Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J013402.292ON72872835200.0
Suva_9.1082.292ON72257324910.0
Skud_9.822.292ON72272024790.0
NDAI0B035302.292ON73957124560.0
YIL091C (UTP25)2.292ON72157224380.0
Smik_9.882.292ON72472424360.0
NCAS0B062302.292ON72373424000.0
KNAG0A054002.292ON72172223930.0
SAKL0E07546g2.292ON71871923310.0
TBLA0B059702.292ON71971723280.0
TDEL0G022202.292ON71072922950.0
CAGL0D04180g2.292ON70057922840.0
Kpol_1039.462.292ON70456722790.0
KLLA0E08229g2.292ON70471422450.0
Ecym_33312.292ON70872122430.0
TPHA0D015202.292ON71656422280.0
Kwal_27.115032.292ON72759122240.0
KLTH0G10494g2.292ON74759422260.0
ADL209C2.292ON70471922150.0
ZYRO0A02002g2.292ON70956421970.0
KLLA0C15433g8.469ON539199820.35
Skud_4.5058.469ON604196790.72
KNAG0M006606.148ON884136781.1
NCAS0H006207.462ON106793724.8
TDEL0D020501.337ON160967725.5
NDAI0D024105.113ON200290718.1
Skud_13.158.862ON312128699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01340
         (728 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....  1360   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   964   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   959   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   950   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   943   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   942   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   929   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   926   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   902   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   901   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   888   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   884   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   882   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   869   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   868   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   862   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   861   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   862   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   857   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   850   0.0  
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...    36   0.35 
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    35   0.72 
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...    35   1.1  
NCAS0H00620 Chr8 (105816..109019) [3204 bp, 1067 aa] {ON} Anc_7....    32   4.8  
TDEL0D02050 Chr4 complement(397206..402035) [4830 bp, 1609 aa] {...    32   5.5  
NDAI0D02410 Chr4 (554265..560273) [6009 bp, 2002 aa] {ON} Anc_5....    32   8.1  
Skud_13.15 Chr13 complement(20641..21579) [939 bp, 312 aa] {ON} ...    31   9.6  

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/728 (91%), Positives = 669/728 (91%)

Query: 1   MKRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAA 60
           MKRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAA
Sbjct: 1   MKRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAA 60

Query: 61  NXXXXXXXXXXXXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXX 120
           N                  MKKQVYGALLTIL                 VLL        
Sbjct: 61  NGDDVGDEVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDES 120

Query: 121 XXXXXXXXXXXXXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTD 180
                           LMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTD
Sbjct: 121 DASEEEEDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTD 180

Query: 181 KLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRL 240
           KLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRL
Sbjct: 181 KLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRL 240

Query: 241 KMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKT 300
           KMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKT
Sbjct: 241 KMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKT 300

Query: 301 RDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGK 360
           RDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGK
Sbjct: 301 RDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGK 360

Query: 361 FKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLG 420
           FKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLG
Sbjct: 361 FKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLG 420

Query: 421 IQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFS 480
           IQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFS
Sbjct: 421 IQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFS 480

Query: 481 RVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVG 540
           RVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVG
Sbjct: 481 RVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVG 540

Query: 541 IKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVR 600
           IKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVR
Sbjct: 541 IKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVR 600

Query: 601 NYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVF 660
           NYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVF
Sbjct: 601 NYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVF 660

Query: 661 YQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHA 720
           YQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHA
Sbjct: 661 YQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHA 720

Query: 721 QNEVYEFK 728
           QNEVYEFK
Sbjct: 721 QNEVYEFK 728

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/573 (78%), Positives = 516/573 (90%), Gaps = 2/573 (0%)

Query: 156 DNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKS 215
           D  +S++EQDPFE+HFN V EK+ D +  +FK N+IKYKS K P+ +DE  I+SKPV+  
Sbjct: 152 DEVDSEDEQDPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVNG 211

Query: 216 DEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQY 275
           DE  +PVE     SSI+SYFLKQRLK+QN L+D K+DPLT LQK+LVDPMFQYKDILY+Y
Sbjct: 212 DE--TPVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEY 269

Query: 276 DSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPT 335
           DSY KDEDEYRDLY+LH LNH+YKTRD+ILKNNQRLQDN DTE LDQGFTRPKVLIVVPT
Sbjct: 270 DSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPT 329

Query: 336 RDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGV 395
           RD AY V++KII KSGIDQVDKKGKF DQF +DSLPPSSKPKSFQ IF+GNT+DFFV+G+
Sbjct: 330 RDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGL 389

Query: 396 KFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQ 455
           KFTRKAIKLYSNFYQSDII+CSPLGIQMILENTDKKKRQDDFLSSIELM+IDQLHSIEYQ
Sbjct: 390 KFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQ 449

Query: 456 NISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGK 515
           NISH+FTI +HINKIP +QH+ADFSR+RMWYIN+QAKL RQTM+FTKYISP ANSL+NG+
Sbjct: 450 NISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGR 509

Query: 516 CQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPN 575
           C+N +GRWKNHKVI + +SSI ++G+KIRQIFQRF+ +  S+++EPDYRFKFFTSV +P+
Sbjct: 510 CRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPS 569

Query: 576 IVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRV 635
           IVK+TGYEDG LIYIP+YTD+IR+RNY+K+KTTILFGDINEYS QKQLN+NRSLFQQGRV
Sbjct: 570 IVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRV 629

Query: 636 KVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRC 695
           KVLLYTERLHHYRRYEIKGVKNV+FY+PP NPEFY E VRYIGKNAFLGNTDLNISTVRC
Sbjct: 630 KVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRC 689

Query: 696 LYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           +YSKLD LSLE IVG+KRAGVL HAQ EVYEFK
Sbjct: 690 VYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 11 YDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXXXX 70
          + G RKRGR+E+R I+R   R+  D   N       E+     E+  S A          
Sbjct: 13 FRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGD 72

Query: 71 XXXXXXXXXMKKQVYGALLTIL 92
                    +++VY ALLTIL
Sbjct: 73 EEEK------QEKVYDALLTIL 88

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/720 (64%), Positives = 558/720 (77%), Gaps = 8/720 (1%)

Query: 9   DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXX 68
           D + G RKRGR+ELR I+R+ GR+  D   +       E  G  + +  S          
Sbjct: 11  DHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDV 70

Query: 69  XXXXXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXX 128
                       KK+VY ALLTIL                                    
Sbjct: 71  GDEDEK------KKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVD 124

Query: 129 XXXXXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKN 188
                   L+G   D++ +D  ++   D+ +S++EQDPFE+HFN V EK  D L  +FK+
Sbjct: 125 DQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKS 184

Query: 189 NDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMD 248
            +I+YKS K P++ DE  I+++PV+  +E  S VE     SSI+SYFLKQRLK+QN L D
Sbjct: 185 KNIRYKSVKAPLNGDESYIYAQPVVVGEE--SSVESPYKSSSIYSYFLKQRLKIQNGLQD 242

Query: 249 PKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNN 308
            K+DPL  LQ++LVDPMFQYKDILY+YDSY KDEDEYRDLY+LHVLNH+YKTRD+ILKNN
Sbjct: 243 KKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNN 302

Query: 309 QRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFED 368
           QRLQDN DTE LDQGFTRPKVLIVVPTRD AY+V++KII+KSGIDQVDKKGKF DQF +D
Sbjct: 303 QRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDD 362

Query: 369 SLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENT 428
           SLPP SKP+SFQ IFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILENT
Sbjct: 363 SLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENT 422

Query: 429 DKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYIN 488
           DKKKRQDDFLSSIE+M+IDQLHSIEYQNISH+ TI +H+NKIP +QH+ADFSR+RMWYIN
Sbjct: 423 DKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYIN 482

Query: 489 DQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQ 548
           +QAK FRQTM+FTKYISP  NSL+NG+C+N +GRWKNH+ I   +SSI ++G+KIRQIFQ
Sbjct: 483 EQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQ 542

Query: 549 RFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTT 608
           RF+T+  S+V+EPDYRFKFFTSV +P+IVK+TGYEDG LIYIP+YTD+IR+RNY+K+KTT
Sbjct: 543 RFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTT 602

Query: 609 ILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPE 668
           ILFGDINEYS Q+QLN+NRSLFQQGR+KV+LYTERLHHYRRY+IKGVK+V+FY+PP NPE
Sbjct: 603 ILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPE 662

Query: 669 FYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           FY+E VR+IGKNAF GNTDLNISTVRC+YSKLD +SLE IVG+KRA VL HAQ EVYEFK
Sbjct: 663 FYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/571 (77%), Positives = 515/571 (90%), Gaps = 1/571 (0%)

Query: 159 ESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEI 218
           ESD+EQDPFE+HFN   E+F DKL  +F++ +IKYK+TK+ I +    I SKP I  +E+
Sbjct: 169 ESDDEQDPFESHFNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEEL 228

Query: 219 ES-PVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDS 277
           E+  +  S +  SI SYF+KQRLK+QNNL++PKVDPLTPLQK+L+DPMFQYKDILY+YDS
Sbjct: 229 ETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDS 288

Query: 278 YGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRD 337
           YGKDEDEYRDLY+LH LNH+YKTRD+ILKNNQRLQDN DTE LDQGFTRPKVLIVVPTRD
Sbjct: 289 YGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRD 348

Query: 338 TAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKF 397
           TAY+V +KII KSG+DQVDKKGKF DQF +DSLPPSSKPKSFQ IFKGNTNDFFVLG+KF
Sbjct: 349 TAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKF 408

Query: 398 TRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNI 457
           TRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSSIEL+I+DQLHS+EYQN+
Sbjct: 409 TRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNL 468

Query: 458 SHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQ 517
           +H+FTI +H+NKIP EQHDADFSR+RMWYINDQAKLFRQTM+FTKY+SP AN+++N +C+
Sbjct: 469 AHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCR 528

Query: 518 NWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIV 577
           NW GRWKNHK+++   SSI K+G+KI+QIFQRF+ + GS+VDEPDYRFK FTSV +P+IV
Sbjct: 529 NWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIV 588

Query: 578 KTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKV 637
           K+T Y+DG LIYIP+YTDY+R+RNYLK+KT ILFGDINEYS+Q++LNSNRSL QQGRVKV
Sbjct: 589 KSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKV 648

Query: 638 LLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLY 697
           LLYTERLHHYRRYEIKGVK+VVFY+PP NPEFY EVVR+IGKNAFLGNTDLNISTVR +Y
Sbjct: 649 LLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVY 708

Query: 698 SKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
            KLD LSLE IVG+KRAG+LCHAQNEVYEFK
Sbjct: 709 CKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 2  KRSGTGADGYDGVRKRGRKELRNIRRAGGRKPR 34
          K+S    +  D  RKRGR+ELR IRR+  +K R
Sbjct: 12 KKSYKSNNSNDHHRKRGRQELRTIRRSAAKKSR 44

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/572 (77%), Positives = 513/572 (89%), Gaps = 6/572 (1%)

Query: 159 ESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDE- 217
           +S++EQDPFE+HFN V EKF DKL  +FK   +KYKS K  +S+ E  I++KPV+  +E 
Sbjct: 154 DSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEA 213

Query: 218 -IESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYD 276
            +ESP       SSI+SYFLKQRLK+QN L+D K DPLT LQK+LVDPMFQYKDILY+YD
Sbjct: 214 LVESPYR----SSSIYSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYD 269

Query: 277 SYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTR 336
           SY KDEDEYRDLY+LHVLNH+YKTRD+ILKNNQRLQDN DTE LDQGFTRPKVLIVVPTR
Sbjct: 270 SYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR 329

Query: 337 DTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVK 396
           + AY+V++KII+KSGIDQVDKKGKF DQF +DSLPP SKPKSFQ IF+GNTNDFFV+G+K
Sbjct: 330 EVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLK 389

Query: 397 FTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQN 456
           FTRKAIKLYSNFYQSDII+CSPLGIQMILENTDKKKRQDDFLSSIELM+IDQLHSIEYQN
Sbjct: 390 FTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQN 449

Query: 457 ISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKC 516
           ISH+FTI +H+NKIP +QH+ADFSR+RMWYIN+QAKLFRQTM+FTKYISP ANSL+NG+C
Sbjct: 450 ISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRC 509

Query: 517 QNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNI 576
           +N +GRWKNHKVI + +SSI + G+KIRQIFQRF+ +  S+++EPDYRFKFFTSV +P I
Sbjct: 510 RNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGI 569

Query: 577 VKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVK 636
           VK+TGYEDG LIYIP+YTD+IR+RNY+K+KTTILFGDINEYS Q+QLN+NRSLFQQGR+K
Sbjct: 570 VKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLK 629

Query: 637 VLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCL 696
           V+LYTERLHHYRRYEIKGVK+VVFY+PP NPEFY EVVR+IGKNAFLGNTDLNISTVRC+
Sbjct: 630 VMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCI 689

Query: 697 YSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           YSKLD LSLE IVG+KRA VL HAQ E+YEFK
Sbjct: 690 YSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 9  DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXX 68
          D + G RKRGR+ELR I+R+  R    + E    ++   +    E+E S   +       
Sbjct: 11 DNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIE 70

Query: 69 XXXXXXXXXXXMKKQVYGALLTIL 92
                      K++VY ALLTIL
Sbjct: 71 DEEGK-------KEKVYDALLTIL 87

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/724 (65%), Positives = 559/724 (77%), Gaps = 14/724 (1%)

Query: 9   DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXX 68
           D + G RKRGR+ELR I+R+  R+ +D   N       E      E+  S          
Sbjct: 11  DHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLD 70

Query: 69  XXXXXXXXXXXMKKQVYGALLTILXXX--XXXXXXXXXXXXXXVLLXXXXXXXXXXXXXX 126
                       K++VY ALLTIL                                    
Sbjct: 71  VEDEEGK-----KEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEP 125

Query: 127 XXXXXXXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSF 186
                     L+G   DD  +D ++   DD  +S++EQDPFE+HFN V EK+ D L  +F
Sbjct: 126 VDEQLEIENGLLGDREDDNDDDSNENEKDDM-DSEDEQDPFESHFNQVSEKYVDDLSNAF 184

Query: 187 KNNDIKYKSTKLPISEDEYAIFSKPVIKSDE--IESPVELSVNKSSIHSYFLKQRLKMQN 244
           K+  IKYKS K  + +DE  I++KP +  +E  +ESP       SSI+SYFLKQRLK+QN
Sbjct: 185 KSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYR----SSSIYSYFLKQRLKVQN 240

Query: 245 NLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKI 304
            L+D K+DPLT +QK+L+DPMFQYKDILY+YDSY KDE EYRDLY+LHVLNH+YKTRD+I
Sbjct: 241 GLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRI 300

Query: 305 LKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQ 364
           LKNNQRLQDN DTE LDQGFTRPKVLIVVPTR+ AY+V++KII+KSGIDQVDKKGKF DQ
Sbjct: 301 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 360

Query: 365 FFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMI 424
           F +DSLPP SKPKSFQ IFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDIIICSPLGIQMI
Sbjct: 361 FRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMI 420

Query: 425 LENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRM 484
           LENTDKKKRQDDFLSSIELM+IDQLHSIEYQNISH+FTI +HINKIP +QH+ADFSR+RM
Sbjct: 421 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRM 480

Query: 485 WYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIR 544
           WYIN+QAKLFRQTM+FTKYISP ANSL+NG+C N +GRWKNHKVI + SSSI ++G+K+R
Sbjct: 481 WYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVR 540

Query: 545 QIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLK 604
           QIFQRF+ +  S+++EPDYRFKFFTSV +P+IVK+ GYEDG L+YIP+YTD+IR+RNY+K
Sbjct: 541 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMK 600

Query: 605 DKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPP 664
           +KTTILFGDINEYS+Q+QLN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVK+VVFY+PP
Sbjct: 601 EKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 660

Query: 665 KNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEV 724
            NPEFY E VR+IGKNAFLGNTDLNISTVRC+YSKLD LSLE IVG+KRA VL HAQ EV
Sbjct: 661 NNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEV 720

Query: 725 YEFK 728
           YEFK
Sbjct: 721 YEFK 724

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/734 (62%), Positives = 557/734 (75%), Gaps = 20/734 (2%)

Query: 2   KRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAAN 61
           KRS  G+  + G +KRGR+ELR IRR+ G K   +QE  N   V +   E+ E   S   
Sbjct: 3   KRSHEGSQ-HAGSKKRGRQELRTIRRSAGAKV-SSQEVFNSSIVDDEEQELNESNESEQE 60

Query: 62  XXXXXXXXXXXXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXX 121
                              K +VYGALLTIL                             
Sbjct: 61  EDIDEEEK-----------KNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELA 109

Query: 122 XXXXXXXXXXXXXXXLMG-SHADDASEDDDKEHGDDNE-----ESDEEQDPFETHFNSVD 175
                            G +   D    DD+E  D +      +S++EQDPFE+HFN V 
Sbjct: 110 SDDGKDDEIDEAQQIEDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVS 169

Query: 176 EKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKP-VIKSDEIESPVELSVNKSSIHSY 234
           EK  D L+ +F    +KYKSTK  I +++  I S P +I  +  E   + +   SSIHSY
Sbjct: 170 EKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSY 229

Query: 235 FLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVL 294
           FLKQRL++ N+++D K DPL PLQK+LVDPMFQY+DIL +Y SY KDEDEYRDLY+LH L
Sbjct: 230 FLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHAL 289

Query: 295 NHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQ 354
           NH+YKTRD+ILK+N RLQDN+DTE  DQGFTRPKVLIVVPTRDTAY+VI KII+KSG+DQ
Sbjct: 290 NHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQ 349

Query: 355 VDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII 414
           VDKKGKF DQF +++LPPSSKPKSFQ IFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII
Sbjct: 350 VDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDII 409

Query: 415 ICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQ 474
           +CSPLG+QMI+ENTDKK RQDDFLSSIE++IIDQLHSIEYQN++H+FTI +H+NKIP++Q
Sbjct: 410 VCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQ 469

Query: 475 HDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSS 534
           H+ADFSR+RMWYINDQA+LFRQTM+FTKY++P AN+L+N +C+NW+GRWKNH++I   +S
Sbjct: 470 HEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEAS 529

Query: 535 SISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYT 594
           +IS++G+K++Q FQRF+ + GSV+DEPDYRFK F+SV +P+IVK+T Y DG LIYIP+YT
Sbjct: 530 AISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYT 589

Query: 595 DYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKG 654
           DY+R+RNYLK+KTT+LFGDINEYS+Q++LNSNRSLFQQGRVKVLLYTERLHHYRRYE+KG
Sbjct: 590 DYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKG 649

Query: 655 VKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRA 714
           VK+VVFY+PP NPEFY EVVRYIGK+AFLGN DLNISTVR LY KLD LSLE IVGSKRA
Sbjct: 650 VKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRA 709

Query: 715 GVLCHAQNEVYEFK 728
           G+LCHAQNEVYEF+
Sbjct: 710 GILCHAQNEVYEFQ 723

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/722 (63%), Positives = 545/722 (75%), Gaps = 16/722 (2%)

Query: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXXXXXXXXX 75
           KRGRKELR+++R   R   D     +     +  G     P+                  
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVG-----PADQMVNVSDSAEDGDGSDS 61

Query: 76  XXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXXXXXXXX 135
                K +VYGALLTIL                                           
Sbjct: 62  DAEARKGKVYGALLTILKSEHPEAKKRKTKKSSDG--GEVDKILVHDDNHEELEEENEEE 119

Query: 136 XLMGSHADDASEDDDKEHGDDNEE---SDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIK 192
            +  +  D+ ++ D ++  D   E   S++EQDPFE+HFN   E   + LD +FK+  ++
Sbjct: 120 QIDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQ 179

Query: 193 YKSTKLPISE-----DEYAIFSKPVIKSDEIESPVELSVN-KSSIHSYFLKQRLKMQNNL 246
           Y+S KL  ++     DEY I+S+P +   +  S   +  N K SI SYFLK+RLK+QN+L
Sbjct: 180 YRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDL 239

Query: 247 MDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILK 306
           ++ K D L  +QK+LVDPMFQYKDILY+Y++YGK EDEYR LY+LH LNH+YKTRD+ILK
Sbjct: 240 LENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILK 299

Query: 307 NNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFF 366
           NNQRLQ+N+DTECLDQGFTRPKVLI+ PTRDTAY ++  II KSGIDQVDK+GKFKDQF+
Sbjct: 300 NNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFY 359

Query: 367 EDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILE 426
           EDSLPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+E
Sbjct: 360 EDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVE 419

Query: 427 NTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWY 486
           NTDKKKRQDDFLSSIE+ IIDQLHSIEYQNISHL+TI  H+N IP EQHDADFSR+RMWY
Sbjct: 420 NTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWY 479

Query: 487 INDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQI 546
           INDQA+ FRQTM+FTKYISP ANS++NGKC+NWSGRWKNH+++S  +S I K+ +++RQI
Sbjct: 480 INDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQI 539

Query: 547 FQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDK 606
           FQRFE   GS+VDEPDYRFKFFTSV +P I+K+TGYEDG LIYIPEYTDY+RVRNYLK+K
Sbjct: 540 FQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEK 599

Query: 607 TTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKN 666
           T ILFGDINEYS QKQL +NRSLFQQGR+KVLLYTERLHHYRRYEIKGVK+V+FY+PP +
Sbjct: 600 TRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSD 659

Query: 667 PEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYE 726
           PEFYTEVVR IG+NAFLGNTDLNISTVRC+YSKLDAL+LEN+VG++RAGVLCH QNE+YE
Sbjct: 660 PEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYE 719

Query: 727 FK 728
           FK
Sbjct: 720 FK 721

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/719 (61%), Positives = 544/719 (75%), Gaps = 16/719 (2%)

Query: 10  GYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXXX 69
           GY   +K GRKELR I RA  R   +++++       EN  ++  E    A+        
Sbjct: 16  GYKKAKKTGRKELRTITRANARHANESKDD------FENEPDMSSEEEELADNKPRSDEE 69

Query: 70  XXXXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXX 129
                      K++VY ALLT+L                                     
Sbjct: 70  EEEDIETK---KQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEE 126

Query: 130 XXXXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNN 189
                        DD   D +   GD+++E  ++ D FE HFN+V E    KL  +F++ 
Sbjct: 127 AIENALVETNDDEDDVGSDIN---GDEDDE--DKADSFELHFNNVSELQATKLASAFRDK 181

Query: 190 DIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDP 249
            I+YKS K+P++EDE+ I+S+P ++ ++  S V  S  K S+HSYF+KQ+LK+QNNL+D 
Sbjct: 182 KIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSC-KKSLHSYFIKQKLKIQNNLLDD 240

Query: 250 KVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQ 309
           K + L PLQK LVDPMFQY+D+LY+Y SY + E+EYRDLY+LHVLNH+YKTRD+IL+N+Q
Sbjct: 241 KKEALAPLQKNLVDPMFQYQDLLYEYRSY-EQEEEYRDLYALHVLNHVYKTRDRILRNSQ 299

Query: 310 RLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDS 369
           +LQDN+D E LDQGFTRPKVLIVVPTRD AYQ++ KII KSG+DQVDK+GKF+DQFF+ S
Sbjct: 300 KLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDAS 359

Query: 370 LPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTD 429
           LPPSSKPKSF+ IFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLGIQ+ILENTD
Sbjct: 360 LPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTD 419

Query: 430 KKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYIND 489
           KKKRQDDFLSSIELM+IDQLHSIEYQN+SH+ TI  HINKIPQ+QHDADFSR+RMWYIN+
Sbjct: 420 KKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINE 479

Query: 490 QAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQR 549
           QA LFRQTM+FTKY SP ANSL+NGKC+N +GRWKNH ++    SSI+++G+K+RQIFQR
Sbjct: 480 QATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQR 539

Query: 550 FETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTI 609
           F+ V GS +DEPDYRFKFFTSV + +I+K+TGYEDG L+YIP+YTDY+RVRN+L++KTT+
Sbjct: 540 FDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTL 599

Query: 610 LFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEF 669
           LFGDINEYS+QKQL SNR+LFQQG+VKVLLYTERLHH+RRYEIKGVK+V+FY+PP NPEF
Sbjct: 600 LFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEF 659

Query: 670 YTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           Y EVVRYIGK+AFLG+ DLNISTVRC+Y KLD LSLE +VG+KRA VL H QNE+YEFK
Sbjct: 660 YREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/717 (61%), Positives = 539/717 (75%), Gaps = 9/717 (1%)

Query: 12  DGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXXXXX 71
           +G  KRGR + R+I+++ G K    ++      + + T E E      +N          
Sbjct: 12  EGYGKRGRSQKRSIKKSSGAKRFKTEDT----RIVKETIEDESSDEDVSNTSIDKEAEVT 67

Query: 72  XXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXXXX 131
                    KKQVY AL+TIL                                       
Sbjct: 68  EDLEK----KKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQE 123

Query: 132 XXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDI 191
                L     ++  E++D   G+ ++ESD + DPF++HFN   E+FT+K   +FKN  I
Sbjct: 124 IENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQI 183

Query: 192 KYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKV 251
           KY+S K  I+E E +I+S+P I  DE ++ V+  V KSSIHSY LK+RLK+ N+L+DP V
Sbjct: 184 KYRSIKYKINEYESSIYSEPRILEDE-QTKVKSPVLKSSIHSYALKKRLKINNDLLDPAV 242

Query: 252 DPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRL 311
           + LT +QK+LVDPMFQYKDILY+Y +YGKDE+EYR LY LHVLNH+YKTRD+ILKNN ++
Sbjct: 243 NNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKV 302

Query: 312 QDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLP 371
           QDN D E LDQGFTRPKVLIV PTRD  Y ++ +II KSGIDQ+DKK KF+DQF+E+SL 
Sbjct: 303 QDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLL 362

Query: 372 PSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKK 431
           P+SKPKSFQ +FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDII+CSPLG+ MILENTDKK
Sbjct: 363 PASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKK 422

Query: 432 KRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQA 491
           KRQDDFLSSIELMIIDQLHS+E+QNISH+ +I  HINKIP+EQHD DFSR++MWYINDQA
Sbjct: 423 KRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQA 482

Query: 492 KLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFE 551
           KLFRQTM+FTKYISP AN  LNGKCQNWSGRWKNHK+I+ N SSI ++G++++Q+F RF+
Sbjct: 483 KLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFD 542

Query: 552 TVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILF 611
            + GS+VDEPDYRFK+FTSV V +I K+T YEDG LIYI +YTDY+RVRNYLK+KTTILF
Sbjct: 543 IIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILF 602

Query: 612 GDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYT 671
           GDINEYSDQKQ+NSNR+LFQQ RVKVLLYTERLHH+RRYEIKGVKN+VFY+ P NPEFY 
Sbjct: 603 GDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYN 662

Query: 672 EVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           EVVRYIGKNAF GNTD+NIS VR +YSKLD L+LE I+G+KRA VL H QNE YEFK
Sbjct: 663 EVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/729 (62%), Positives = 542/729 (74%), Gaps = 44/729 (6%)

Query: 12  DGVRKRGRKELRNIRRAGGRKPRDAQEN------------GNGISVSENTGEVEEEPSSA 59
           +G  KRGRKELR+IRR    K  +  E+             NG+  +E    VEE+  + 
Sbjct: 14  NGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEEIANVEEDEENK 73

Query: 60  ANXXXXXXXXXXXXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXX 119
                                +++VYGALLTIL                 V +       
Sbjct: 74  ---------------------RRKVYGALLTILNSEHPKPKPKQE-----VTVQSRKEDS 107

Query: 120 XXXXXXXXXXXXXXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFT 179
                             +    ++ SEDD  E  D +EESD+EQD F++HFN V E   
Sbjct: 108 ESDVEEDERDEVEQLEDNLARVDENPSEDDLSE--DADEESDDEQDTFDSHFNQVPENVV 165

Query: 180 DKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQR 239
           DKLD +FK   +KYKS K+PI E+E  ++SKP++  D+    +E+     S+ SY  KQR
Sbjct: 166 DKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQ-SKKLEIPSRHESLKSYVFKQR 224

Query: 240 LKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYK 299
           LK+QN+L   + + LT  Q+ LVDPM QY D+LY+Y+SY KDEDEYRDLY+LHVLNH+YK
Sbjct: 225 LKIQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYK 281

Query: 300 TRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKG 359
           TRDKILKNNQR+ DN D + LDQGFTRPKVLIVVPTRDTAYQV+EKII KSGIDQ+DKKG
Sbjct: 282 TRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKG 341

Query: 360 KFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPL 419
           KF+DQFFE+SLPPSSKPKSFQ +FKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPL
Sbjct: 342 KFRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPL 401

Query: 420 GIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADF 479
           GIQ+ILENTDKKKRQDDFLSSIE+ I DQLHSIEYQN+SH+ TI +H+N IPQEQHD DF
Sbjct: 402 GIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDF 461

Query: 480 SRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKV 539
            RVR+WYIN+QAKLFRQTM+FTKY+SP AN+L+N KCQN +GRWKNH  I  N SSI K+
Sbjct: 462 GRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKL 521

Query: 540 GIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRV 599
           G+K+RQIFQR +    S+++E D+RFKFFTSV +P+I+K+TGYEDG L+YIP+Y D+IRV
Sbjct: 522 GLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRV 581

Query: 600 RNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVV 659
           RNY+K+KTTI+FGDINEYS+QKQLNSNR+LFQQGR KVLLYTERLHH+RRYEIKGVK+VV
Sbjct: 582 RNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVV 641

Query: 660 FYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCH 719
           FYQPP NPEFY+EVVR+I K+A LG TDLNISTVR +YSKLD +SLE IVG+KRA +L H
Sbjct: 642 FYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTH 701

Query: 720 AQNEVYEFK 728
            QNEVYEFK
Sbjct: 702 GQNEVYEFK 710

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/579 (72%), Positives = 495/579 (85%), Gaps = 11/579 (1%)

Query: 158 EESDEEQDPFETHFNSVDE-KFTDKLDVSFKNNDIKYKSTKLPIS---ED---EYAIFSK 210
           E  DEE+DPF+THFN  +  K  + L  + K+N ++YKS KL +    ED   E AIFS 
Sbjct: 125 ESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSV 184

Query: 211 PVIKSDEIESP-VELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYK 269
           P I   E E+P +E    K S+ SYFLK+RL++QNNL+D + + LT LQ+++VDPM QYK
Sbjct: 185 PYI---EGETPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYK 241

Query: 270 DILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKV 329
           DILY+YD+YGKDEDEYRDLY+LHVLNH+YKTRDKI+KNNQ+LQDN D+E LDQGFTRPKV
Sbjct: 242 DILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKV 301

Query: 330 LIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTND 389
           LI+ PTRD+AYQ++ K+I KSG+DQVDKKGKF+DQF++ S PPSSKPKSFQ IFKGNTND
Sbjct: 302 LIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTND 361

Query: 390 FFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQL 449
           +FVLGVKFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKKRQDDFLSS+E+ IIDQ 
Sbjct: 362 YFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQF 421

Query: 450 HSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMAN 509
           HSIEYQN +HLFTI +H+NKIPQEQHDADFSR+RMWYINDQAK FRQTM+FTKYISP+AN
Sbjct: 422 HSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVAN 481

Query: 510 SLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFT 569
           SLLN KC+N  GRWKNHK++S+  SS+  VG+K+RQIFQRF  +  SV DEPDYRFKFFT
Sbjct: 482 SLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFT 541

Query: 570 SVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSL 629
           SV + NI K+TGY+DGTLIYIPEY+DY+RVRNY+K+KT+ILFGDINEYS+Q+ L SNR+L
Sbjct: 542 SVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTL 601

Query: 630 FQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLN 689
           F QGR+KVLLYTERLHH+RRYE+KGVKNVVFY+PP +PEFY EVVRYIGK  FLG+ DLN
Sbjct: 602 FNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLN 661

Query: 690 ISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           ISTVRC YSKLD L+LE IVG+KR GVL H QNE YEFK
Sbjct: 662 ISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 36/80 (45%), Gaps = 19/80 (23%)

Query: 16 KRGRKELRNIRRAGGRK---PRDAQENGNGISVSENTGEVEEEPSSAANXXXXXXXXXXX 72
          KRGRKELR+IRRA   K     DA    +G SV E    VEE+                 
Sbjct: 3  KRGRKELRSIRRAKRTKIEPEADAGVESSG-SVLEAGPAVEEKVQDDGEKEDD------- 54

Query: 73 XXXXXXXMKKQVYGALLTIL 92
                  K+QVY ALLTIL
Sbjct: 55 --------KEQVYNALLTIL 66

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/567 (71%), Positives = 493/567 (86%), Gaps = 1/567 (0%)

Query: 162 EEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESP 221
           ++ D FE+HFN V +   D +   FK+  IKYKS K  + + E AIF KP++ + + E+ 
Sbjct: 139 DQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDET- 197

Query: 222 VELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKD 281
           ++  V  SS  SYF+KQRLK+QN+L+D   + LTPL+K+L+DPMFQYKD+L +Y +Y  D
Sbjct: 198 IDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYEND 257

Query: 282 EDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQ 341
           E EYR+LYSLHVLNH+YKTRDKILK+NQRLQ+N+D ECLDQGFTRPKVLIVVPTRDTAYQ
Sbjct: 258 EKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQ 317

Query: 342 VIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKA 401
           V+E II KSG+DQ+DKKGKFKDQFF+DSLPP+SKPKSF+ +FKGNTNDFFVLG+KFTRKA
Sbjct: 318 VVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKA 377

Query: 402 IKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLF 461
           IKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIE+MI+DQLHSIEYQNISH++
Sbjct: 378 IKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVY 437

Query: 462 TICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSG 521
           TI  HINKIPQ+Q +ADFSR+RMWYINDQAK  RQTMLFT+YISP AN+++NGKC N +G
Sbjct: 438 TILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAG 497

Query: 522 RWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTG 581
           RWKN+++IS+  SSI ++GIKI+QIFQRF+ V G+VVDE DYRFK+FTSV + NIVK+TG
Sbjct: 498 RWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTG 557

Query: 582 YEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYT 641
           YEDG L+YIPEYTDY+R+RNY+K+KTTILF +INEYS QKQL+SNRS+FQQGR KVLLYT
Sbjct: 558 YEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYT 617

Query: 642 ERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLD 701
           ERLHHYRRYE+KG+K+V+FY+PP NPEFY EV+R+  KNAFLG +D+NIST+R +YSKLD
Sbjct: 618 ERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLD 677

Query: 702 ALSLENIVGSKRAGVLCHAQNEVYEFK 728
            L+L+ IVGSKRA +LCH QNE Y+FK
Sbjct: 678 GLALQRIVGSKRAAILCHGQNESYDFK 704

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 39/91 (42%), Gaps = 14/91 (15%)

Query: 2  KRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAAN 61
          + SGT     +G +KRGR ELR+IRR     P  +Q + +   V       E E   +  
Sbjct: 3  RHSGTS----EGPKKRGRTELRSIRR-----PNRSQHSKHDQQVVH-----ESENEDSLE 48

Query: 62 XXXXXXXXXXXXXXXXXXMKKQVYGALLTIL 92
                             K++VYGALLTIL
Sbjct: 49 SSSDDDEDIAQAEAENSDRKEKVYGALLTIL 79

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/714 (60%), Positives = 529/714 (74%), Gaps = 19/714 (2%)

Query: 16  KRGRKELRNIRRAGGRKPR-DAQENGNGISVSENTGEVEEEPSSAANXXXXXXXXXXXXX 74
           K GRK+LR I RAG ++ R D +     ++    +     EPS AA              
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQH------ 62

Query: 75  XXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXXXXXXX 134
                 + Q Y ALLT+L                                          
Sbjct: 63  ------RGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIE 116

Query: 135 XXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYK 194
             L         E+D ++   D +ES++E DPFE+HF+   E      D  FK+  +KYK
Sbjct: 117 NALDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYK 176

Query: 195 STKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPL 254
           S+K  +SE+E  I+SKP +  +E+  PV+    K ++ SYF+KQ+LK+ N+  +  + PL
Sbjct: 177 SSKTDVSEEESLIYSKPCLDDEEV-LPVK---GKQTLSSYFIKQKLKLANDFQNNGL-PL 231

Query: 255 TPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDN 314
           T +QK+LVDPMFQYKD+LY+YD Y  DED+YRDLYSLH LNH+YKTRD+ILKNNQ+LQ+N
Sbjct: 232 TEIQKELVDPMFQYKDMLYEYDDYA-DEDQYRDLYSLHALNHVYKTRDRILKNNQKLQEN 290

Query: 315 NDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSS 374
           ND E LDQGFTRPKVLIVVPTRD A++++ KI+ KSG+DQ DKK KF+DQFFEDSLPP+S
Sbjct: 291 NDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTS 350

Query: 375 KPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 434
           KPKSFQ IF+GNTNDFFVLG+KFTRK++K+YSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 351 KPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQ 410

Query: 435 DDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLF 494
           DDFLSSIE+MIIDQLHSIEYQN  H+ TI  HINKIP++Q +ADFSR+RMWYIN+QAK F
Sbjct: 411 DDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFF 470

Query: 495 RQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVN 554
           RQT++FTKYISP ANS+LNGKC+N +GRWKNH+ I    SSI ++G+K+RQIFQRF+   
Sbjct: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAG 530

Query: 555 GSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDI 614
           G+ +DEPDYRFKFFTSV VP+IVK+TGYEDG L+YIP+YTD+IRVRNYLK+KTTI+FG+I
Sbjct: 531 GTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEI 590

Query: 615 NEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVV 674
           NEYS+QKQL SNR+ FQ G+VKVLLYTERLHH+RRYEIK VK+V+FY+PP NPEFY+EVV
Sbjct: 591 NEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVV 650

Query: 675 RYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           R IGKN FLGN D+NISTVRC+YSK+D LSLE +VGSKRA VL H QNEVYEFK
Sbjct: 651 RNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/721 (59%), Positives = 541/721 (75%), Gaps = 24/721 (3%)

Query: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISV-SENTGEVEEEPSSAANXXXXXXXXXXXXX 74
           KRGRK+LR I R G  +  D + NG+ +     N G+   E +   +             
Sbjct: 4   KRGRKQLRKITRIGRNRSED-KANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTA 62

Query: 75  XXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXXXXXXX 134
                    VYGALL+IL                 V +                      
Sbjct: 63  --------HVYGALLSILNSAHPEIRRKR------VKVEKTTDAVVEERKNGSRNYETDE 108

Query: 135 XXLMGSHADDASEDDDKEHG-----DDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNN 189
              + +  DD+ + D++         D E+S++E+DPFE HFN + E  T+KLD +FK  
Sbjct: 109 VATISASLDDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEK 168

Query: 190 DIKYKSTKLP-ISEDEYAIFSKPVIKSDEIESPV-ELSVNKSSIHSYFLKQRLKMQNNLM 247
            ++Y+STKLP + ++E  IFSKPVI+  +    V +  V K +IHSYF+K++LK+ N L+
Sbjct: 169 TVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLL 228

Query: 248 DPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKN 307
           D K  PLTPL K LVDP+FQY+D+L++Y+ + + E EYRDLY+LH+LNH+YKTRD+ILKN
Sbjct: 229 DDKKKPLTPLSKTLVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKN 287

Query: 308 NQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFE 367
           N +LQ+N+D E LDQGFTRPKVL+V PTR+TAY +IEKII KSG+DQVDKK KFKDQF+E
Sbjct: 288 NHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYE 347

Query: 368 DSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILEN 427
           DSLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+I+CSPLGIQ+ILEN
Sbjct: 348 DSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILEN 407

Query: 428 TDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYI 487
           TDKKKRQDDFLSSIE++++DQLHS+E+QN +H+ +I  HINKIPQ+QHD+DFSR+RMWYI
Sbjct: 408 TDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYI 467

Query: 488 NDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIF 547
           NDQA+LFRQT++FTKY+SP ANSL+NGKC NWSGR+KN + IS   S+I+++G+K+RQ+F
Sbjct: 468 NDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVF 527

Query: 548 QRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKT 607
            RF+   GS VDEPDYRFKFFTSVTVP I K+TGYEDG L+YIP+YTD++RVRNY KD+T
Sbjct: 528 HRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQT 587

Query: 608 TILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNP 667
            ILFG+I EYSDQ+Q+ SNR+LFQQG+VKVLLYTERLHH+RRY+IKGVK+V+FY+PP NP
Sbjct: 588 RILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNP 647

Query: 668 EFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEF 727
           EFY E++R IGKNAFLGN DLNISTVRC Y KLD+LSLE IVGSKRA VL  +QNE+YEF
Sbjct: 648 EFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEF 707

Query: 728 K 728
           K
Sbjct: 708 K 708

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/564 (71%), Positives = 487/564 (86%), Gaps = 4/564 (0%)

Query: 167 FETHFNSVDEKFTDKLDVSFKNNDIKYKSTK--LPISEDEYAIFSKPVIKSDEIESPVEL 224
           F+ HFN V E   DK+   F N  IKY S K  LP  E ++ I+SKP++  D  +  VE 
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIV-DDGNKHKVES 213

Query: 225 SVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDE 284
            + KSS+ SYF+K+RL++ NNL+D K D LT LQK LVDPMFQY DIL++Y++YG DE E
Sbjct: 214 PIKKSSLDSYFIKKRLEITNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQE 272

Query: 285 YRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIE 344
           YR+LY+LH+LNHLYKTRDK+LK+NQRLQ+NN++E LDQGFTRPKVLIVVPTRDTAY V+E
Sbjct: 273 YRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVE 332

Query: 345 KIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKL 404
            II KSG+DQV+KKGKFK QFFEDSLPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKA+KL
Sbjct: 333 TIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKL 392

Query: 405 YSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTIC 464
           YSNFYQSD+IICSPLG+ MI ENTDKKK+QDDFLSSIE+ I+DQLHS+EYQNISH+  I 
Sbjct: 393 YSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIF 452

Query: 465 NHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWK 524
            H+NKIP+EQHDADFSR+RMWYINDQA+LFRQTM+FTKY+SP AN+++NGKC+N +GRW+
Sbjct: 453 EHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWR 512

Query: 525 NHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYED 584
           N   +++  SS+ K+G+KIRQIFQRF+ V G++ DEPD+RFKFF SV + +I+K+TGYED
Sbjct: 513 NKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYED 572

Query: 585 GTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERL 644
           G L+YIP Y+DY+RVRNY+K+KTT+LFGDINEYSDQ++LNSNRSLFQQGRVKVLLYTERL
Sbjct: 573 GILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERL 632

Query: 645 HHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALS 704
           HHYRRYEIKGVK+V+FY PP NPEFY EVVR+IGKNAFLGN D+NI+TVR +YSKLD+LS
Sbjct: 633 HHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLS 692

Query: 705 LENIVGSKRAGVLCHAQNEVYEFK 728
           LE IVG++RA VL  A+NEVYEFK
Sbjct: 693 LERIVGTQRAAVLSRAENEVYEFK 716

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 10 GYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEE-EPSSAANXXXXXXX 68
          G    +KRGR +LR I+R+   K R++     G +   NT   +E +P+ A         
Sbjct: 3  GRGEFKKRGRSQLRTIQRSKYAKKRNS-----GRNYDTNTKHNDESKPADALVSGEEAES 57

Query: 69 XXXXXXXXXXXMKK--QVYGALLTIL 92
                      KK  QVYGALLTIL
Sbjct: 58 ESDDAKDEEDVGKKRNQVYGALLTIL 83

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/591 (66%), Positives = 496/591 (83%), Gaps = 3/591 (0%)

Query: 138 MGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTK 197
           + S  D+A+E  D+E  ++ ++ +   DP E HFNSV EK TD LD +FK   ++Y+S+K
Sbjct: 140 LDSDGDEAAEIGDEEDDNNGDQDENASDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSK 199

Query: 198 LPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPL 257
           + IS++E  I+S+P +   E  +P+++     S+  YF+KQRLK+QN+L+D K + LTPL
Sbjct: 200 IKISKNEEFIYSRPDLNL-ESRTPIQVPQGTQSLSPYFIKQRLKIQNDLLDSK-NNLTPL 257

Query: 258 QKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDT 317
           QK++VDP+FQY+D+LY+Y++Y + E EYRDLY+LH L+H+YKTRD+ILKNNQRLQDN D 
Sbjct: 258 QKKIVDPIFQYQDLLYEYENYDQ-ETEYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQ 316

Query: 318 ECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPK 377
           E LDQGFTRPKVLIVVPTRD AY V+ KII KSG+DQVDKK KF+DQF++DSLPP  KPK
Sbjct: 317 EVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPK 376

Query: 378 SFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDF 437
           SFQ +FKGNTNDFFVLG KFTRK IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDF
Sbjct: 377 SFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDF 436

Query: 438 LSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLFRQT 497
           LSSIEL++IDQLHSIE+QN+ HL +I  HINKIPQ+QHDADFSR++MWYINDQAKLFRQT
Sbjct: 437 LSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQT 496

Query: 498 MLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSV 557
           ++FT++ +P ANSL+NGKC+N++GRWKNH ++    SS+S++G++ R +FQRF+   G+ 
Sbjct: 497 LIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAA 556

Query: 558 VDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDINEY 617
            DEPD+RFK F SV VPNIV++TGYEDG L+YIP+YTD+IRVRNYL++KTTILFGDI+EY
Sbjct: 557 TDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTDFIRVRNYLREKTTILFGDISEY 616

Query: 618 SDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYI 677
           S+Q+QL +NR+LFQQGRVKVLLYTERLHH+RRYEIKGVK V+FY+PP NPEF+ E VRY+
Sbjct: 617 SEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYL 676

Query: 678 GKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
            K+AFLG  DLNIS VRCLYSKLD L+LE IVG++RA +L H  NE YEFK
Sbjct: 677 AKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAAILTHGPNETYEFK 727

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/594 (68%), Positives = 495/594 (83%), Gaps = 9/594 (1%)

Query: 140 SHADDASEDDDKEHGDDNE-----ESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYK 194
           SH DD +    +E GD  E     E +++ D  E HFNSV EK T+ LD +FK  +++Y+
Sbjct: 158 SHQDDIN-GVTREGGDATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYR 216

Query: 195 STKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPL 254
           S KL + +++  I+S+P +  +E  S V       S++SYF+KQRLK+QN+L+D + D L
Sbjct: 217 SCKLHVDKNQEFIYSRPTL-VNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKL 274

Query: 255 TPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDN 314
           TPLQKQ+VDPMFQY+D+LY+Y+ Y K E EYRDLY+LHVLNH+YKTRD+ILKNNQRLQ+N
Sbjct: 275 TPLQKQIVDPMFQYQDLLYEYEDYDK-ETEYRDLYALHVLNHIYKTRDRILKNNQRLQEN 333

Query: 315 NDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSS 374
            D E LDQGFTRPKVLIV PTRD AY ++ KII KSG+DQVDKK KFKDQFF+++LPPS 
Sbjct: 334 PDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSY 393

Query: 375 KPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 434
           KPKSFQ +FKGNTNDFFVLG KFTRK IKLYSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 394 KPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQ 453

Query: 435 DDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLF 494
           DDFLSSIEL+++DQLHSIE+QN+ HL +I  HINKIPQ+QHDADFSR++MWYINDQAKLF
Sbjct: 454 DDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLF 513

Query: 495 RQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVN 554
           RQT++FTK+ SP ANSL+NGKC+N++GRWKNH+VI   +SS+ ++G++ R IFQRF+ V 
Sbjct: 514 RQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVG 573

Query: 555 GSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDI 614
            SV +EPD RFK F SV VPNIVK+TGYEDG L+YIP+YTD++RVRNYL++KTTILFGDI
Sbjct: 574 KSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDI 633

Query: 615 NEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVV 674
           NEYS+Q+QL SNR++FQQGRVKVLLYTERLHH+RRYEIKGVK V+FY+PP NPEF+ EV 
Sbjct: 634 NEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVA 693

Query: 675 RYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           RY+GK+AFLG  DLNIS VRCL+SKLD LSLE IVG++RA VL H  NE YEFK
Sbjct: 694 RYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 15/95 (15%)

Query: 1  MKRSGTGADGYDGVR--KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTG-EVEEEPS 57
          +KRS +   G +  R  K GRK+LR IR+A G +   A+E+ N     EN G E E E  
Sbjct: 4  LKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLAEESAN----EENNGSETEAEDK 59

Query: 58 SAANXXXXXXXXXXXXXXXXXXMKKQVYGALLTIL 92
           AA                      + Y ALLT+L
Sbjct: 60 LAA--------PELNEPAQDQRAGGEAYAALLTLL 86

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/719 (59%), Positives = 521/719 (72%), Gaps = 33/719 (4%)

Query: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEE----PSSAANXXXXXXXXXX 71
           KRGRK+LRNI R G             I V E+  +  EE     + A            
Sbjct: 13  KRGRKQLRNITRIG-----------RAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNH 61

Query: 72  XXXXXXXXMKKQVYGALLTILXXXXXXXXXXXXXXXXXVLLXXXXXXXXXXXXXXXXXXX 131
                    + Q YGALLT+L                   L                   
Sbjct: 62  PAEDDGGARESQSYGALLTLLSAEHGKQRKKR--------LRKAEAEAAEAAEAGEDPEE 113

Query: 132 XXXXXLMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDI 191
                L  S A DA + +D    DD+ ESDEEQD F+ HFN V      +LD +FKN   
Sbjct: 114 AITAALENS-AQDAEDAEDA--FDDSGESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRA 170

Query: 192 KYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLM--DP 249
           +Y+  K    E+E  ++SKPV  S+  E PV   V   S+  Y +KQRL+M N L   DP
Sbjct: 171 QYRVQKEARGEEE-ILYSKPVASSEGTEGPVR--VPARSLRGYAIKQRLRMHNGLTADDP 227

Query: 250 KVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQ 309
           +  PLTP QK L+DPMFQY+DILY+Y+ Y + E EYR+LY+LH+LNH+YKTRD+ILKNNQ
Sbjct: 228 E-KPLTPQQKVLLDPMFQYQDILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNNQ 285

Query: 310 RLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDS 369
           +LQDN D E LDQGFTRPK L+VVPTR TAY V++ ++ +SGI+QVDKK KFKDQF++ S
Sbjct: 286 KLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPS 345

Query: 370 LPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTD 429
           LPP+SKPKSFQ +FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+I+CSPLG+Q+I+ENTD
Sbjct: 346 LPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTD 405

Query: 430 KKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYIND 489
           KKKRQDDFLSSIE+M++DQLHSIE+QNI+H+  I  HINKIPQ+Q DADFSR+RMWYI D
Sbjct: 406 KKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIED 465

Query: 490 QAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQR 549
           QAKLFRQTM+FT+YISP AN+LLN KC NW+GR K+H+V+S   S I ++G+K+RQIFQR
Sbjct: 466 QAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQR 525

Query: 550 FETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTI 609
           FE + GS VDEPD+RFKFFTSV VP I KTTGY+ G L+YIPEYTD+IRVRNYLKDKT I
Sbjct: 526 FEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRI 585

Query: 610 LFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEF 669
           LFGDINEYSDQ+QL SNR+LFQ GR+KVLLYTERLHH+RR+E+KGVK+V+ Y+PP NPEF
Sbjct: 586 LFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEF 645

Query: 670 YTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728
           Y E++RYIGK+AFLG  DLNI+TVRCLYSK+D+L+LE IVG+KRA VL H QNEVYEFK
Sbjct: 646 YQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/564 (71%), Positives = 476/564 (84%), Gaps = 6/564 (1%)

Query: 166 PFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVI-KSDEIESPVEL 224
           PFE+HFN   E   D LD ++K   I  KS K+ + +DE  I++K +  K  E E P   
Sbjct: 151 PFESHFNMQSESI-DSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQEFELPS-- 207

Query: 225 SVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDE 284
             +K  + SY LK++LK+QNNL++ + D LTPLQ+++VDP+FQY+D+LY+Y+ Y +DEDE
Sbjct: 208 --HKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDE 265

Query: 285 YRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIE 344
           YRDLY LHVLNH+YKTRD+ILK+NQRL  N D E LDQGFTRPKVLIV PTRDTAYQ++ 
Sbjct: 266 YRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVS 325

Query: 345 KIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKL 404
           K+I KSG+DQVDKK K +DQFFED LPPSSKPKSF+  FKGNTNDFFVLGVKFTRKAI+L
Sbjct: 326 KVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRL 385

Query: 405 YSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTIC 464
           YSNFYQSD+I+CSPLG+Q+ILENTD+KKRQDDFLSSIELMIIDQL+SIE+QN+SHLFTI 
Sbjct: 386 YSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIF 445

Query: 465 NHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWK 524
            H+NKIP+EQHD DF RVRMWYIN+QAKL RQT++FT+Y++P AN LLNGKC+N  GRWK
Sbjct: 446 AHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWK 505

Query: 525 NHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYED 584
           NH  I+   SS+SK+G ++RQIFQR +    SVVDEPDYRF+FFTSV VP+I K+TGYED
Sbjct: 506 NHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYED 565

Query: 585 GTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERL 644
           G L+YIP+Y D+IRVRNYLKDKTTILFGDINEYSD +QL S RSLFQQGR+KVLLYTERL
Sbjct: 566 GILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERL 625

Query: 645 HHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALS 704
           HH+RRYEIKGVK+V+FYQPP NPEFY EVVRYIGK+AFLG+TDLNISTVRC+YSKLD L+
Sbjct: 626 HHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLA 685

Query: 705 LENIVGSKRAGVLCHAQNEVYEFK 728
           LE IV SKRA VL H QNE+YEFK
Sbjct: 686 LERIVSSKRAAVLTHGQNEIYEFK 709

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 12/92 (13%)

Query: 1  MKRSGTGADGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAA 60
          +KR+G G D  DG RKRGRK+LR+IRRA  R  ++  E       SE  GE+ E+    A
Sbjct: 2  VKRTGNGTDAIDGSRKRGRKDLRSIRRA--RNDKEPVEEPEIPVASEEDGELSEDSEEDA 59

Query: 61 NXXXXXXXXXXXXXXXXXXMKKQVYGALLTIL 92
                              K++ YGALLTIL
Sbjct: 60 TNEVQEQEDS----------KEKAYGALLTIL 81

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 80/199 (40%), Gaps = 44/199 (22%)

Query: 495 RQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVN 554
           RQTM+FT   SP    + NG  +  S     +  +    S       KI+QI +      
Sbjct: 324 RQTMMFTATFSPTIEKVANGYLKKPS-----YVTVGGEESK-----PKIKQIVR------ 367

Query: 555 GSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDK-------T 607
              V + + + K      +PN      Y+   +I+I    +Y R  ++L DK        
Sbjct: 368 --YVPDEEEKLKILVKDFLPN------YKAPIIIFI----NYKRTADWLFDKLREARFRA 415

Query: 608 TILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNP 667
           T L G       Q+Q   + SL + G+V +L+ T+     R  +I  V  VV  Q PK+ 
Sbjct: 416 TTLHGS----KSQEQREHSLSLLRNGKVDILIATDVAG--RGIDIPNVSLVVNLQFPKS- 468

Query: 668 EFYTEVVRYIGKNAFLGNT 686
             +   V  +G+    G T
Sbjct: 469 --FDSFVHRVGRTGRAGKT 485

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 80/196 (40%), Gaps = 34/196 (17%)

Query: 495 RQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVN 554
           RQT++FT  ++P+   +  G       R   +  I  ++ S       I+QI +      
Sbjct: 388 RQTLMFTATMTPVIEKIAAGYM-----RKPVYATIGVDTGSEPL----IQQIVE------ 432

Query: 555 GSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYI--PEYTDYI--RVRNYLKDKTTIL 610
               D  + +FK   S+        T YE   +I+I   +  D++  R +     + TIL
Sbjct: 433 --YADNEEQKFKKLKSIV-------TKYEPPIIIFINYKQTADWLAERFQKETNMRVTIL 483

Query: 611 FGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFY 670
            G       Q+Q   +  LF+ GRV+V++ T      R  +I  V  VV +Q  K  + Y
Sbjct: 484 HGS----KSQEQREHSLQLFRSGRVQVMIATNV--AARGLDIPNVSLVVNFQISKKIDDY 537

Query: 671 TEVVRYIGKNAFLGNT 686
              +   G+ A  G  
Sbjct: 538 IHRIGRTGRAAKKGTA 553

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 30/136 (22%)

Query: 218 IESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPL----QKQLVDPMFQYKDILY 273
           ++SP+ +++N +++ +  + Q++++ NN +D K D L  L    Q +LV P    K I++
Sbjct: 510 LKSPLSITINSNTMVNENVTQKVELCNNELD-KFDILLSLLEKHQAKLVSPEQDEKVIIF 568

Query: 274 QYDS------YGKDEDEYRDLYSLHV----------LNHLYKTRDKILKNNQRLQDNNDT 317
                     Y K E+   DL+++H           LN   +T + IL           T
Sbjct: 569 VASQQICDTLYAKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILIC---------T 619

Query: 318 ECLDQGFTRPKVLIVV 333
           E L +G   P+V +VV
Sbjct: 620 EVLSRGLNVPEVSLVV 635

>NCAS0H00620 Chr8 (105816..109019) [3204 bp, 1067 aa] {ON} Anc_7.462
           YJR091C
          Length = 1067

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 14/93 (15%)

Query: 506 PMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRF 565
           P  ++ L+   +N +   KN +   TNSSS S V +K +Q+              P    
Sbjct: 62  PSISAKLHHSKKNGTVHGKNGEFSPTNSSSGSTVDLKAQQV-------------SPLKPM 108

Query: 566 KFFTSVTVPNIVK-TTGYEDGTLIYIPEYTDYI 597
           K FT+ T  N+   T   E+G L++ P+ T+Y+
Sbjct: 109 KNFTATTTGNLSDLTPPQENGKLVHFPDTTNYM 141

>TDEL0D02050 Chr4 complement(397206..402035) [4830 bp, 1609 aa] {ON}
           Anc_1.337 YBR275C
          Length = 1609

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 611 FGDINEYSDQKQLNSNRSLFQ---QGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNP 667
           FG++++  D    +SN   FQ   +G +++L   ER H  RR+E+    N +   PP N 
Sbjct: 193 FGEVHKMLD----SSNFKEFQKIIEGGLEILANNERSHVARRFEVYASFNNII--PPNNL 246

Query: 668 EFYTEVV 674
           ++++E++
Sbjct: 247 KYHSELI 253

>NDAI0D02410 Chr4 (554265..560273) [6009 bp, 2002 aa] {ON} Anc_5.113
           YGR217W
          Length = 2002

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 20/90 (22%)

Query: 145 ASEDDDKEHGDD----------NEESDEEQDPFETHFNS---------VDEKFTDKLDVS 185
           A+ D   ++G D          N E   E+ P  T  ++         VD+  + +LD S
Sbjct: 193 ATVDTTSQNGHDELRVSGKWSYNNEQTPEEGPSRTPNSAGVYGDGSIFVDDIGSKELDTS 252

Query: 186 FKNNDIKYKSTKLPISEDEYAIFSKPVIKS 215
           FK NDI   +  LP+ + E  + +KP++K+
Sbjct: 253 FKENDIAVSTISLPLPDFEQPL-NKPILKT 281

>Skud_13.15 Chr13 complement(20641..21579) [939 bp, 312 aa] {ON}
           YML125C (REAL)
          Length = 312

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 21/128 (16%)

Query: 551 ETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDG------------TLIYIPEYTDYIR 598
           ET   +V+DEP +      ++ +  +  TT Y  G            T+I+I  YT Y R
Sbjct: 5   ETEGTNVLDEPIHGIYIPAALFIVGVAITT-YMSGELKILWSLPILSTIIFIRAYTAYKR 63

Query: 599 VRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQ---QGRVKVLLYTERLHHYRRYEIKGV 655
            R+   +K + L     E  DQ  ++ N +L++   + R++ L      H   R  + G 
Sbjct: 64  RRSLFPNKWSPL-----ELEDQTIISKNTALYRFRLKTRLESLEIPAGHHVAVRVPVDGK 118

Query: 656 KNVVFYQP 663
             + +Y P
Sbjct: 119 DEIRYYNP 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,016,403
Number of extensions: 4101552
Number of successful extensions: 35092
Number of sequences better than 10.0: 487
Number of HSP's gapped: 34135
Number of HSP's successfully gapped: 561
Length of query: 728
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 611
Effective length of database: 40,065,477
Effective search space: 24480006447
Effective search space used: 24480006447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)