Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J013302.293ON49149125790.0
NDAI0B035202.293ON50149816830.0
NCAS0B062202.293ON48648816760.0
KNAG0A053902.293ON49748816740.0
Smik_9.892.293ON49149216460.0
YIL090W (ICE2)2.293ON49149216190.0
Skud_9.832.293ON49149216160.0
Suva_9.1092.293ON49149216150.0
CAGL0D04202g2.293ON49950315940.0
TDEL0G022302.293ON48848815790.0
ZYRO0A02024g2.293ON48648615040.0
SAKL0E07524g2.293ON47949214700.0
Kpol_1003.422.293ON49049113880.0
KLTH0G10516g2.293ON47449313350.0
Kwal_27.115002.293ON47549313201e-179
ADL208W2.293ON50251212151e-163
Ecym_33322.293ON51351812041e-161
KLLA0E08207g2.293ON48648711721e-157
TPHA0C034402.293ON57953711801e-157
TBLA0B059802.293ON49349911611e-155
TBLA0B069902.293ON53653011351e-150
TDEL0E017404.199ON42384770.79
KLLA0F01012gna 1ON55649741.6
TDEL0B009808.799ON1559108741.8
TPHA0B004104.344ON94564689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01330
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   998   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   652   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   650   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   649   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   638   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   628   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   627   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   626   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   618   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   612   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   583   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   570   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   539   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   518   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   513   e-179
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   472   e-163
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   468   e-161
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   456   e-157
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   459   e-157
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   451   e-155
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            441   e-150
TDEL0E01740 Chr5 complement(335052..336323) [1272 bp, 423 aa] {O...    34   0.79 
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...    33   1.6  
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    33   1.8  
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    31   9.5  

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/491 (100%), Positives = 491/491 (100%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDL 120
           ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDL
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDL 120

Query: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180
           MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS
Sbjct: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180

Query: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240
           NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER
Sbjct: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240

Query: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300
           GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV
Sbjct: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300

Query: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360
           ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG
Sbjct: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360

Query: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420
           MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI
Sbjct: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420

Query: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480
           LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY
Sbjct: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480

Query: 481 GGELFGTPTAD 491
           GGELFGTPTAD
Sbjct: 481 GGELFGTPTAD 491

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/498 (65%), Positives = 399/498 (80%), Gaps = 17/498 (3%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           ++S S +RG+R FS  FYLLFTLISIP+SFKIGG+ CGL+FT TLF  YFLSTTLS+LAR
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVL--VANQDL 120
           + GS F I LT  +YY QHLIIASLLY FLSGFS+++L   L D T+K++++  V  ++L
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180
             + SNW LY  YY++ V+PWK++LSYSTPFF L+EGFFTILAIQA+GETN+WL +E NS
Sbjct: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180

Query: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240
           N+WIISSLL S GV+TASLYYLYRIYVTPIW+LS QTA+LLG  LSL  GLG++GI++E+
Sbjct: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240

Query: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300
           GSV+ESSLFFAYIVRCIYEISPKLATTATDEILE+FKEVWQ HQG LP TDN+L YY + 
Sbjct: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300

Query: 301 ILKNTEMIWEAFLSKTKQHS-NHTLNSFFTAENFWIHF----------NPLWKFFKNFTI 349
           +L++ +M+WE  +SK  Q+  N+TL S F   NF   F           P+WK FKNFT+
Sbjct: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNI-NFLTTFLSKDLLLRICKPIWKLFKNFTV 359

Query: 350 SVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRI 409
           SVP SISEL  +  QMA ES+SPAVV+NLCFRVLIFYSATRIIP+LQR+   + +KSRRI
Sbjct: 360 SVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRI 419

Query: 410 MKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWN 469
           MK+LYWYSPC+LIAMYTHLILQYSGELK++L LWG +  L +L+  +   ++VDSW FWN
Sbjct: 420 MKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCN--LKWLIPNQP-ELIVDSWGFWN 476

Query: 470 WCNIFWTILIYGGELFGT 487
           WCNIF+TI+IY  ELFGT
Sbjct: 477 WCNIFFTIIIYASELFGT 494

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/488 (66%), Positives = 398/488 (81%), Gaps = 11/488 (2%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           ++S S IRG+RI S TFYLLFTLISIP+SFKIGG+HCGL+FTV+LFI YFLSTTLSI AR
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVL--VANQDL 120
           + GSR +I+LT+++YY QH IIASLLY FLSGFSN++L  +L+DG + I+ +  +  +++
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 121 MVS-ESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKN 179
             S ++NW+LY YYY + V+PW+F+LSYSTPFF L+EGFFTILAIQAIGETN+WL  E N
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 180 SNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISE 239
           SN+W+ISSLLAS GV+TASLYYLYRIYVTPIW+LS QTA+LLG  LSL  GLGI+GI+++
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 240 RGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRS 299
           +GSV+ESS+FFAYIVRCIYEISPKLATTAT+EILE+FKEVWQ HQ  L   +N+L+YY +
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 300 VILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELS 359
           V+LKN E IWE+F    K + N  + SF T     I F P+WK  K FTI+VP SI+EL 
Sbjct: 301 VVLKNIETIWESF----KINDNSFITSFSTERVITI-FMPIWKLLKTFTITVPSSINELC 355

Query: 360 GMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPC 419
            +  +MA ESISPAV+VNLCFRVLIFYSATRIIP+LQR++  + RKSRRIMKVLYWYSPC
Sbjct: 356 FVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPC 415

Query: 420 ILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILI 479
           ILIAMY HLILQYSGELK EL LWG +SK   +   ++  I+VDSW FWNWCNIF+TIL+
Sbjct: 416 ILIAMYAHLILQYSGELKDELCLWGCNSK---IFPSDQPKIIVDSWGFWNWCNIFFTILV 472

Query: 480 YGGELFGT 487
           Y  EL GT
Sbjct: 473 YASELIGT 480

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/488 (65%), Positives = 390/488 (79%), Gaps = 2/488 (0%)

Query: 4   LSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILARQ 63
           L+   IRG RI SG  YLL TLISIP+SFK+GG++CGL+FT TLFI YF+STTLSI+AR+
Sbjct: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64

Query: 64  SGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVL--VANQDLM 121
           +G+R YIVL+S++YYCQH IIASLL+ FLSGFSN ELH+++++    IE L  + N  + 
Sbjct: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124

Query: 122 VSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSN 181
            SE+NW+ Y YYY YVV PWKFVLS+STPFF L+EGFFTILAIQAIGETN+WL  EKNSN
Sbjct: 125 SSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSN 184

Query: 182 SWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERG 241
           +WIISSLL SS V++A+LYYLYRIYVTPIWEL+ QTA+LLG VLSL  GLGI+GI+S+ G
Sbjct: 185 AWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSG 244

Query: 242 SVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVI 301
           SV+ESSLFFAYIVRCIYEISPKLATTATDE+LELFK+VWQ+ QG LPI +N++ YY +VI
Sbjct: 245 SVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVI 304

Query: 302 LKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGM 361
           LKN EM W+ F+ +T        N      N W    P+WKFFKNFT+SVPFSI E+  M
Sbjct: 305 LKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLM 364

Query: 362 MLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCIL 421
             +M+ ES+SPAVV+NLCFR+LIFYSATRI+PSLQRK+ R+ R+SR++M+++YWYSPCIL
Sbjct: 365 TWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCIL 424

Query: 422 IAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIYG 481
           IAMY HLILQYS ELK EL LWG ++ L      +   +VVD+W FWNWCN+F TIL+Y 
Sbjct: 425 IAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYA 484

Query: 482 GELFGTPT 489
            EL G  T
Sbjct: 485 NELIGDTT 492

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/492 (64%), Positives = 391/492 (79%), Gaps = 8/492 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MT LSKS ++  RI +  FYLLFTL+SIP+SFK+GG+ CGLSFTVTLF  YF++TTL++L
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118
           AR+ G + YI LTS +YY QH IIASLLY FLSGFSNDEL  VLK    + E  +     
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
            L  ++ N++LY YY+ +VV+PW+F+L+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN+WIISSLLAS GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
           ++GSV+ESSLFFAYIVRCIYEISPKLATTATDEIL+LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355
           +VILKN EM+W +F+ + ++ +   +  L S  + E   +   P WKFFKNFT SVP SI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415
           +E   + ++MASES+SPA+VVNLCFRVL+FYSATRIIP+LQRK  +  RKSRRIMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475
           YSPCILIAMYTHLILQYSGELK++L +WG   K  F  D+ E  I+VDSW FWNWCNIF 
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW-FGSDQPE--IIVDSWGFWNWCNIFC 477

Query: 476 TILIYGGELFGT 487
           TIL+Y  EL G+
Sbjct: 478 TILVYATELIGS 489

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/492 (64%), Positives = 390/492 (79%), Gaps = 8/492 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MT LSKS ++  RI +  FYLLFTL+SIP+SFK+GG+ CGLSFTVTLF  YF++TTL++L
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118
           AR+ G R YI  T+ +YY QH IIASLLY FLSGFSNDEL  VLK+   + E  +     
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
            L  ++ N++LY YYY +VV+PW+FVL+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN+WIISSLL S GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
           ++GSV+ESSLFFAYIVRCIYEISPKLATTATDEIL LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355
           +VILKN E++W +F+ + ++ +   +  L S  + E   +   P WKFFKNFT SVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415
           +E   + ++MASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  +  RKSRRIMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475
           YSPCILIAMYTHLILQYSGELK++L +WG   K  F VD+ E  I+VDSW FWNWCNIF 
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW-FGVDQPE--IIVDSWGFWNWCNIFC 477

Query: 476 TILIYGGELFGT 487
           TIL+Y  EL G+
Sbjct: 478 TILVYATELIGS 489

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/492 (63%), Positives = 393/492 (79%), Gaps = 8/492 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MT LSKS ++  R+ +  FYLLFTL+SIP+SFK+GG+ CGLSFTVTLF  YF++TTL++L
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIE-VLVANQD 119
           A++ G + YI LT+ +YY QH +IASLLY FLSGFSNDEL  VLK+ + + E  L A +D
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 120 LMVSES-NWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
            + S   N++LY YYY +VV+PW+FVL+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN+WIISSLLAS GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
           ++GSV+ESSLFFAYIVRCIYEISPKLATTATDEIL+LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355
           +V+LKN EM+W +F+ + ++ +   +  + S  + E   +   P WKFFKNFT SVP SI
Sbjct: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360

Query: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415
           +E   + ++MASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  +  RKSRRIM+ LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420

Query: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475
           YSPCILIAMYTHLILQYSGELK++L +WG   K       E+  I+VDSW FWNWCNIF 
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEK---WFGAEQPEIIVDSWGFWNWCNIFC 477

Query: 476 TILIYGGELFGT 487
           TIL+Y  EL G+
Sbjct: 478 TILVYATELIGS 489

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/492 (64%), Positives = 393/492 (79%), Gaps = 8/492 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MT LSKS ++  RI +  FYLLFTL+SIP+SFK+GG+ CGLSFTVTLF  YF++TTL++L
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118
           AR++G R YI LTS +YY QH +IASLL+ FLSGFSNDEL  VLK+ + + E  +     
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
            L  ++ N++LY YYY +VV+PW+F+L+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN+WIISSLLAS GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
           +RGSV+ESSLFFAYIVRCIYEISPKLATTATDEIL+LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355
           +VILKN E++W +F+ + ++ +   +  + S  + E   +   P W+F KNFT SVP SI
Sbjct: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360

Query: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415
           +E   + ++MASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  +  RKSRRIMK LYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475
           YSPCILIAMYTHLILQYSGELK++L +WG   K  F  D+ E  I+VDSW FWNWCNIF 
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW-FGPDQPE--IIVDSWGFWNWCNIFC 477

Query: 476 TILIYGGELFGT 487
           TIL+Y  EL G+
Sbjct: 478 TILVYATELVGS 489

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/503 (61%), Positives = 384/503 (76%), Gaps = 19/503 (3%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           M L+++ + R +RI S   YL+ TL+SIP+SFKIGG+ CGLSFTVTLF  Y +STTLS+L
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLK--------DGTEKIE 112
           AR+S +R Y+  TS++YY QHL+IA LL+ FLSGFSN+E +R L         D      
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 113 VLVANQDLMVSES----NWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIG 168
            L+ ++ LM + +    NW LY YY+ ++V+PW+++LSYSTPFF L EGFFTILAIQAIG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 169 ETNRWLSDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLT 228
           ETN+WLS E NSN+WII+SLL S GV+T SLYYLYRIYVTPIW+L+ Q+A+LLG VLS+ 
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 229 FGLGIHGIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLP 288
           F LG++GIIS +GSV+ESSLFFAYIVRCIYEISPKLAT AT+EIL+L K+VWQ HQ  L 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 289 ITDNILNYYRSVILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFT 348
             DN+L YY +V+LKN EM+WE+F+    +  N           FW+   P+WKFFKNFT
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNA-----MEKIRFWLDVTPVWKFFKNFT 355

Query: 349 ISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRR 408
           +SVP SI EL  +  +MASES+SPAV+VNLCFR+LIFYSATRIIP+LQR   ++ R+SRR
Sbjct: 356 VSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRR 415

Query: 409 IMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFW 468
           I+K+LYWYSPC+LIAMYTHLILQYSGELKREL LWG  S  ++   K++  IV DSWSFW
Sbjct: 416 ILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTS--NWFGSKDQPRIVTDSWSFW 473

Query: 469 NWCNIFWTILIYGGELFGTPTAD 491
           NWCNIFWT+L+Y  EL GT   +
Sbjct: 474 NWCNIFWTVLVYANELIGTQAPN 496

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/488 (62%), Positives = 380/488 (77%), Gaps = 5/488 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           MT +SKS ++G R+    FYLL TL++IP+SFK+GG++CGLSFTVTLF  Y ++TTLS++
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118
           A+  G++ YIV T+ IYY QH +IASLLY FLSGFSN+EL +VL+DG++  + LV     
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
           ++  + S+W+LY YYY YVV+PW+ VL++ST FFAL+EGFFT+L IQAIGETNRWL DE 
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN+WII+SLL S GV+TASLYYLYRIYVTPIW LS QTA+LLG  LS+  G+G+ GI+S
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
           + GSV+ESSLFFAYIVRCIYEISPKLATTATDEILE+ K  WQ+HQ  L  T+N+L+YY+
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 299 SVILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISEL 358
            V+LKN EM+WE+ + +TK     T  +       W  F P+WKFFK F +SVP SI  +
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360

Query: 359 SGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSP 418
             + L++ASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  R+ RKSRRIM VLYWYSP
Sbjct: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420

Query: 419 CILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTIL 478
           CILIAMYTHLILQYSGEL  +L LWG   K        +  I +++W FWNWCNIFWT+L
Sbjct: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEK---WFGSGQPKIEINTWVFWNWCNIFWTVL 477

Query: 479 IYGGELFG 486
           IYG EL G
Sbjct: 478 IYGSELIG 485

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 376/486 (77%), Gaps = 13/486 (2%)

Query: 8   IIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILARQSGSR 67
           +++ +R+    FYLL  LI+IP+SFK+GG++CGLSFTVTLF  YF+STTLS+  R   SR
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 68  FYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEK----IEVLVANQDLMVS 123
           FY+  T+ IYY QH IIASLLY FLSGFSN+EL ++L+ G++     +EVL +N     +
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNP--FSA 121

Query: 124 ESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNSW 183
            SNW+LY YYY Y+V+PW+++LS+ST FF+L+EGFFTILAIQA+GE++RWL  E NSN W
Sbjct: 122 HSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIW 181

Query: 184 IISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGSV 243
            I+SLL S GV+TA+LYYLYRIYVTP+WELS QTA+LLG  LSL  GLG++GI+S+ GSV
Sbjct: 182 NITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSV 241

Query: 244 VESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVILK 303
           +ESSLFFAYIVRCIYEISPKLATTATDEILE+FKE WQ+HQ     T+N+L+YY  V+L 
Sbjct: 242 IESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLD 301

Query: 304 NTEMIWEAFLSKTKQHSN---HTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360
           + EM+WE+ +SKT   S+   HT + F     F   F P+  FFKNFTISVP SI  L  
Sbjct: 302 SAEMMWESIVSKTVTTSDPFYHT-SMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQ 360

Query: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420
           + L+MAS+S+SPA+VVNL FRVLIFYSAT+IIP+LQ K  R   KSRRIM VLYWYSPCI
Sbjct: 361 VTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCI 420

Query: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480
           LIAMYTHLILQYSGEL R+L LWG +S    L    +  IVVDSW FWNWCNIFWTIL+Y
Sbjct: 421 LIAMYTHLILQYSGELNRDLCLWGCNSMWFSL---NQTKIVVDSWGFWNWCNIFWTILVY 477

Query: 481 GGELFG 486
           G EL G
Sbjct: 478 GSELIG 483

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/492 (58%), Positives = 369/492 (75%), Gaps = 17/492 (3%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           +L +S+I+ +R    TFYLL  LI+IP+SF++GG++CGLSFTVTLF  YFL+TTL I+++
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKI--EVLVANQDL 120
           +  +R Y  +TS +YY QH II SLL+ FLSGF+NDEL R + DG   +  E LV     
Sbjct: 61  KY-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQI-DGDVNLPRESLVNFLRN 118

Query: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180
              + +W+ Y YYY + VKPW+FVL +STP+F L EGFFT+L IQAIGETN+WL   KNS
Sbjct: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240
           N+WII SLL S GV+T SLYYLYRIYVTP+WELS QTA+LLG  LS+  GLG++GI+S +
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300
           GSV+ESSLFFAYIVRCIYEISP+LAT+A DEI ++ K+ WQ+HQG LP TDN+L+YYR+V
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNV 297

Query: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360
           +LKN EMIW+A + KT   S        T +  W+   PLWKF KNFTISVP SI E+  
Sbjct: 298 VLKNGEMIWDAIVQKTGTTSPS------TTQMVWLRLQPLWKFTKNFTISVPSSIREIFR 351

Query: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420
           + L+MA+ES++P VV+NL FR+L+FYSATRIIP+LQ+ +    + SRR+M+++YWYSPCI
Sbjct: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411

Query: 421 LIAMYTHLILQYSGELKRELYLWG--PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTIL 478
           +IAMYTHLILQYSGEL  +L LWG  P S      +   + +VVD+W FWNWCN+F T+ 
Sbjct: 412 VIAMYTHLILQYSGELNNDLCLWGCFPWSH----TNDPSSKVVVDAWGFWNWCNVFCTLA 467

Query: 479 IYGGELFGTPTA 490
           IYG EL G  ++
Sbjct: 468 IYGLELIGGKSS 479

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/491 (56%), Positives = 354/491 (72%), Gaps = 9/491 (1%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           M  + K++IR +++    FYLL  + +IP+SFKIGG++CGL+FTVTLF  YF STTL+I+
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQ 118
           AR+ GS+  I++TS  +Y Q+ II SLL+ FL+GF+N++L + ++ G +  E  +     
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 119 DLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178
           D+ VS  NWLL+ YYYSY VKPW+ +LSYSTP F L EGFFTIL IQ IGE N WL  E+
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238
           NSN WIISSLL S G++T SLYYLYRIY TPIW LS   ATLLG  LSL   LGI+GI+S
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298
             GSV+ESSLFFAYIVRCIYEI+P+LATTAT+E LE  KEVWQ H   L + D  ++Y+ 
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355
                     W  F S+T  +    N+ ++ + +      +F P+W+  K  T SVP SI
Sbjct: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNYCMD-YPSLVMIRSNFYPIWETLKTLTFSVPTSI 359

Query: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415
           SEL  + ++MA +S+SPA+++NLCFR++IFYSATRIIP++Q++   ++RK R IMK LYW
Sbjct: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419

Query: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475
           YSPCILIAMYTHLILQYSGELK++L LWG DS   F  D+E  N  VD+WSFWNWCNIFW
Sbjct: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTW-FGEDQERIN--VDAWSFWNWCNIFW 476

Query: 476 TILIYGGELFG 486
           TI+IYG EL G
Sbjct: 477 TIIIYGSELIG 487

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/493 (55%), Positives = 343/493 (69%), Gaps = 25/493 (5%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           +  +S+I+  R+   +FYLL  LI+IP+SF++GG++CGLSFTVTLF  Y ++TTL I AR
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDLMV 122
             G      L S  YY QH  I SLL+ FLSGFSNDEL R +   T   E L+       
Sbjct: 61  ARG---LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTT 117

Query: 123 SESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNS 182
               W+ Y YYY YVV+PW+F+L  STP+F L EGFFT+L IQA+GETNRWLS    SN 
Sbjct: 118 QSQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNM 177

Query: 183 WIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGS 242
           W+IS L+AS GV+TA+LYYLYRIYVTPIWELS QTA+LLG   S+  GLGI+GI+S RGS
Sbjct: 178 WVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGS 237

Query: 243 VVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVIL 302
            +ESSLFFAYIVRC+YEISP+LAT+A DEI  L KE W      L  +D +L YYR +IL
Sbjct: 238 TIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIIL 297

Query: 303 KNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGMM 362
           KN EM+W+A L++T  +   +    + +   W    PLWKF K+FT SVP SI E+  + 
Sbjct: 298 KNGEMVWDAILARTNVNVGASGTPVWAS---WNRVQPLWKFVKHFTSSVPSSIQEIFYLT 354

Query: 363 LQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILI 422
           L+MA E+I+PAVV+NLCFR+LIFYSATRIIP+LQ+K     R+SRR M++LYWYSPCI+I
Sbjct: 355 LEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKH---KRRSRRFMRMLYWYSPCIVI 411

Query: 423 AMYTHLILQYSGELKRELYLWG------PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWT 476
           AMYTHLILQYSG++  +L LWG      PD+            +VVDSW FWNWCNIF T
Sbjct: 412 AMYTHLILQYSGQISNDLCLWGCFPWSVPDTP----------KVVVDSWGFWNWCNIFCT 461

Query: 477 ILIYGGELFGTPT 489
           + IY  EL G+ +
Sbjct: 462 MAIYASELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  513 bits (1320), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 277/493 (56%), Positives = 349/493 (70%), Gaps = 23/493 (4%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           ++ +SI++ +R+   +FYLL  LI+IP++F++GG++CGLSFTVTLF  Y ++TTL I AR
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDLMV 122
             G   +  L S  YY QH  I SLL+ FLSGFSNDEL   +   T   E L+   DL+ 
Sbjct: 61  ARG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLI---DLLR 114

Query: 123 SESN---WLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKN 179
           S ++   W+ Y YYY YVV+PW+F+L  STP+F L EGFFT+L IQA+GETNRWLS    
Sbjct: 115 SSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHG 174

Query: 180 SNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISE 239
           SN W+IS L+ S GV+TA+LYYLYRIYVTPIWELS QTA+LLG   S+  GLGI GI+S 
Sbjct: 175 SNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSG 234

Query: 240 RGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRS 299
           RGS +ESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W      L  +D  L YYR 
Sbjct: 235 RGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRD 294

Query: 300 VILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELS 359
           +ILKN EMIW+A L++T  + +    +   A   W    PLWKF K+FT SVP SI E+ 
Sbjct: 295 IILKNGEMIWDAVLARTNVNVS---GAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIF 351

Query: 360 GMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPC 419
            + L MA E+I+PAVV+NLCFR+LIFYSATRIIP+LQRK     R+SRR M++LYWYSPC
Sbjct: 352 LLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKH---KRRSRRFMRMLYWYSPC 408

Query: 420 ILIAMYTHLILQYSGELKRELYLWG--PDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTI 477
           I+IAMYTHLI+QYSG++  +L LWG  P S        E + +VVDSW FWNWCNIF T+
Sbjct: 409 IVIAMYTHLIMQYSGQISNDLCLWGCFPWSP------PEGSKVVVDSWGFWNWCNIFCTM 462

Query: 478 LIYGGELFGTPTA 490
            IY  ELFG+ + 
Sbjct: 463 AIYASELFGSKSG 475

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  472 bits (1215), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 247/512 (48%), Positives = 338/512 (66%), Gaps = 38/512 (7%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           ++ K ++R LR    +FYL   LI++P+SF+IGG++CGLSFTVTLFI YF++TTL I A 
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEK------------ 110
             G  +  + ++L YY QH ++ S+L+ FLSGF+ND+L + L     K            
Sbjct: 61  TRGDEWKHIASTL-YYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119

Query: 111 ----IEVLVANQDLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQA 166
               +++L  ++D    +   + Y +YY YVV+PW+++L ++TP F L EGFFT+LAIQ 
Sbjct: 120 NESLLQLLGRSRD----DRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQV 175

Query: 167 IGETNRWLSDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLS 226
           IGET RWL  ++NS +W+ISSL+ S  V+T S+YYLYRIYVTPIW LS  TATLLG  LS
Sbjct: 176 IGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLS 235

Query: 227 LTFGLGIHGIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGK 286
           L FGLG++GIIS +GS +ESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  QG 
Sbjct: 236 LVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGT 295

Query: 287 LPITDNILNYYRSVILKNTEMIWEAFLSKTKQHSNHTLNS-----------FFTAENFWI 335
           LP  +++L YY++ IL N E +W+  L K     +  L+                + +W 
Sbjct: 296 LP-KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWN 353

Query: 336 HFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSL 395
               LW F KNF+  +P SI E+  + L +A ESI+ AVV NL FRV++FYSATRIIP+L
Sbjct: 354 KSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPAL 413

Query: 396 QRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDK 455
           QR       +SR++M+++YWYSPCI+IAMYTH+IL+YSGEL  EL +WG    L    + 
Sbjct: 414 QRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQ--SEA 469

Query: 456 EENNIVVDSWSFWNWCNIFWTILIYGGELFGT 487
             +  VVD+W FWNWCN+F+T+LIY  EL G+
Sbjct: 470 NRDRWVVDAWGFWNWCNLFFTLLIYAVELIGS 501

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  468 bits (1204), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 255/518 (49%), Positives = 345/518 (66%), Gaps = 39/518 (7%)

Query: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62
           +LS+ ++R +R     FYL   LI+IP+SF++GG++CGLSFTVTLFI YF +TTL I   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKD----GTEKIEVLVANQ 118
               +F + L SLIYY QH +I S+L+ FLS F++D+L R++       + K  +   N 
Sbjct: 61  NGSGKFKL-LASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNV 119

Query: 119 D---------LMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGE 169
           +            +E +   Y YYY Y+VKPW+++L ++TP+F L EGFFT+LAIQAIGE
Sbjct: 120 NESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 170 TNRWLSDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTF 229
           T RWL  +KNSN+W+I SLL S  V+T S++YLYRIYVTPIW LS QTATLLG  LSL F
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 230 GLGIHGIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPI 289
           GLG++GIIS +GS +ESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  QG L  
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS- 298

Query: 290 TDNILNYYRSVILKNTEMIWEAFLSKTKQHSNHTLNSFFT-------------------- 329
            +N+L YY + +  N E  W++ L KT   +       +T                    
Sbjct: 299 KNNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIIL 357

Query: 330 AENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSAT 389
              +W+    +W F KNF++ +P SI E+  + L+MA ESI+PAV+ NL FRVL+FYSAT
Sbjct: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417

Query: 390 RIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKL 449
           RIIP+LQ+     + +SR++M+++YWYSPCI+IAMYTHLIL+YSGEL  +L +WG    L
Sbjct: 418 RIIPALQKAT--GATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWL 475

Query: 450 SFLVDKEENNIVVDSWSFWNWCNIFWTILIYGGELFGT 487
           +F   K  +  VVD+WSFWNWCN+F+T+LIY  EL G+
Sbjct: 476 NF-SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  456 bits (1172), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 321/487 (65%), Gaps = 42/487 (8%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           M L+ KS+++ LRIF  T YL   LI+IP+SF++GG++CGLSFTVTLF  YF+STT  ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDL 120
               GS     L++LIYY QHL+I S+L+ FLS F N                   + D 
Sbjct: 100 LLDRGS----ALSTLIYYLQHLLIPSILFMFLSYFEN------------------IDSDT 137

Query: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180
           + SE     +  +++ +VKPW+  L +STP F L EG FTILAIQAIGET RWL   + S
Sbjct: 138 VDSE----YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRS 193

Query: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240
           N W+I SLL S G++T SL+Y YRIYVTP+WELS  +A+LLG   S+  G+G++G I+  
Sbjct: 194 NQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYG-INGS 252

Query: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300
           GSV+ESSLFFAY+VR +YEISPK+A  A DEI ++ KE W+ HQ  LP  DN+L     +
Sbjct: 253 GSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----EL 308

Query: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360
           + KN   IW   +  T +  NH        +  WI  NPLW   KNFT SVP SI E+  
Sbjct: 309 MTKNYRAIWSQIVEHTPR--NHKYIKMMD-QCKWI-LNPLWNSVKNFTKSVPISIQEIFV 364

Query: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420
           +  +MA ES+ PAVV+NL FR+LIFYSATRIIP+LQR   ++ R  RRIM  +YWYSPCI
Sbjct: 365 VTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCI 423

Query: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480
           +IAMYTHLIL+YSG+LK +L +WG          + E  IVVDSWSFWNWCNI+ T+LIY
Sbjct: 424 IIAMYTHLILRYSGQLKNDLCIWG------CFPYETEPKIVVDSWSFWNWCNIYSTMLIY 477

Query: 481 GGELFGT 487
             EL G+
Sbjct: 478 ALELMGS 484

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  459 bits (1180), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 252/537 (46%), Positives = 344/537 (64%), Gaps = 61/537 (11%)

Query: 2   TLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILA 61
            L+ + +I         FYLL  +++IP+SFKIGG++CGLSFT TLF  YF+ST+++I+ 
Sbjct: 49  NLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIIT 108

Query: 62  RQ-SGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVL----------KDGTE- 109
           ++ + +    +L S ++Y Q+ II+SLL  +L GF+N +L   L          K+GT  
Sbjct: 109 KRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNT 168

Query: 110 KIEVLVANQDLMV-----------------------SESN----------WLLYCYYYSY 136
           K ++L   +D  V                       SE N          W+L+ YYY  
Sbjct: 169 KYQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYI 228

Query: 137 VVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNSWIISSLLASSGVVT 196
            +KPWKF+L  STPFF L EGFFTIL IQ IGETN WL  +K+S+ W+I SLL+S GV+T
Sbjct: 229 FIKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVIT 288

Query: 197 ASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGSVVESSLFFAYIVRC 256
           A+LYYL RIYVTP W+L+  TA++LG  LS+  GLG+ GI+S+ GS +ESSLFFAYIVRC
Sbjct: 289 ATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRC 348

Query: 257 IYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVILKNTEMIWEAF--LS 314
           IYE+SP+LA +ATDE LE F EVWQ +Q ++ + DN+L Y +  I+       +AF   S
Sbjct: 349 IYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-------DAFSSFS 401

Query: 315 KTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAV 374
             + H          ++N  +     W F KNFTI+VP SI++L  +  QMA +SISPA+
Sbjct: 402 SIEHHLFPKTIELGISKNLIVK--QFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAI 459

Query: 375 VVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSG 434
           ++NL FR++IFYSATRIIP++QR+   D+      M  +YW+SPC+LIAMYTHLILQ+SG
Sbjct: 460 IINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSG 519

Query: 435 ELKRELYLWGPDSKLSFLVDKE-----ENNIVVDSWSFWNWCNIFWTILIYGGELFG 486
           ELK+ + LW  ++ LS   D +     +N+I+VDSWSFWNWCNIFWTI+IY  EL G
Sbjct: 520 ELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  451 bits (1161), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 249/499 (49%), Positives = 333/499 (66%), Gaps = 22/499 (4%)

Query: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60
           M+ + K++    R F    YLL  L+++P++F++GG+ CGL+FT+TLF +YF++TTL+ +
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKD---GTEKIEVLVAN 117
           AR+   + +I  T+ +YY Q+  I  +L+ FLS FS+ EL   + D     E I  ++ N
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 118 QDLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDE 177
            D   S++   +Y Y++ Y +  WKF LSYSTP FAL EGFFTILAIQ IGETN WL+  
Sbjct: 121 NDTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTV 180

Query: 178 KNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGII 237
           KNS+ WII SL+ SS +VT S+YY+Y+IYVTP+W LS Q A+LL    SL  G+ I+GI+
Sbjct: 181 KNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIV 240

Query: 238 SERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYY 297
           S RGSVVESSLFFAYIV CIYEISP +ATTA D+I +  KE WQ HQ    I+DN+L YY
Sbjct: 241 SHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYY 300

Query: 298 RSVILKNTEMIWEAFLSK--TKQHSNHTLNS--FFTAENFWIHFNPLWKFFKNFTISVPF 353
            + ++KN +   +  + K  TK + ++  NS  F   +     F  + K  K FT+ +P 
Sbjct: 301 YNSLIKNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPS 360

Query: 354 SISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVR------DSRKSR 407
           SI EL  + L+MASESISP ++VNLC+RVLIFY+ATRIIP+L+ +          ++ + 
Sbjct: 361 SIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNS 420

Query: 408 RIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSF 467
           + MKVLYWYSPCILIAMYT+LILQYSGELK E  LW   +            +VVDSW F
Sbjct: 421 KFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLWNNSNNNE---------VVVDSWRF 471

Query: 468 WNWCNIFWTILIYGGELFG 486
           WNWCNIFWTI +YG EL G
Sbjct: 472 WNWCNIFWTITLYGSELIG 490

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  441 bits (1135), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 242/530 (45%), Positives = 352/530 (66%), Gaps = 49/530 (9%)

Query: 6   KSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILARQSG 65
           KS+ + +R+  G FYL+  LI+IP +FKIGG++CGLSFT+TLF  YFLSTT+ ++A+++ 
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65

Query: 66  SRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDG-TEKIEVL---VANQDLM 121
           + FYI+L++L+YY QH++IASLLY F++ FS+  L+ +L +  T+++  L   + N    
Sbjct: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125

Query: 122 VSESNW--LLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKN 179
               N+  LL+ YYY Y V+PW ++LS+STPFF L EGFFTIL IQAIGET  WL  +K 
Sbjct: 126 SVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQ 185

Query: 180 SNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISE 239
              + + + L S GV+  ++++LY+IY   +WELS QTA+LLG  +SL   +GI GI S 
Sbjct: 186 KKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245

Query: 240 RGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRS 299
            GS++ESSLF  YI+RC YEISP+L+T+AT EIL+  KE WQ HQG + +T++IL YY +
Sbjct: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305

Query: 300 VILK--NTEMIWEAFLSKTKQHS--------------NHTLNSFFTA------------- 330
           V+LK  N+  ++ +  SK+   S              N+TL                   
Sbjct: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365

Query: 331 ENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATR 390
           +N+ I+  P+++  K+F +++P S++ LS +  ++A +S+SP++V+NLCFRVLIFYSATR
Sbjct: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425

Query: 391 IIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPD---- 446
           IIP++QRK   ++++SR  +K  Y +SPCI+IAMYT+LILQYSGELK +L +WG D    
Sbjct: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485

Query: 447 ------SKLSFLVDKEEN----NIVVDSWSFWNWCNIFWTILIYGGELFG 486
                 S ++  V  ++       +V+SW FWNWCNIF TI IYG EL G
Sbjct: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TDEL0E01740 Chr5 complement(335052..336323) [1272 bp, 423 aa] {ON}
           Anc_4.199 YLR360W
          Length = 423

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 122 VSESNWLLYCYYYSYV-----VKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSD 176
           V+E++WL    Y   +     V P   + SY+ P F + +GF+T+  + A    + + S 
Sbjct: 97  VNENSWLALRVYEVDLNKLQSVNPNDLIDSYNAPLFEMTDGFYTLPGLPAARIVSDFSSH 156

Query: 177 EKN-SNSWIISSLLASSGVVTASL 199
           ++N SNS  + S   +S +    L
Sbjct: 157 KRNVSNSRFVQSFSFNSALKVNKL 180

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 335 IHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVL 383
           + F   W FF N+T+ +P  I  ++ M +   +E+I+P++VV LC+ ++
Sbjct: 119 VGFTISWLFFLNWTVVLPLEIC-VASMTINFWNENINPSIVVALCYSLV 166

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 10/108 (9%)

Query: 100  LHRVLKDGTEKIEVLVANQDLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFF 159
            + + L+D T K++ L +N D +    N +      SY++   K  LS+  P        +
Sbjct: 1393 IEKELEDVTNKMDKLKSNDDALTIRINKVTNEVKASYLIDEQKLELSFKLP------SNY 1446

Query: 160  TILAIQAIGETNRWLSDEKNSNSWIISS---LLASSGVVTASLYYLYR 204
             +  +Q IG +   +S++K    WI+S+   +   +G V  S+  L R
Sbjct: 1447 PLTNVQVIGVSRVGISEQK-WKQWIMSAQRVITGMNGTVMDSMELLTR 1493

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
           Anc_4.344 YML076C
          Length = 945

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 295 NYYRSVILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTI-SVPF 353
           N  +S+ L N   + ++ LSK +Q++NH  N+ +   N +    P+  F+ N  I S P 
Sbjct: 230 NITKSISLDNIHSM-DSRLSKNQQYNNHNTNTAYNINNNYKSRLPIPNFYSNGNIYSTPA 288

Query: 354 SISE 357
           S S+
Sbjct: 289 SCSK 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,912,785
Number of extensions: 2157987
Number of successful extensions: 8617
Number of sequences better than 10.0: 51
Number of HSP's gapped: 8764
Number of HSP's successfully gapped: 52
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)