LR LFY QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 119 IVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVR 178
           I++EN + + + DWS++ QLGK +DGESV+QRT+ L+K +++ ++ + YD AR+EFY +R
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 MQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSD 238
           M+ ++++Q+A EEA MFGSIFG +++E+GIQ+EQ+V+  W+++ I ETEL+ A+ +NP+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 239 SW 240
           SW
Sbjct: 241 SW 242

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  292 bits (747), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 184/241 (76%), Gaps = 1/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQ NA N+LERTSAYL+AGLL   PA+Y+V+A VPP  KF R PKL NPS  +   + 
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
             L       G++KTRY A DR  +  +LY AS+L Y+ED LR++FY QHPWELSRPKI+
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           IENN D    DWS++QQ+GKP+DGESVVQRTL+LMKNK+  +L   YD AR+EFY++RMQ
Sbjct: 121 IENNGD-EKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
           +  EEQ+A EEA MFGS+FGP+A+EYGIQ+EQ VI  WK++AI +TE++ A+R NPS+SW
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239

Query: 241 A 241
           A
Sbjct: 240 A 240

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  290 bits (741), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 183/241 (75%), Gaps = 2/241 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA NILERTSA+L++G+++  PA+Y+V+A  PP  KF R+P  VNPSTG+ R   
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  RELTD-KVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
           +   D K N   +YKTRY+ +D+  S + LY+  +L YLED LRQLFYDQHPWE SRP I
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           +IENN+     DWS IQQLGK +DGESVVQR LFL++    D+L+  YD+ARFEFY++RM
Sbjct: 121 LIENNV-TPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239
           Q++ EEQI+ EEAAM+GS++  +A+E+G+++E  VI  WK+R I+ETE + A+RA+PS+S
Sbjct: 180 QQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSES 239

Query: 240 W 240
           W
Sbjct: 240 W 240

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  288 bits (737), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 182/236 (77%), Gaps = 2/236 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MK+Q NA N+LERTS+YL+AG+L+  PA+Y+V+AQ+PPS +F REP+LVNPST  +  + 
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  RELTDKVNWRG-LYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
            E  +  N+    YKTR +  D+  S ++LYKA +LKY ED LR+LF++QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           ++EN+      DWS +QQLGKP+DGESVVQRTL+L+K+KKH  L   YDQARFEFY++R+
Sbjct: 121 LVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRAN 235
           Q + + Q+A EEA M GS+FGP+A+++G+++EQ +I  WKQ+AI ++ELL A+  N
Sbjct: 180 QEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  286 bits (733), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 139/240 (57%), Positives = 194/240 (80%), Gaps = 2/240 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           M++QTNA NI+ERTSAYL++GLL+N PA+Y+V+A++PP+ KFTREP+L+NPST +D    
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120
           R+  + VN +G YKTR    DR  + ++LYK  +L+Y+ED LR LF+DQHPWELSRPKI+
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180
           +EN+++    DWS+IQQLGKP+DGESVVQRT++L+K  K D +   Y+QARFEFY+ R+Q
Sbjct: 121 VENSLE-ERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMD-MITAYNQARFEFYRFRIQ 178

Query: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240
           ++ EEQ+A EEA MFGS+F  + +++GI++EQ VI +WK++A +ETEL+ A+RANPSDSW
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  279 bits (713), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 186/245 (75%), Gaps = 7/245 (2%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MK+Q  A N+LERTSAYL++G+L+  PA+Y+VIA+VPP+ KF R P+L +P  G+ RT  
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTA- 59

Query: 61  RELTDKVNWR----GLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSR 116
             L D  NW+    GLYKTR  + ++    S+LY++ +L Y+ED LR+LF+ QHPWELSR
Sbjct: 60  --LPDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSR 117

Query: 117 PKIVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQ 176
           PKI++EN ++    DWS+IQQLGKP+DGESVVQRTLFL+K+ +   L D YDQARFEFY+
Sbjct: 118 PKILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYR 177

Query: 177 VRMQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANP 236
           +R+Q++ ++Q+A EEA MFGS+F  T++EYGI +EQ VI  WK++A+++ EL+ A+ ++P
Sbjct: 178 LRIQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSP 237

Query: 237 SDSWA 241
           S SW 
Sbjct: 238 SASWT 242

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  272 bits (696), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 182/238 (76%), Gaps = 2/238 (0%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+LERTSAYL+ G+++  PA+Y+V+A +PP TKFTREP  +NPST +  +  
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  REL-TDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
           ++   + VN  GLYKTR+ A +R  +  ++YK  +L YLED +R LFY QHPWEL+RPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           V EN I N++ DW N+ QLG+P+DGE+VVQRTL+L+K K+  N+ D YDQAR EFY++RM
Sbjct: 121 VSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179

Query: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPS 237
           Q++ EEQ+A EEA MFGS+FGP+ +E+G+ +EQ VI KWK+ A  ++ELL AK+ N S
Sbjct: 180 QQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  262 bits (669), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 180/245 (73%), Gaps = 5/245 (2%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQ NA N+LERTS+YL++GLL   PA+Y+V+A++PPS KF R PK  NPS  +     
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  RELTDKV----NWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSR 116
           R + +++    N   L+K+RY   D+ +S   +YK ++L Y+ED LR++FY QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKIVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQ 176
           PKIV+ENN D  + DWS+IQQLGK +DGE+VVQR ++LMK K          +AR+EFY+
Sbjct: 121 PKIVVENNGD-ETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179

Query: 177 VRMQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANP 236
           VRMQ + EEQ+A EEA MFGS+FGP+ +E+G+ +EQ VI  WK++AI ETEL++AKR NP
Sbjct: 180 VRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239

Query: 237 SDSWA 241
           S++WA
Sbjct: 240 SETWA 244

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  223 bits (569), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (75%), Gaps = 4/191 (2%)

Query: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60
           MKIQTNA N+L+RTS YLQAGLL+  PA+Y+V+A++PP TKF REPKL +P +G+ +   
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  RELTDKVNWRG-LYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119
             +TD++N     YKTR  +SDR  +   ++K S+L+++ED LR LF+ QHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179
           ++EN + N   DWS + QLGKP+DGESVVQRTL+L+K+  H  +   YDQARFEFY++RM
Sbjct: 119 LVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

Query: 180 QRDSEEQIATE 190
           Q++ EEQIA E
Sbjct: 178 QQELEEQIAYE 188

>SAKL0H12430g Chr8 (1059187..1060434) [1248 bp, 415 aa] {ON}
           conserved hypothetical protein
          Length = 415

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 35/82 (42%)

Query: 27  PAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRFRELTDKVNWRGLYKTRYAASDRHASV 86
           P  Y V++ V    K   +PK +   +   ++    L +    RG   T + +SD   S 
Sbjct: 112 PGAYRVVSNVGKFIKNKMKPKFIVVISAHWQSNSGNLIEVAVPRGSSNTNHGSSDLFGSR 171

Query: 87  SRLYKASRLKYLEDDLRQLFYD 108
           SR    S  K L+ D  +L YD
Sbjct: 172 SRHSNKSSAKTLDPDENKLIYD 193

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 143 DGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQRDSEEQIATEE 191
           DG +  +R + L        L D Y+ ARF++ Q++   DSEE+ + +E
Sbjct: 167 DGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQLKKNDDSEERKSIKE 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,087,054
Number of extensions: 1039386
Number of successful extensions: 3060
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3133
Number of HSP's successfully gapped: 36
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)