Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J012602.306ON36536514960.0
AGR390C2.306ON3783289881e-132
NDAI0B034402.306ON4991857063e-88
NCAS0B061402.306ON4431856849e-86
KNAG0A054402.306ON4421986743e-84
TBLA0B071702.306ON4701856633e-82
TDEL0G023602.306ON4021916556e-82
CAGL0H10604g2.306ON4161846541e-81
ZYRO0A02398g2.306ON4101986471e-80
Kpol_1043.342.306ON4421856422e-79
Smik_14.3132.306ON4511856396e-79
Skud_14.3122.306ON4591856362e-78
Suva_14.3302.306ON4571846362e-78
YNL016W (PUB1)2.306ON4531846353e-78
TPHA0C035202.306ON4421856213e-76
SAKL0E07128g2.306ON4012086155e-76
KLTH0G10912g2.306ON4361976125e-75
KLLA0E08779g2.306ON4751866077e-74
Kwal_27.114472.306ON4391846048e-74
Ecym_33442.306ON4211846011e-73
Ecym_80105.382ON6023172661e-24
TDEL0E024505.382ON4723322641e-24
ADR307W5.382ON5663132606e-24
SAKL0G08118g5.382ON5453072447e-22
Kwal_55.201545.382ON5223382438e-22
Skud_8.1475.382ON5133392322e-20
KLTH0E03520g5.382ON5163072287e-20
Smik_8.1645.382ON5243412233e-19
KNAG0B044405.382ON3973182126e-18
CAGL0L11792g8.229ON5793112138e-18
KNAG0G018108.229ON5961932102e-17
Suva_15.2805.382ON5413442102e-17
ZYRO0A07018g5.382ON5583152092e-17
YHR086W (NAM8)5.382ON5233392092e-17
NDAI0C018205.382ON4983292022e-16
CAGL0H02123g5.382ON5551912003e-16
ZYRO0B11660g8.229ON5873081987e-16
TPHA0B034208.229ON5793131961e-15
TDEL0A013508.229ON5881841952e-15
TBLA0F037808.229ON5771931923e-15
Kpol_530.466.104ON5872901914e-15
KAFR0D048305.382ON4061651888e-15
Kpol_1032.498.229ON5803071899e-15
NDAI0C061008.229ON5853141881e-14
YER165W (PAB1)8.229ON5773131871e-14
TBLA0H017905.382ON6742051881e-14
NDAI0D028404.61ON4261781862e-14
NCAS0H018105.382ON4431711852e-14
Smik_5.3378.229ON5773141826e-14
Skud_5.3048.229ON5773221819e-14
KLLA0F14861g5.382ON5891781819e-14
SAKL0H17952g8.229ON5893381791e-13
Ecym_62014.61ON4481841763e-13
NCAS0A036808.229ON5751611763e-13
Ecym_55628.229ON5801741764e-13
NCAS0A058904.61ON4151791745e-13
YGR159C (NSR1)4.61ON4141781745e-13
CAGL0E03245g4.61ON4251981737e-13
TPHA0H015205.382ON4942061737e-13
Suva_5.2998.229ON5773231738e-13
KAFR0F031204.61ON4121791729e-13
Skud_7.4834.61ON3931801719e-13
KNAG0D032204.61ON399781711e-12
KAFR0G023206.104ON6202751711e-12
Smik_6.2644.61ON395911701e-12
KAFR0B025008.229ON5821811712e-12
Kpol_224.18.797ON2171891623e-12
TBLA0C043604.61ON403781673e-12
KLLA0C11495g4.61ON445781674e-12
Suva_7.4504.61ON3911811647e-12
AGR122C8.229ON5853131641e-11
TPHA0K019104.61ON416781612e-11
TDEL0F029104.61ON4361801612e-11
KLLA0C17600g8.229ON5921671622e-11
Kwal_56.234868.229ON5871671613e-11
ZYRO0G07326g4.61ON468781603e-11
Skud_2.3456.104ON6641441613e-11
Kpol_1026.214.61ON437851594e-11
AFR107W4.61ON3961801576e-11
Suva_4.4706.104ON6631441586e-11
YBR212W (NGR1)6.104ON6721441587e-11
Skud_6.1071.357ON611721587e-11
Smik_2.3556.104ON7361441587e-11
ZYRO0C05060g6.104ON7161441578e-11
KLTH0G14344g8.229ON5871611561e-10
KLTH0D03916g4.61ON505781551e-10
SAKL0H23562g4.61ON4211811541e-10
Suva_6.951.357ON613721552e-10
TDEL0G036706.104ON6171441542e-10
Kwal_26.7493singletonOFF2221381473e-10
Ecym_13021.408ON2882891468e-10
TBLA0A099206.104ON5941461499e-10
SAKL0A07370g6.104ON4901441471e-09
NCAS0B072401.357ON610721472e-09
Ecym_30826.104ON5861441472e-09
KAFR0H031101.408ON4412201462e-09
AAR151W6.104ON4811441452e-09
CAGL0K06655g6.104ON8021441419e-09
KLLA0C05522g6.104ON5401451382e-08
NDAI0B045701.357ON4641091382e-08
SAKL0D08558g1.408ON4641781372e-08
TBLA0D049401.357ON665551382e-08
SAKL0B06270g8.797ON2091731323e-08
Kwal_14.18516.104ON5351441355e-08
KLTH0E14036g8.797ON2091811296e-08
AAL018W1.408ON3373281318e-08
YFR023W (PES4)1.357ON611721302e-07
NCAS0G042801.408ON4352311292e-07
KAFR0A074902.80ON3811351292e-07
Smik_7.3341.357ON611721293e-07
ZYRO0G00814g1.357ON654871274e-07
KLTH0H06842g6.104ON5471031274e-07
Ecym_27461.357ON681721274e-07
AEL016C1.357ON678721275e-07
KLLA0C14388g8.797ON2031701225e-07
CAGL0M03795g3.49ON5131701266e-07
Kwal_0.3701.357ON560721257e-07
TDEL0H032407.159ON1671151198e-07
KAFR0C044101.357ON589721241e-06
SAKL0D09680g1.357ON672721231e-06
KNAG0L005707.93ON4311041222e-06
KLLA0C08019g7.250ON301881202e-06
ZYRO0E04928g1.408ON4092191202e-06
KLLA0A08338g1.357ON766721212e-06
Kwal_55.219603.49ON5971731203e-06
TBLA0C023003.432ON868831203e-06
NCAS0C046003.49ON5811701194e-06
Kwal_27.118328.491ON686791194e-06
KLTH0F18766g3.49ON5881731194e-06
NCAS0C048301.408ON3771971184e-06
TBLA0A033005.382ON362791185e-06
TBLA0B085903.49ON6231721185e-06
KNAG0A013703.49ON5451731186e-06
Ecym_44463.432ON8551171186e-06
TPHA0A022201.357ON713761186e-06
NCAS0G019502.80ON4041351177e-06
CAGL0E01947g3.49ON4521701167e-06
Kpol_1041.42.80ON3841351167e-06
Kwal_27.123378.797ON2091741138e-06
TBLA0B008102.80ON3891151169e-06
NCAS0A100103.49ON5061691169e-06
AGL250W8.491ON729911161e-05
Kpol_1008.231.357ON660721161e-05
CAGL0J11154g2.80ON3801351151e-05
KLLA0D05016g1.408ON4431751151e-05
TBLA0A078103.49ON4721701141e-05
KAFR0H014508.491ON6902121151e-05
KAFR0C016803.49ON4791701141e-05
TDEL0D022501.357ON6221071151e-05
Kwal_0.250singletonOFF2161311112e-05
Suva_3.81.408ON4333141142e-05
CAGL0I08943g1.357ON6021101142e-05
Kwal_YGOB_0.2501.408ON2261311112e-05
SAKL0C12672g3.49ON5511701142e-05
KLTH0H12958g1.357ON639731142e-05
Suva_16.2718.491ON686911142e-05
ABL134C2.80ON3751371132e-05
Kwal_33.144632.80ON3931371122e-05
Kpol_1076.113.49ON5262011132e-05
Smik_16.1928.491ON6901001132e-05
TPHA0B043001.102ON3341191112e-05
TPHA0F028206.104ON6081441123e-05
ZYRO0C02574g3.49ON5431411123e-05
CAGL0B04807g1.408ON4193241113e-05
KLTH0B06886g2.80ON3961371113e-05
YCL011C (GBP2)1.408ON4273161113e-05
Ecym_20503.49ON5411711123e-05
KNAG0A076103.432ON867891123e-05
Suva_16.4403.432ON8861111123e-05
TPHA0D039603.432ON872921123e-05
NCAS0C023808.491ON702791123e-05
KLTH0C04268g8.822ON4501901114e-05
KNAG0C020301.357ON365801104e-05
ZYRO0G04862g2.80ON3761351104e-05
KAFR0B044205.76ON6251951114e-05
Smik_3.711.408ON4283161104e-05
TBLA0D048501.408ON4292181104e-05
Smik_16.3553.432ON8861281114e-05
Ecym_64162.80ON3901351095e-05
TBLA0A015708.491ON742981105e-05
NDAI0G041901.408ON3593131096e-05
YPL043W (NOP4)8.491ON685791106e-05
NCAS0I005207.93ON4481291096e-05
Skud_16.2388.491ON680791096e-05
TDEL0E006003.49ON5471701097e-05
NDAI0A047503.432ON8431291098e-05
TDEL0B014608.491ON692921098e-05
TDEL0F006802.80ON3881351088e-05
KAFR0L009707.250ON285791078e-05
ADR035C3.432ON838951099e-05
KNAG0A022108.491ON682791089e-05
Skud_8.671.357ON652731089e-05
TPHA0P013103.49ON5181701089e-05
YIR001C (SGN1)7.145ON250751051e-04
Kpol_1018.1221.357ON634751081e-04
KLTH0E11418g8.491ON693791081e-04
KNAG0G032608.797ON2011681041e-04
NDAI0G039703.49ON6071701071e-04
Kpol_1002.696.183ON590791071e-04
Skud_16.3993.432ON8791321071e-04
TPHA0F023102.80ON400781061e-04
Kpol_487.61.408ON3761811061e-04
Skud_15.4878.797ON2131801032e-04
Ecym_11211.102ON324751052e-04
KLLA0C12925g3.49ON5701741062e-04
Skud_3.481.408ON4291701062e-04
ABL059W8.797ON2041681022e-04
Ecym_25418.491ON675791062e-04
Skud_9.1787.145ON250751032e-04
ADR189W5.536ON269851032e-04
Kpol_1075.1a8.229ON264801032e-04
TDEL0B060601.408ON345751042e-04
CAGL0B04169g3.432ON861861053e-04
NDAI0E004708.797ON2581791023e-04
Suva_14.1662.80ON403781043e-04
Ecym_43247.250ON331941033e-04
Suva_9.2107.145ON250751023e-04
Smik_9.2007.145ON249751023e-04
TDEL0F028504.66ON279821023e-04
YNL175C (NOP13)2.80ON403781033e-04
YHR015W (MIP6)1.357ON659721033e-04
TDEL0B010108.797ON2101721003e-04
Skud_14.1592.80ON400781033e-04
ADL160W3.49ON5261711034e-04
YPR112C (MRD1)3.432ON887861034e-04
TPHA0J022106.183ON593801034e-04
NDAI0A061703.49ON5521421034e-04
Suva_15.1981.357ON662721034e-04
Smik_14.1552.80ON403781024e-04
SAKL0A05280g6.183ON582801034e-04
NCAS0B009508.797ON2191801004e-04
KAFR0A055103.432ON8501291034e-04
ZYRO0F08294g8.491ON714781025e-04
NDAI0E030708.491ON701791025e-04
NDAI0F033202.80ON399781015e-04
SAKL0E12738g2.80ON3961351015e-04
CAGL0L12672g8.491ON682791025e-04
ZYRO0G07216g4.66ON271811005e-04
KAFR0C054305.536ON274861005e-04
TDEL0H019407.250ON3181111015e-04
ADL063W7.250ON3201071015e-04
KLTH0A04554g7.250ON2781091006e-04
KLLA0D11792g8.491ON685791026e-04
TPHA0C017408.491ON697791026e-04
Kwal_23.39853.432ON876831026e-04
Ecym_22336.183ON576801016e-04
TBLA0B080105.76ON939821026e-04
SAKL0F08866g7.250ON302921006e-04
NDAI0F022606.183ON680801016e-04
Kpol_1023.955.536ON27488997e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J01260
         (365 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   580   0.0  
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   385   e-132
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   276   3e-88
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   268   9e-86
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   264   3e-84
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   259   3e-82
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   256   6e-82
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   256   1e-81
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   253   1e-80
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   251   2e-79
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   250   6e-79
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   249   2e-78
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   249   2e-78
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   249   3e-78
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   243   3e-76
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   241   5e-76
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   240   5e-75
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   238   7e-74
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   237   8e-74
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   236   1e-73
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...   107   1e-24
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...   106   1e-24
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...   104   6e-24
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    99   7e-22
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    98   8e-22
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    94   2e-20
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    92   7e-20
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    91   3e-19
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    86   6e-18
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    87   8e-18
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    86   2e-17
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    86   2e-17
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    85   2e-17
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    85   2e-17
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    82   2e-16
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    82   3e-16
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    81   7e-16
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    80   1e-15
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    80   2e-15
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    79   3e-15
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    78   4e-15
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    77   8e-15
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    77   9e-15
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             77   1e-14
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    77   1e-14
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    77   1e-14
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    76   2e-14
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     76   2e-14
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    75   6e-14
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    74   9e-14
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    74   9e-14
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    74   1e-13
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    72   3e-13
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    72   3e-13
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    72   4e-13
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             72   5e-13
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    72   5e-13
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    71   7e-13
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    71   7e-13
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    71   8e-13
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    71   9e-13
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    70   9e-13
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    70   1e-12
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    70   1e-12
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    70   1e-12
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    70   2e-12
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    67   3e-12
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    69   3e-12
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    69   4e-12
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    68   7e-12
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    68   1e-11
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    67   2e-11
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    67   2e-11
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    67   2e-11
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    67   3e-11
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    66   3e-11
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    67   3e-11
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    66   4e-11
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    65   6e-11
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    65   6e-11
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    65   7e-11
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    65   7e-11
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    65   7e-11
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    65   8e-11
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    65   1e-10
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    64   1e-10
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    64   1e-10
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    64   2e-10
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    64   2e-10
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    61   3e-10
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    61   8e-10
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    62   9e-10
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    61   1e-09
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    61   2e-09
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    61   2e-09
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    61   2e-09
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    60   2e-09
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    59   9e-09
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    58   2e-08
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    58   2e-08
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    57   2e-08
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    58   2e-08
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    55   3e-08
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    57   5e-08
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    54   6e-08
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    55   8e-08
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    55   2e-07
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     54   2e-07
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    54   2e-07
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    54   3e-07
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    54   4e-07
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    54   4e-07
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    54   4e-07
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    54   5e-07
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    52   5e-07
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    53   6e-07
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    53   7e-07
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    50   8e-07
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    52   1e-06
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    52   1e-06
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    52   2e-06
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    51   2e-06
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    51   2e-06
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    51   2e-06
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    51   3e-06
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    51   3e-06
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      50   4e-06
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    50   4e-06
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    50   4e-06
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     50   4e-06
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    50   5e-06
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    50   5e-06
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    50   6e-06
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    50   6e-06
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    50   6e-06
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    50   7e-06
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    49   7e-06
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    49   7e-06
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    48   8e-06
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    49   9e-06
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    49   9e-06
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    49   1e-05
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    49   1e-05
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    49   1e-05
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    49   1e-05
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    49   1e-05
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    49   1e-05
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    49   1e-05
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    49   1e-05
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    47   2e-05
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    49   2e-05
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    49   2e-05
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    47   2e-05
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    49   2e-05
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    49   2e-05
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    49   2e-05
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    48   2e-05
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    48   2e-05
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    48   2e-05
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    48   2e-05
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    47   2e-05
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    48   3e-05
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    48   3e-05
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    47   3e-05
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    47   3e-05
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    47   3e-05
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    48   3e-05
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    48   3e-05
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    48   3e-05
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    48   3e-05
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    48   3e-05
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    47   4e-05
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    47   4e-05
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    47   4e-05
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    47   4e-05
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    47   4e-05
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    47   4e-05
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    47   4e-05
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    47   5e-05
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    47   5e-05
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    47   6e-05
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    47   6e-05
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    47   6e-05
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    47   6e-05
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    47   7e-05
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    47   8e-05
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    47   8e-05
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    46   8e-05
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    46   8e-05
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    47   9e-05
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    46   9e-05
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    46   9e-05
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    46   9e-05
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    45   1e-04
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    46   1e-04
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    46   1e-04
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    45   1e-04
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    46   1e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    46   1e-04
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    46   1e-04
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    45   1e-04
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    45   1e-04
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    44   2e-04
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    45   2e-04
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    45   2e-04
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    45   2e-04
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    44   2e-04
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    45   2e-04
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    44   2e-04
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    44   2e-04
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    44   2e-04
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    45   2e-04
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    45   3e-04
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    44   3e-04
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    45   3e-04
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    44   3e-04
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    44   3e-04
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    44   3e-04
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    44   3e-04
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    44   3e-04
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    44   3e-04
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    43   3e-04
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    44   3e-04
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    44   4e-04
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    44   4e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    44   4e-04
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    44   4e-04
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    44   4e-04
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    44   4e-04
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    44   4e-04
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      43   4e-04
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    44   4e-04
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    44   5e-04
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    44   5e-04
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      44   5e-04
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    44   5e-04
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    44   5e-04
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    43   5e-04
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    43   5e-04
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    44   5e-04
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    44   5e-04
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    43   6e-04
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    44   6e-04
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    44   6e-04
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    44   6e-04
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    44   6e-04
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    44   6e-04
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    43   6e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     44   6e-04
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    43   7e-04
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    44   8e-04
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    42   8e-04
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    42   8e-04
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    43   9e-04
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       43   9e-04
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    43   0.001
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    42   0.001
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    43   0.001
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    42   0.001
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    43   0.001
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    42   0.001
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    42   0.001
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    42   0.001
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    43   0.001
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    41   0.001
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    42   0.001
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    42   0.002
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    42   0.002
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    42   0.002
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    42   0.002
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    42   0.002
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    42   0.002
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    41   0.002
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    42   0.002
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    40   0.002
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    41   0.002
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    41   0.002
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    41   0.002
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    40   0.003
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    41   0.003
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    41   0.003
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    42   0.003
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    41   0.003
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    41   0.003
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    40   0.003
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    41   0.003
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    41   0.003
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    41   0.003
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    41   0.003
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    40   0.003
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    40   0.003
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    41   0.003
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    41   0.003
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    40   0.004
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    41   0.004
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    41   0.004
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    41   0.004
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    41   0.004
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    40   0.004
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    40   0.004
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    39   0.004
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    41   0.004
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    39   0.005
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    41   0.005
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    40   0.005
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    40   0.005
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    39   0.005
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    40   0.005
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    40   0.005
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    40   0.005
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    40   0.006
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    40   0.006
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    39   0.006
CAGL0D01166g Chr4 complement(134536..135441) [906 bp, 301 aa] {O...    40   0.006
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    40   0.006
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    40   0.007
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    40   0.007
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    39   0.007
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    39   0.007
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    38   0.007
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    39   0.007
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    39   0.007
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    40   0.007
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    40   0.007
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    40   0.008
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    39   0.008
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    40   0.008
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    39   0.009
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    40   0.009
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    40   0.009
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    39   0.009
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    40   0.009
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    40   0.010
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    40   0.010
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    40   0.010
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    39   0.011
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    40   0.011
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    40   0.011
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    39   0.011
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    39   0.013
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    39   0.013
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    39   0.014
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    37   0.014
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    39   0.014
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    38   0.014
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    39   0.015
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    37   0.016
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    39   0.016
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    38   0.016
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    39   0.016
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    39   0.016
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    38   0.019
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    38   0.019
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    37   0.022
TPHA0C04450 Chr3 complement(964539..965540) [1002 bp, 333 aa] {O...    38   0.022
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    39   0.023
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    38   0.023
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    39   0.025
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    38   0.026
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    38   0.028
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    39   0.028
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    37   0.029
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    38   0.030
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    38   0.031
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    38   0.031
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    38   0.033
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    38   0.035
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    38   0.036
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    38   0.036
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    38   0.036
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    37   0.037
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    38   0.038
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    38   0.038
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    38   0.038
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    38   0.042
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    37   0.043
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    38   0.045
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    38   0.045
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    37   0.048
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    36   0.048
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    37   0.049
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    37   0.050
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    37   0.050
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    37   0.053
SAKL0B09702g Chr2 (819107..820528) [1422 bp, 473 aa] {ON} simila...    37   0.054
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    37   0.055
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    37   0.056
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    37   0.071
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    37   0.072
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    36   0.075
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    37   0.077
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    37   0.078
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    37   0.079
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    37   0.084
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    37   0.084
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    36   0.089
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    37   0.10 
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    37   0.11 
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    36   0.13 
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    36   0.13 
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    35   0.14 
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    36   0.14 
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    35   0.14 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    36   0.15 
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    36   0.15 
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    35   0.16 
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    36   0.16 
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    35   0.16 
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    35   0.16 
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    35   0.18 
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    35   0.18 
KAFR0G02950 Chr7 complement(614874..615782) [909 bp, 302 aa] {ON...    35   0.19 
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    35   0.19 
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    35   0.20 
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    36   0.20 
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    36   0.20 
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    35   0.22 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    35   0.23 
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    35   0.24 
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    34   0.25 
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    34   0.26 
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    35   0.26 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    34   0.28 
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    34   0.28 
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    35   0.29 
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    35   0.29 
TBLA0E01200 Chr5 complement(265315..266220) [906 bp, 301 aa] {ON...    35   0.31 
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    35   0.32 
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    35   0.34 
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    34   0.34 
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    34   0.36 
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    34   0.37 
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    34   0.39 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    34   0.40 
Kpol_1030.41 s1030 complement(91357..93168) [1812 bp, 603 aa] {O...    35   0.41 
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    34   0.43 
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    34   0.46 
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    33   0.48 
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    34   0.48 
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    34   0.49 
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    34   0.49 
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    34   0.50 
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    34   0.57 
CAGL0A04213g Chr1 (416929..418848) [1920 bp, 639 aa] {ON} simila...    34   0.59 
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    33   0.61 
Smik_12.12 Chr12 complement(31593..32339) [747 bp, 248 aa] {ON} ...    33   0.64 
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    34   0.67 
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    33   0.70 
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    33   0.73 
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    33   0.81 
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    33   0.90 
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    33   0.91 
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    33   0.95 
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    33   1.0  
NCAS0D03580 Chr4 complement(665299..666036) [738 bp, 245 aa] {ON...    33   1.1  
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    33   1.1  
Kpol_1063.18 s1063 (40779..41780) [1002 bp, 333 aa] {ON} (40779....    33   1.1  
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    33   1.1  
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    33   1.2  
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    33   1.3  
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    32   1.3  
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    32   1.4  
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    32   1.5  
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    33   1.6  
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    32   1.7  
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    33   1.8  
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    32   2.0  
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    32   2.0  
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    32   2.0  
Kpol_311.2 s311 (3859..4536) [678 bp, 225 aa] {ON} (3859..4536) ...    32   2.2  
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    32   2.2  
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    32   2.2  
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    32   2.4  
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    32   2.6  
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      32   2.6  
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    32   2.9  
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    31   3.0  
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    31   3.1  
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    32   3.4  
Kpol_499.24 s499 complement(66661..67020) [360 bp, 119 aa] {ON} ...    30   3.4  
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    31   3.6  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   3.7  
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    32   4.0  
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    31   4.1  
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    32   4.2  
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    31   4.6  
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    30   5.2  
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    31   5.6  
Smik_6.375 Chr6 complement(611206..611835) [630 bp, 209 aa] {ON}...    30   5.7  
KNAG0L01180 Chr12 complement(212187..213341) [1155 bp, 384 aa] {...    31   6.1  
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    30   6.4  
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    29   6.7  
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    30   6.7  
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    31   6.9  
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    29   7.7  
Suva_16.131 Chr16 (221470..222099) [630 bp, 209 aa] {ON} YPL178W...    30   8.4  

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/365 (79%), Positives = 289/365 (79%)

Query: 1   MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXX 60
           MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQI   
Sbjct: 1   MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDV 60

Query: 61  XXXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN 120
                       YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN
Sbjct: 61  KVMVDKKNNHVNYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN 120

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM
Sbjct: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180

Query: 181 QGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXX 240
           QGHEINGRAIRINWATKRE                 QVRNR                   
Sbjct: 181 QGHEINGRAIRINWATKRENMNNNSNNNTNNNNNNNQVRNRMMMEGQQNMPPPPPPMGSL 240

Query: 241 XXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFI 300
                QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFI
Sbjct: 241 PPVNPQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFI 300

Query: 301 KYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERSTFIXXXXXXXXXXXTSEGEXXXXXXX 360
           KYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERSTFI           TSEGE       
Sbjct: 301 KYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERSTFIPPQGMMPPPMMTSEGEQQQQQQQ 360

Query: 361 XXPSE 365
             PSE
Sbjct: 361 LQPSE 365

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/328 (58%), Positives = 217/328 (66%), Gaps = 9/328 (2%)

Query: 18  PASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIE 77
           P  A +GGRETSD++LY+GNLDK+INE  LKQYFQV G I               YAF+E
Sbjct: 22  PVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVE 81

Query: 78  YSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLAN 137
           Y    DANVA QTL+G QIEN  IKINWAFQSQ   +DDT FNLF+GDLNV+VDD TL++
Sbjct: 82  YRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDT-FNLFVGDLNVDVDDETLSS 140

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            FK  P F+QAHVMWDMQ+ RSRGYGFVSF   E AQ AMD  QG  +NGRAIR+NWA K
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 198 REXXXXXXXXX--------XXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVE 249
           RE                           +                          QAVE
Sbjct: 201 RESQHAARPRSNRGGFRGGSGHQPFRGMPQGPHLGGAAPAGPMQLQGPPVPSPVNPQAVE 260

Query: 250 DMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAA 309
            MIRRAP RVTTAYIGNIPHFA EPDLIPLLQNFGFI+DF HY EKGCCFIKYDTH+QAA
Sbjct: 261 AMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAA 320

Query: 310 VCIVALSNFQFQGRNLRTGWGKERSTFI 337
           +CIVAL+NF FQGR LRTGWGKE+ +F+
Sbjct: 321 LCIVALANFPFQGRTLRTGWGKEKPSFV 348

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  276 bits (706), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 148/185 (80%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           NV+PASA  GGRETSD+VLY+GNLDKSINED LKQYFQV GQI               YA
Sbjct: 71  NVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNQNVNYA 130

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EY  +HDANVALQTLNGIQIENK IKINWAFQSQ NLN + +FNLF+GDLN++VDD T
Sbjct: 131 FVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDLNIDVDDET 190

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L++ FK+ P ++QAHVMWDMQTSRSRGYGFVSF   + AQ AMD MQG EINGR IRINW
Sbjct: 191 LSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEINGRPIRINW 250

Query: 195 ATKRE 199
           ATKRE
Sbjct: 251 ATKRE 255

 Score =  194 bits (493), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 89/92 (96%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+DMIRRAPPRVTTAYIGNIPHFATE DLIPLLQ FGFILDF+HYPEKGCCFIKYDTH
Sbjct: 352 QAVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTH 411

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKER+TFI
Sbjct: 412 EQAAVCIVALANFPFQGRNLRTGWGKERTTFI 443

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 401 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 439

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  268 bits (684), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 127/185 (68%), Positives = 144/185 (77%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           +V+PASA +GGRETSD+VLY+GNLDKSINED LKQYFQV GQI               YA
Sbjct: 67  SVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYA 126

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           FIEY  +HDANVALQTLNGIQIE K ++INWAFQSQ   N D +FNLF+GDLNV+VDD T
Sbjct: 127 FIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDET 186

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L++AF   P ++QAHVMWDMQT RSRGYGFVSF   E AQ AM+ MQG  INGRA+RINW
Sbjct: 187 LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246

Query: 195 ATKRE 199
           ATKRE
Sbjct: 247 ATKRE 251

 Score =  195 bits (496), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 90/92 (97%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QA++DMIRRAPPRVTTAYIGNIPHFATE DLIPLLQNFGFILDF+HYPEKGCCFIKYDTH
Sbjct: 311 QAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTH 370

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKER+TFI
Sbjct: 371 EQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 360 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 398

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  264 bits (674), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 149/198 (75%), Gaps = 8/198 (4%)

Query: 10  VVPVEN--------VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXX 61
           VVP EN        V+PA+A  GGRETSD+VLY+GNLDKSI ED LKQYFQVAGQI    
Sbjct: 50  VVPEENEEANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVK 109

Query: 62  XXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNL 121
                      YAF+EY+  HDA+VALQTLNGIQIEN  +KIN AFQSQ +  DD++FNL
Sbjct: 110 VMIDKKSNYVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNL 169

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           F+GDLN+++DD TL+ +FK  P ++QAHVMWDMQT RSRGYGFVSF   E AQ AM++MQ
Sbjct: 170 FVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQ 229

Query: 182 GHEINGRAIRINWATKRE 199
           G E+NGR IRINWATKR+
Sbjct: 230 GKELNGRPIRINWATKRD 247

 Score =  193 bits (491), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (97%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+DMIRRAPPRV+TAYIGNIPHFATE DLIPLLQ+FGFILDFTHYPEKGCCFIKYDTH
Sbjct: 325 QAVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTH 384

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTF 336
           EQAAVCIVAL+NF FQGRNLRTGWGKER+TF
Sbjct: 385 EQAAVCIVALANFNFQGRNLRTGWGKERNTF 415

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 33  LYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L++G+L+  I++D L + F+     I               Y F+ ++    A  A++ +
Sbjct: 169 LFVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEM 228

Query: 92  NGIQIENKNIKINWAFQSQTN 112
            G ++  + I+INWA +   N
Sbjct: 229 QGKELNGRPIRINWATKRDNN 249

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 374 KGCCFIKYDTHEQAAVCIVALANFNFQGRNLRTGWGKER 412

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  259 bits (663), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 125/185 (67%), Positives = 143/185 (77%), Gaps = 1/185 (0%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           NV+PA+A  GGRETSDK+LY+GNLDKSINED+LKQYFQV G I               YA
Sbjct: 67  NVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPIANVKIIVDKNNKYCNYA 126

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EY  +HDANVALQTLNG  IE K +KINWAFQSQ + NDDT FNLFIGDLN++V+D +
Sbjct: 127 FVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSSNDDT-FNLFIGDLNIDVNDES 185

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L  AFK  P F+QAHVMWDMQT RSRGYGF SF T  +AQ AMDQMQG E+NGR IRINW
Sbjct: 186 LTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAMDQMQGKELNGRPIRINW 245

Query: 195 ATKRE 199
           A+KR+
Sbjct: 246 ASKRD 250

 Score =  178 bits (451), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 77/91 (84%), Positives = 84/91 (92%)

Query: 247 AVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 306
           AVEDMIRRAPPRVTTAYIGN+P FATE DLIPLLQNFGFILDF HYP++G CFIKYDTHE
Sbjct: 326 AVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHE 385

Query: 307 QAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           QAAVCIVAL+NF  QGRNL+TGWGKE+ TF+
Sbjct: 386 QAAVCIVALANFPLQGRNLKTGWGKEKPTFM 416

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 23/48 (47%)

Query: 151 MWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           + D +    RG  F+ +DTHE A   +  +    + GR ++  W  ++
Sbjct: 365 ILDFKHYPDRGICFIKYDTHEQAAVCIVALANFPLQGRNLKTGWGKEK 412

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  256 bits (655), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 143/191 (74%)

Query: 7   SETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXX 66
           SET+    +V+PA+A +GGRETSDKVLY+GNLD SINE+ LKQYFQV G I         
Sbjct: 20  SETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDK 79

Query: 67  XXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL 126
                 YAF+EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ    D+ +FNLF+GDL
Sbjct: 80  NNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDL 139

Query: 127 NVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
           NV+VDD TL NAFK  P +LQ HVMWDMQT  SRGYGFVSF + E AQ AMD MQGHE+N
Sbjct: 140 NVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELN 199

Query: 187 GRAIRINWATK 197
           GR +RINWA+K
Sbjct: 200 GRPLRINWASK 210

 Score =  187 bits (474), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (94%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+ MIRRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTH
Sbjct: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKER++F+
Sbjct: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFV 370

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 21/46 (45%)

Query: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 321 DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 366

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  256 bits (654), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 140/184 (76%)

Query: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAF 75
           V+PASA +GGRETSD+VLY+GNLDKSI ED LKQYFQ  G I               YAF
Sbjct: 43  VVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAF 102

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135
           +EY  +HDANVALQTLNG+Q+ENK +KINWAF++Q    +D +FNLF+GDLNV+VDD TL
Sbjct: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETL 162

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           A  F+  P F+QAHVMWDMQT RSRGYGFVSF   E AQ AMD MQG +++GR IRINWA
Sbjct: 163 AGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222

Query: 196 TKRE 199
           TKRE
Sbjct: 223 TKRE 226

 Score =  192 bits (489), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 84/92 (91%), Positives = 89/92 (96%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QA+EDMIRRAPPRVTTAYIGNIPH+ATE DLIPLLQNFGFILDFTHYPEKGCCFIKYDTH
Sbjct: 301 QAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 360

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKER+ F+
Sbjct: 361 EQAAVCIVALANFPFQGRNLRTGWGKERTNFM 392

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L++G+L+  ++++ L   F +    I               Y F+ +S   +A  A+  +
Sbjct: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207

Query: 92  NGIQIENKNIKINWAFQSQTNLNDD 116
            G  +  + I+INWA + + N+ ++
Sbjct: 208 QGKDLSGRQIRINWATKRERNMGNN 232

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 350 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 388

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  253 bits (647), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 145/198 (73%), Gaps = 4/198 (2%)

Query: 2   SDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXX 61
           SD +  ET      V+PA+A +GGRETSD+VLY+GNLDKSI E+ L+QYFQV GQI    
Sbjct: 31  SDSEERETTP----VVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVK 86

Query: 62  XXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNL 121
                      YAF+EY  +HDAN+ALQTLNG QIEN  ++INWAFQSQ  L D+ ++NL
Sbjct: 87  VMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNL 146

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           F+GDL+V+VDD TL NAF+S P F+Q HVMWDMQT  SRGYGFVSF   E AQ AMD MQ
Sbjct: 147 FVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQ 206

Query: 182 GHEINGRAIRINWATKRE 199
             E+NGR +RINWA+KRE
Sbjct: 207 SQELNGRPLRINWASKRE 224

 Score =  187 bits (475), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (95%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAVE MIRRAPPRVTT+YIGNIPHFAT+ DLIPLLQNFGFILDF HYPEKGCCF+KYDTH
Sbjct: 298 QAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTH 357

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKER+TF+
Sbjct: 358 EQAAVCIVALANFFFQGRNLRTGWGKERTTFV 389

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 22/48 (45%)

Query: 151 MWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           + D +    +G  FV +DTHE A   +  +      GR +R  W  +R
Sbjct: 338 ILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKER 385

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/85 (17%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 33  LYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L++G+L   ++++ L   F+     I               Y F+ +     A +A+ ++
Sbjct: 146 LFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSM 205

Query: 92  NGIQIENKNIKINWAFQSQTNLNDD 116
              ++  + ++INWA + + + N +
Sbjct: 206 QSQELNGRPLRINWASKRENHHNGN 230

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  251 bits (642), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 141/185 (76%), Gaps = 1/185 (0%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           +++PA+A  GGRETSDK+LY+GNLDKSINED LKQYFQV G I               YA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNNEAN-YA 119

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EYS +HDA++AL+TLNG QIEN  +KINWAFQSQ N   D +FNLFIGDLNV+VDD T
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L  AFK    F+QAHVMWDMQT RSRGYGFVSF   ++AQ AMD MQG E+NGR +RINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 195 ATKRE 199
           A+KRE
Sbjct: 240 ASKRE 244

 Score =  180 bits (456), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 85/92 (92%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+DMIRRAP RVTT YIGNIPHFATE DLIPLLQNFGFILDF HYPEKG CFIKYDTH
Sbjct: 310 QAVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTH 369

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIV L+NF FQGRNL+TGWGKE+STF+
Sbjct: 370 EQAAVCIVVLANFPFQGRNLKTGWGKEKSTFM 401

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  250 bits (639), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 120/185 (64%), Positives = 140/185 (75%), Gaps = 1/185 (0%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           +V+PA+A  GGRETSDKVLY+GNLDK+I ED LKQYFQV G I               YA
Sbjct: 57  SVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 116

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ + +DDT FNLF+GDLNVNVDD T
Sbjct: 117 FVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVNVDDET 175

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L NAFK  P +L  HVMWDMQT  SRGYGFVSF + ++AQ AMD MQG ++NGR +RINW
Sbjct: 176 LRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINW 235

Query: 195 ATKRE 199
           A KR+
Sbjct: 236 AAKRD 240

 Score =  184 bits (466), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 85/92 (92%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+ +IR APPRVTTAYIGNIPHFATE DLIPL QNFGFILDF HYPEKGCCFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKERS F+
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%)

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           P F     + D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 359 PLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 414

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  249 bits (636), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 140/185 (75%), Gaps = 1/185 (0%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           +V+PA+A  GGRETSD+VLY+GNLDK+I ED LKQYFQV G I               YA
Sbjct: 59  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 118

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ + +DDT FNLF+GDLNVNVDD T
Sbjct: 119 FVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVNVDDET 177

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L NAFK  P +L  HVMWDMQT  SRGYGFVSF + ++AQ AMD MQG ++NGR +RINW
Sbjct: 178 LRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRPLRINW 237

Query: 195 ATKRE 199
           A KR+
Sbjct: 238 AAKRD 242

 Score =  184 bits (466), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 85/92 (92%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+ +IR APPRVTTAYIGNIPHFATE DLIPL QNFGFILDF HYPEKGCCFIKYDTH
Sbjct: 333 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 392

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKERS F+
Sbjct: 393 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 424

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%)

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           P F     + D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 365 PLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 420

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  249 bits (636), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 119/184 (64%), Positives = 139/184 (75%), Gaps = 1/184 (0%)

Query: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAF 75
           V+PA+A  GGRETSD+VLY+GNLDK+I ED LKQYFQV G I               YAF
Sbjct: 61  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 120

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135
           +EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ + +DDT FNLF+GDLNVNVDD TL
Sbjct: 121 VEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQSSSDDT-FNLFVGDLNVNVDDETL 179

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
            NAFK  P +L  HVMWDMQT  SRGYGFVSF + ++AQ AMD MQG ++NGR +RINWA
Sbjct: 180 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239

Query: 196 TKRE 199
            KR+
Sbjct: 240 AKRD 243

 Score =  183 bits (465), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 85/92 (92%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+ +IR APPRVTTAYIGNIPHFATE DLIPL QNFGFILDF HYPEKGCCFIKYDTH
Sbjct: 329 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 388

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKERS F+
Sbjct: 389 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/81 (19%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 33  LYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L++G+L+ +++++ L+  F+     +               Y F+ +++  DA  A+ ++
Sbjct: 165 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSM 224

Query: 92  NGIQIENKNIKINWAFQSQTN 112
            G  +  + ++INWA +   N
Sbjct: 225 QGQDLNGRPLRINWAAKRDNN 245

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%)

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           P F     + D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 361 PLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 416

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  249 bits (635), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 119/184 (64%), Positives = 139/184 (75%), Gaps = 1/184 (0%)

Query: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAF 75
           V+PA+A  GGRETSD+VLY+GNLDK+I ED LKQYFQV G I               YAF
Sbjct: 60  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 119

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135
           +EY  +HDAN+ALQTLNG QIEN  +KINWAFQSQ + +DDT FNLF+GDLNVNVDD TL
Sbjct: 120 VEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVNVDDETL 178

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
            NAFK  P +L  HVMWDMQT  SRGYGFVSF + ++AQ AMD MQG ++NGR +RINWA
Sbjct: 179 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238

Query: 196 TKRE 199
            KR+
Sbjct: 239 AKRD 242

 Score =  184 bits (467), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 85/92 (92%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+ +IR APPRVTTAYIGNIPHFATE DLIPL QNFGFILDF HYPEKGCCFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIVAL+NF FQGRNLRTGWGKERS F+
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 24/56 (42%)

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           P F     + D +    +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 359 PLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 414

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  243 bits (621), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 139/185 (75%), Gaps = 1/185 (0%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           +V+PA+A  GGRETSDK+LY+GNLDKSINE+ LKQYFQ+ G I               YA
Sbjct: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YA 121

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134
           F+EY  +HDA+VA + LNG  IE K +KINWAFQSQ   +D++ FNLF+GDLNV+VDD T
Sbjct: 122 FVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDET 181

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           L +AF   P F+QAHVMWDMQT RSRGYGF+SF   E+AQ AMD+MQ  E+NGR IRINW
Sbjct: 182 LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241

Query: 195 ATKRE 199
           A+KRE
Sbjct: 242 ASKRE 246

 Score =  175 bits (444), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAV+DMIRRAP RVTT YIGNIPHFATE DLIPLLQNFGFILDF +YPEKG CFIKYDTH
Sbjct: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCIV L+N+ FQGRNL+TGWGKE++ FI
Sbjct: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  241 bits (615), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 141/208 (67%), Gaps = 13/208 (6%)

Query: 4   QQPSETVV---------PVE---NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYF 51
           QQP++  V         PVE    + PA+   GGRETSDK+LY+GNLDKSI ED LKQYF
Sbjct: 5   QQPTQEKVVENNQDETTPVEEQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYF 64

Query: 52  QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQT 111
           QV G +               YAF+EY   HDANVA QTL+G  IEN  IKINWAFQS  
Sbjct: 65  QVGGPVANVKILVDKNNQEANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSH- 123

Query: 112 NLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHE 171
            +  D SFNLF+GDLNV+VDD TLANAF     F+QAHVMWDMQ+ RSRGYGFVSF   E
Sbjct: 124 QVASDESFNLFVGDLNVDVDDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQE 183

Query: 172 NAQAAMDQMQGHEINGRAIRINWATKRE 199
            AQ AM+  QG E+NGRAIRINWA+KRE
Sbjct: 184 QAQKAMETKQGFELNGRAIRINWASKRE 211

 Score =  186 bits (473), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (95%)

Query: 249 EDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQA 308
           E MIRRAPPR+TTAYIGNIPHFATEPDLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQA
Sbjct: 287 EAMIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQA 346

Query: 309 AVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           AVCIVAL+NF FQGRNLRTGWGKE+ TFI
Sbjct: 347 AVCIVALANFPFQGRNLRTGWGKEKPTFI 375

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 21/46 (45%)

Query: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           D +    +G  F+ +DTHE A   +  +      GR +R  W  ++
Sbjct: 326 DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEK 371

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  240 bits (612), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 138/197 (70%), Gaps = 2/197 (1%)

Query: 4   QQPSETVVPVE-NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX 62
           Q P  +  P E  V PA+A  GGRETSD++LY+GNLD ++ E+ LKQYFQV G I     
Sbjct: 39  QTPESSTKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKI 98

Query: 63  XXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLF 122
                     YAF+E+   HDANVA QTL+G QIEN  IKINWAFQSQ   ++DT FNLF
Sbjct: 99  LMDKNNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDT-FNLF 157

Query: 123 IGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQG 182
           +GDLNV+VDD TLA  FK  P F+QAHVMWDMQT RSRGYGFVSF     AQ AM+  QG
Sbjct: 158 VGDLNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQG 217

Query: 183 HEINGRAIRINWATKRE 199
             +NGRAIRINWA+KRE
Sbjct: 218 AVVNGRAIRINWASKRE 234

 Score =  173 bits (439), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QAVE M+R APPRVTT YIGNIPHFATE DLIPLLQNFGFI+DF HYP++GCCFIKY TH
Sbjct: 307 QAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 366

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAAVCI+ L NF FQGRNLRTGWGKE+ ++I
Sbjct: 367 EQAAVCILTLGNFPFQGRNLRTGWGKEKPSYI 398

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 8/104 (7%)

Query: 5   QPSETVVPVENVIPASAKEGGRETSDKV--LYIGNLDKSINEDALKQYFQVAGQIXXXXX 62
           QP   ++P + V P + +   R    +V  +YIGN+     E  L    Q  G I     
Sbjct: 294 QPQGPIMPPQ-VPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKH 352

Query: 63  XXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
                       FI+Y T+  A V + TL     + +N++  W 
Sbjct: 353 YPDRG-----CCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWG 391

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  238 bits (607), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 135/186 (72%), Gaps = 1/186 (0%)

Query: 14  ENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXY 73
           ++  P  A +GGRE SDK+LY+GNL KSI++D LKQYFQ+ G I               Y
Sbjct: 80  DSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNY 139

Query: 74  AFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDT 133
           AF+EY   HDANVA QTLNG ++E K +KINWAFQSQ  +N D +FNLF+GDLNV+VDD 
Sbjct: 140 AFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQ-QVNSDETFNLFVGDLNVDVDDA 198

Query: 134 TLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRIN 193
           TLA  FK  P F+QAHVMWDMQ+ RSRGYGFVSF   + AQ AM+  QG E+NGRA+RIN
Sbjct: 199 TLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258

Query: 194 WATKRE 199
           WA+KRE
Sbjct: 259 WASKRE 264

 Score =  186 bits (473), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 87/92 (94%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           +AVEDM+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTH
Sbjct: 345 EAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 404

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAA+CIVAL+NF FQGRNLRTGWGKE+ TFI
Sbjct: 405 EQAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  237 bits (604), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 135/184 (73%), Gaps = 1/184 (0%)

Query: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAF 75
           V PA+A  GGRETSD++LY+GNLD ++ ED LKQYFQV G I               YAF
Sbjct: 47  VTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAF 106

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135
           +E+   HDA+VA QTL+G QIEN  IKIN+AFQSQ   ++DT FNLF+GDLNV+VDD TL
Sbjct: 107 VEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDT-FNLFVGDLNVDVDDETL 165

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           AN FK  P F+QAHVMWDMQT RSRGYGFVSF     AQ AM++ QG  +NGRAIRINWA
Sbjct: 166 ANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWA 225

Query: 196 TKRE 199
           +KRE
Sbjct: 226 SKRE 229

 Score =  169 bits (429), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%)

Query: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305
           QA+E MIR AP RVTT YIGNIPHFA+E DLIPLLQNFGFI+DF HYP++GCCFIKY TH
Sbjct: 310 QAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 369

Query: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           EQAA+CI+ L NF FQGRNLRTGWGKE+ T++
Sbjct: 370 EQAAICILTLGNFPFQGRNLRTGWGKEKPTYV 401

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  236 bits (601), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 132/184 (71%), Gaps = 1/184 (0%)

Query: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAF 75
           V P  A +GGRETSD++LY+GNLDK+INED LKQYFQV G I               YAF
Sbjct: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135
           +EY   HDANVA QTL+G QIE   IKINWAFQSQ   +DDT FNLF+GDLNV+VDD TL
Sbjct: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETL 166

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
              FK  P F+QAHVMWDM + RSRGYGFVSF   + AQ AM+  QG  +NGRAIRINWA
Sbjct: 167 TGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226

Query: 196 TKRE 199
           +KRE
Sbjct: 227 SKRE 230

 Score =  179 bits (455), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 79/89 (88%), Positives = 82/89 (92%)

Query: 249 EDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQA 308
           E MIRRAP RVTTAYIGNIPHFA EPDLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQA
Sbjct: 303 EAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 362

Query: 309 AVCIVALSNFQFQGRNLRTGWGKERSTFI 337
           AVCIVAL+NF FQGRNLRTGWGKE+  FI
Sbjct: 363 AVCIVALANFPFQGRNLRTGWGKEKPAFI 391

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 21/46 (45%)

Query: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           D +    +G  F+ +DTHE A   +  +      GR +R  W  ++
Sbjct: 342 DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEK 387

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 134/317 (42%), Gaps = 14/317 (4%)

Query: 25  GRETSDKVLYIGNLDKSINEDALKQYFQVAGQ--IXXXXXXXXXXXXXXXYAFIEYSTNH 82
           G ET+   LY+G+LD S  E+ +KQ +   G+  +               Y F+E+ +N 
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEPNVQVKLIKNSGPMNNSGYCFVEFPSNL 106

Query: 83  DA-NVALQTLNGIQIE-NKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A N  L+T   I ++ ++++K+NWA  +       T F++F+GDL  NV ++ L   F 
Sbjct: 107 SATNALLKTGLPIPVDPSRSLKLNWASFATA---PGTEFSIFVGDLAPNVSESQLFELFI 163

Query: 141 S-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           S     L A +++D  T  S+GYGFV F      Q ++ +MQG  +NGRAIR++  +K +
Sbjct: 164 SRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSKNK 223

Query: 200 X----XXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRA 255
                                 V N                         Q V  + +  
Sbjct: 224 SRFRGGLSGTVTSAAAATAGPPVGNLSGVIQTSSPQTLPQQSQFIYPVQQQPV--LSQFT 281

Query: 256 PPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVAL 315
            P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  +
Sbjct: 282 DPNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKM 341

Query: 316 SNFQFQGRNLRTGWGKE 332
             F      +R  WG+ 
Sbjct: 342 QGFPIGNSRIRLSWGRS 358

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 142/332 (42%), Gaps = 23/332 (6%)

Query: 15  NVIPASAKEG-----GRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX----- 64
           N + + A+ G     G ++ +  LY+G+LD S +E+ ++  +   G+             
Sbjct: 27  NAMTSPAQSGNVRLSGSQSRNNQLYMGDLDPSWDENVIRSIWNSLGESNVEIKLMWNNRN 86

Query: 65  XXXXXXXXYAFIEYSTNHDANVALQTLNGIQIE---NKNIKINWAFQSQTNLNDDTSFNL 121
                   Y F+++S+   A+ AL   NG+ I    +K +++NW+  S  + +     ++
Sbjct: 87  AGVRTHLGYCFVQFSSRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISV 145

Query: 122 FIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           F+GDL  NV ++ L   F S CP    A VM+D  T  S+GY FV F   E+ Q A+ +M
Sbjct: 146 FVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEM 205

Query: 181 QGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXX 240
            G  + GRAIR+  A  +                  +++                     
Sbjct: 206 TGTFLKGRAIRVGSAGHQN------QRNRNGPGLENKLKGLNATVSSPKPANISSTNFSQ 259

Query: 241 XXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE-KGCCF 299
                Q +  +        TT ++ ++ H  TE +L    Q FG ++ +   PE K C F
Sbjct: 260 FILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVI-YAKLPENKQCGF 318

Query: 300 IKYDTHEQAAVCIVALSNFQFQGRNLRTGWGK 331
           ++Y     A + I+ L  F  +G  ++  WG+
Sbjct: 319 VQYVDRASAEMAILKLQGFPIRGSRIKISWGR 350

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 44/100 (44%), Gaps = 8/100 (8%)

Query: 7   SETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXX 66
           S+ ++P + + P ++     + ++  L++ +L   + E+ LK +FQ  G +         
Sbjct: 258 SQFILPTQQLPPLNSFT---DRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENK 314

Query: 67  XXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
                   F++Y     A +A+  L G  I    IKI+W 
Sbjct: 315 QC-----GFVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 85/238 (35%), Gaps = 57/238 (23%)

Query: 6   PSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYF--QVAGQIXXXXXX 63
           PS+T+    +    ++ +G  E S   +++G+L  ++ E  L + F  +           
Sbjct: 121 PSKTLRLNWSSASGNSADGSNEIS---VFVGDLAPNVTESDLFELFISKCPSTSNAKVMY 177

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA-FQSQTNLN-------- 114
                    YAF+ +    D   ALQ + G  ++ + I++  A  Q+Q N N        
Sbjct: 178 DQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKL 237

Query: 115 -------------------------------------DDTSFNLFIGDLNVNVDDTTLAN 137
                                                D  +  LF+  L+  V +  L  
Sbjct: 238 KGLNATVSSPKPANISSTNFSQFILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKA 297

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
            F+     + A +  + Q       GFV +    +A+ A+ ++QG  I G  I+I+W 
Sbjct: 298 FFQPFGNVIYAKLPENKQC------GFVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score =  104 bits (260), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 131/313 (41%), Gaps = 9/313 (2%)

Query: 25  GRETSDKVLYIGNLDKSINEDALKQYFQVAGQ--IXXXXXXXXXXXXXXXYAFIEYSTNH 82
           G +TS   LY+G+LD S  E  +KQ +   G+  +               Y F+E+ +N 
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNL 105

Query: 83  DA-NVALQTLNGIQIE-NKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A N  L+T   I ++ ++ +K+NWA  + T     + F++F+GDL  NV ++ L   F 
Sbjct: 106 AATNALLKTGLPIPVDASRTLKLNWASFATT---PGSEFSIFVGDLAPNVTESQLFELFI 162

Query: 141 S-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           S     L A +++D  T  S+GYGFV F      Q ++ +MQG  +NGRAIR++  +K +
Sbjct: 163 SRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNK 222

Query: 200 XXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRV 259
                                                         Q    + + A P  
Sbjct: 223 SRFQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQ-PALSQFADPNN 281

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQ 319
           TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  +  F 
Sbjct: 282 TTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQGFP 341

Query: 320 FQGRNLRTGWGKE 332
                +R  WG+ 
Sbjct: 342 IGNSRVRLSWGRS 354

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 98.6 bits (244), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 127/307 (41%), Gaps = 17/307 (5%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ---IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           LY+G+LD S +E ++K  +   G+   +               + F+E+ ++ +A+ AL 
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGEQNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNALL 116

Query: 90  TLNGIQIEN---KNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKS-CPGF 145
             NG+ + N   K +K+NWA  S T  N+   +++F+GDL  NV +  L   F S     
Sbjct: 117 K-NGLPVPNAVNKFLKLNWASISTTPGNE---YSIFVGDLAPNVTEAQLFELFISRYSST 172

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L + +++D  T  S+GYGFV F        A+ +MQG  +NGRAIR++  +K +      
Sbjct: 173 LNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSKNKPKFQQL 232

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                      Q   +                            D      P  TT +IG
Sbjct: 233 QQLQSQSQSKSQPLQQTPINSTATQLQSQFVFPVQQTPSINQFTD------PNNTTVFIG 286

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNL 325
            +    TE +L    Q FG I+       KGC F++Y     A   I  +  F      +
Sbjct: 287 GLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQGFPIGNSRI 346

Query: 326 RTGWGKE 332
           R  WG+ 
Sbjct: 347 RLSWGRS 353

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 5/77 (6%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           +  ++IG L   + ED L+ YFQ  G I                 F++Y     A  A+ 
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGC-----GFVQYIDRISAETAIA 334

Query: 90  TLNGIQIENKNIKINWA 106
            + G  I N  I+++W 
Sbjct: 335 KMQGFPIGNSRIRLSWG 351

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 98.2 bits (243), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 86/338 (25%), Positives = 137/338 (40%), Gaps = 18/338 (5%)

Query: 2   SDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXX 61
           SD Q   ++    +  PAS     R  S   LY+G+LD + +E A++  +   G+     
Sbjct: 19  SDYQLHTSMSGTRSQSPASEHHSTRSNS---LYMGDLDPNWDEAAIRAVWATLGEPNVQI 75

Query: 62  XXXXXXXXX---XXYAFIEYSTNHDANVALQTLNGIQIENKN---IKINWAFQSQTNLND 115
                         Y F+E+ ++ +A+ AL   NG+ I N     +K+NWA  + T  N+
Sbjct: 76  KLIRSSGSPGHNSGYCFVEFPSHTNASNALLK-NGLVIPNTGNRILKLNWASFATTPGNE 134

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              +++F+GD+  NV +  L   F S     L A +++D  T  S+GYGFV F      Q
Sbjct: 135 ---YSVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQ 191

Query: 175 AAMDQMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXX 234
            ++ +MQG  +NGRAIR++  +K                       +             
Sbjct: 192 RSLLEMQGVFLNGRAIRVSTTSKNRPKFQQVQPPLQQQQHQQHAFAK----HSHAPQFNA 247

Query: 235 XXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE 294
                      Q    + +   P  TT +IG +    TE +L    Q FG I+       
Sbjct: 248 VQPQSQFIYPVQQQPTLTQYTDPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVG 307

Query: 295 KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
           KGC F++Y     A   I  +  F      +R  WG+ 
Sbjct: 308 KGCGFVQYVDRLSAETAIAKMQGFPIGNSRIRLSWGRS 345

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/339 (23%), Positives = 132/339 (38%), Gaps = 36/339 (10%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQVAGQIX------------XXXXXXXXXXXXXXYAF 75
           T+   LY+G+LD + +++ ++Q +   G+                            Y F
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCF 100

Query: 76  IEY-STNHDANVALQTLNGIQIEN---KNIKINWAFQSQTN------LNDDTSFNLFIGD 125
           I++ S+ H AN  L+  NG+ I N   + +K+NWA  S +N      +    S+++F+GD
Sbjct: 101 IDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGD 158

Query: 126 LNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHE 184
           L  NV ++ L   F         A ++ D  T  S+GYGFV F   +  Q A+ +MQG  
Sbjct: 159 LAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVF 218

Query: 185 INGRAIRINWATKREXXXXXXXXXXXXXXXXXQV-----------RNRXXXXXXXXXXXX 233
           +NGRAI++   + ++                  +           +N+            
Sbjct: 219 LNGRAIKVGPTSGQQQQNVHVNGNIDQGRSSSSLNNENFDPRFHSKNQSLLGNVANNMSS 278

Query: 234 XXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYP 293
                       Q    +     P  TT +IG +    TE +L    Q FG I+      
Sbjct: 279 KGNNVSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPV 338

Query: 294 EKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
            KGC F++Y     A   I  +  F      +R  WG+ 
Sbjct: 339 GKGCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRS 377

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   + ED L+ YFQ  G I                 F++Y     A  
Sbjct: 301 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGC-----GFVQYVDRLSAEA 355

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  ++++W 
Sbjct: 356 AIAGMQGFPIANSRVRLSWG 375

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 126/307 (41%), Gaps = 13/307 (4%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXX---XXXXXXXXXYAFIEYSTNHDANVALQ 89
           LY+G+LD S +E+A++  +   G+                   Y F+E+ ++ +A+ AL 
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL 104

Query: 90  TLNGIQI---ENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKS-CPGF 145
             NG+ I    N+ +K+NWA  +    N+ +   +F+GD+  NV +  L   F S     
Sbjct: 105 K-NGLLIPNARNRYLKLNWASFATAPGNEHS---VFVGDIAPNVSEAQLFELFISRYAST 160

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L A +++D  T  S+GYGFV F      Q A+ +MQG  +NGRA+R++  +K        
Sbjct: 161 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSKNRSKFQQP 220

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                      Q                            Q    + +   P  TT +IG
Sbjct: 221 LQQQQQPYMQQQQPYVQQQARAPAFNNGNVQSQFIYPVQQQPT--LTQYTDPNNTTVFIG 278

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNL 325
            +    +E +L    Q FG I+       KGC F++Y     A   I  +  +      +
Sbjct: 279 GLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGYPIGNSRI 338

Query: 326 RTGWGKE 332
           R  WG+ 
Sbjct: 339 RLSWGRS 345

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   ++ED L+ YFQ  G I                 F++Y     A  
Sbjct: 269 DPNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGC-----GFVQYVDRISAET 323

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  I+++W 
Sbjct: 324 AIAKMQGYPIGNSRIRLSWG 343

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/341 (23%), Positives = 137/341 (40%), Gaps = 36/341 (10%)

Query: 25  GRETSDKVLYIGNLDKSINEDALKQYFQVAGQ------------IXXXXXXXXXXXXXXX 72
           G  T+   LY+G+LD + +++ ++Q +   G+            +               
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNSLNNGSRSPMGSKNNQG 107

Query: 73  YAFIEY-STNHDANVALQTLNGIQIEN---KNIKINWAFQSQT-------NLNDDTSFNL 121
           Y F+++ S+ H AN  L+  NG+ I N   + +K+NWA  S +       N+    + ++
Sbjct: 108 YCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSSGNSTFNNVKSSNNCSV 165

Query: 122 FIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           F+GDL  NV ++ L   F         A V+ D  T  S+GYGFV F   +  Q+A+ +M
Sbjct: 166 FVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSALLEM 225

Query: 181 QGHEINGRAIRINWAT--KREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXX 238
           QG  +NGRAI++   +  ++                   + +R                 
Sbjct: 226 QGVFLNGRAIKVGPTSGQQQHVNSNNDYNRSSSSLNNENLDSRFISKSQSFIGSGSSNMG 285

Query: 239 XXXXXXXQAVEDMIRRAP-------PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTH 291
                  Q +   +++ P       P  TT +IG +    TE +L    Q FG I+    
Sbjct: 286 LKRNQTSQFIYP-VQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKI 344

Query: 292 YPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
              KGC F++Y     A   I  +  F      +R  WG+ 
Sbjct: 345 PVGKGCGFVQYVDRLSAETAIARMQGFPIANSRVRLSWGRS 385

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 126/318 (39%), Gaps = 25/318 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXX---------XXXXXXXXYAFIEYSTNHD 83
           LY+G+L+ S +E+ +K+ +   G+                         Y FI++ T+ +
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDFPTHFN 115

Query: 84  ANVALQTLNGIQIE---NKNIKINWAFQSQ-----TNLNDDTSFNLFIGDLNVNVDDTTL 135
           A+ AL   N + I    +K +K+NWA  S       +     +F++F+GDL  NV +  L
Sbjct: 116 ASNAL-LKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQL 174

Query: 136 ANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
            + F S  P    A V+ D+ T  S+GYGF+ F    + Q A+ +MQG  +NGRA+++  
Sbjct: 175 FDLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGM 234

Query: 195 ATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRR 254
           ++ +                    R                          Q    +   
Sbjct: 235 SSGQSNSGAGGSRQVGHD------RYGGSKPAGGKSNTPNSALFSQFMYPIQQQPALNHF 288

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVA 314
             P  TT +IG +     E +L    Q FG I+       KGC F++Y     A   I  
Sbjct: 289 TDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQ 348

Query: 315 LSNFQFQGRNLRTGWGKE 332
           +  F      +R  WG+ 
Sbjct: 349 MQGFPISNSRVRLSWGRS 366

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   + E+ L+QYFQ  G+I                 F++Y     A  
Sbjct: 290 DPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGC-----GFVQYIDRISAET 344

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  ++++W 
Sbjct: 345 AISQMQGFPISNSRVRLSWG 364

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 86.7 bits (213), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 128/311 (41%), Gaps = 57/311 (18%)

Query: 22  KEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYST 80
           +E   ET    LY+G+LD S++E  L   F   G +                YA++ ++ 
Sbjct: 26  EENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFND 85

Query: 81  NHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
           +  A  A++ LN   I+ K  +I W+ Q   +L    + N+FI +L+ ++D+  L + F 
Sbjct: 86  HDAAKTAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFS 144

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRIN-WATKRE 199
                L + V  D +T +S+G+G+V F+  E+A  A+D + G  +NG+ I +    +K+E
Sbjct: 145 VFGNILSSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVGPHLSKKE 203

Query: 200 XXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRV 259
                                                            E          
Sbjct: 204 R------------------------------------------------ESKFEEMKANF 215

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFG----FILDFTHYPE-KGCCFIKYDTHEQAAVCIVA 314
           T  YI NI    T+ +   L+  FG     +L+ T   E KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 315 LSNFQFQGRNL 325
           L+N +F+G+ L
Sbjct: 276 LNNTEFKGQPL 286

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 55/103 (53%)

Query: 95  QIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDM 154
           Q+EN +++      ++ N ++  S +L++GDL+ +V +  L + F          V  D 
Sbjct: 11  QLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDA 70

Query: 155 QTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            T  S GY +V+F+ H+ A+ A++++    I G+  RI W+ +
Sbjct: 71  ITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 72/174 (41%), Gaps = 12/174 (6%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++I NL   I+  AL   F V G I               + ++ +  +  A+ A+  LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTSF--------NLFIGDLNVNVDDTTLANAFKSCPG 144
           G+ +  + I +      +     ++ F        N++I ++N    D           G
Sbjct: 185 GMLLNGQEIYVGPHLSKKER---ESKFEEMKANFTNVYIKNINTETTDKEFEELVAKF-G 240

Query: 145 FLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
              + V+       ++G+GFV+F  HE+A   ++++   E  G+ + +N A K+
Sbjct: 241 KTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 74/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +YI N++    +   ++     G+                + F+ +  + DA   ++ LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 93  GIQIENKNIKINWA---FQSQTNLNDD------------TSFNLFIGDLNVNVDDTTLAN 137
             + + + + +N A   ++ Q  L                  NLFI +L+ ++DD  L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 198 RE 199
           ++
Sbjct: 397 KD 398

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 91/193 (47%), Gaps = 3/193 (1%)

Query: 1   MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXX 60
           +S++QP +   P       S + G  + +   LY+G LD S++E  L   F   G +   
Sbjct: 17  ISEEQPQQEATPASTASSESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASI 76

Query: 61  XX-XXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSF 119
                        YA++ +S +     A++ LN   I+ K  +I W+ Q   +L      
Sbjct: 77  RVCRDAITKTSLGYAYVNFSDHEAGKQAIEKLNYTPIKGKLCRIMWS-QRDPSLRKKGHG 135

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           N+FI +LN ++D+  L + F      L + +  D +T +S+G+GFV F+    A  A+D 
Sbjct: 136 NIFIKNLNQDIDNKALFDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEEESAANEAIDA 194

Query: 180 MQGHEINGRAIRI 192
           + G  +NG+ I +
Sbjct: 195 LNGMLLNGQEIYV 207

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D    ++  K++F   G +               + F+ Y  ++DA  A++ LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 93  GIQIENKNIKINWA------FQSQTNLNDDTSF---------NLFIGDLNVNVDDTTLAN 137
           G + +++ + +  A       QS     + T           NLF+ +L+ ++DD  L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM   +  +S+G+GFV F + E A  A+ +     + G+ + +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 198 RE 199
           ++
Sbjct: 409 KD 410

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%)

Query: 110 QTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDT 169
           Q   ND TS +L++G+L+ +V +  L + F          V  D  T  S GY +V+F  
Sbjct: 38  QAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSD 97

Query: 170 HENAQAAMDQMQGHEINGRAIRINWATK 197
           HE  + A++++    I G+  RI W+ +
Sbjct: 98  HEAGKQAIEKLNYTPIKGKLCRIMWSQR 125

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 132/344 (38%), Gaps = 41/344 (11%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX------------XXXXXXXXYAF 75
           T+   LY+G+LD + +++ + Q +   G+                            Y F
Sbjct: 54  TAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSSSRPSMGPKNNQGYCF 113

Query: 76  IEY-STNHDANVALQTLNGIQIE---NKNIKINWA-----------FQSQTNLNDDTSFN 120
           +++ S+ H AN  L+  NG+ I    NK +K+NWA             S +N     +++
Sbjct: 114 VDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGNNGGNNSISNSKSGNNYS 171

Query: 121 LFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           +F+GDL  NV ++ L + F +       A ++ D  T  S+GYGFV F   +  Q A+ +
Sbjct: 172 IFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFVKFSNADEQQLALSE 231

Query: 180 MQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQV-----------RNRXXXXXXX 228
           MQG  +NGRAI++   + ++                  +           +N+       
Sbjct: 232 MQGVFLNGRAIKVGPTSGQQQQNVRANGSNEYNRTSSSLNNENFDPRFPSKNQLSLGNVT 291

Query: 229 XXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILD 288
                            Q    +     P  TT +IG +    TE +L    Q FG I+ 
Sbjct: 292 NNMSSKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVY 351

Query: 289 FTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
                 KGC F++Y     A   I  +  F      +R  WG+ 
Sbjct: 352 VKIPVGKGCGFVQYVDRLSAETAIAGMQGFPIANSRVRLSWGRS 395

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   + ED L+ YFQ  G I                 F++Y     A  
Sbjct: 319 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGC-----GFVQYVDRLSAET 373

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  ++++W 
Sbjct: 374 AIAGMQGFPIANSRVRLSWG 393

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 125/315 (39%), Gaps = 21/315 (6%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXX----------XXXXXXXXXXXXXYAFIEY-STN 81
           LY+G+LD S +E+ ++Q +   G+                          Y F+E+ ST 
Sbjct: 47  LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEFPSTV 106

Query: 82  HDANVALQTLNGIQIEN---KNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANA 138
           H +N  L+  NG+QI N   K +K+NWA  S ++      +++F+GDL  NV ++ L   
Sbjct: 107 HASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFEL 164

Query: 139 FKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
           F S         +++D  T  S+GY FV F    + Q A+ +MQG  ++GRAIR++ A  
Sbjct: 165 FISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNAGH 224

Query: 198 REXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPP 257
            +                    N                         Q    +     P
Sbjct: 225 LQ----NSADGKSKATGAASASNANAVGGINTGNNSGLMSGSQFMYPVQPQPALNSFTDP 280

Query: 258 RVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSN 317
             TT ++G +     E +L    Q FG I+       KGC F++Y     A   I  +  
Sbjct: 281 NNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQG 340

Query: 318 FQFQGRNLRTGWGKE 332
           F      +R  WG+ 
Sbjct: 341 FPIGNSRVRLSWGRS 355

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 42/100 (42%), Gaps = 8/100 (8%)

Query: 7   SETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXX 66
           S+ + PV+   P  A     + ++  +++G L   + ED L+ YFQ  G I         
Sbjct: 262 SQFMYPVQ---PQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK 318

Query: 67  XXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
                   F++Y     A  A+  + G  I N  ++++W 
Sbjct: 319 GC-----GFVQYVDRISAETAIAKMQGFPIGNSRVRLSWG 353

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 135/339 (39%), Gaps = 38/339 (11%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQVAGQ------------IXXXXXXXXXXXXXXXYAF 75
           T+   LY+G+LD + +++ ++Q +   G+            +               Y F
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCF 110

Query: 76  IEY-STNHDANVALQTLNGIQIEN---KNIKINWA-------FQSQTNLNDDTSFNLFIG 124
           +++ S+ H AN  L+  NG+ I N   K +K+NWA         S  N+    + ++F+G
Sbjct: 111 VDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVG 168

Query: 125 DLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           DL  NV ++ L   F         A ++ D  T  S+GYGFV F   +  Q A+ +MQG 
Sbjct: 169 DLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGV 228

Query: 184 EINGRAIRINWATKREXXXXXXX--XXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXX 241
            +NGRAI++   + ++                    V +R                    
Sbjct: 229 FLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKR 288

Query: 242 XXXXQAVEDMIRRAP-------PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE 294
               Q +   +++ P       P  TT +IG +    TE +L    Q FG I+ +   P 
Sbjct: 289 NHMSQFIYP-VQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIV-YVKIPV 346

Query: 295 KGCC-FIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
             CC F++Y     A   I  +  F      +R  WG+ 
Sbjct: 347 GKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRS 385

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   + ED L+ YFQ  G I                 F++Y     A  
Sbjct: 309 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCC-----GFVQYVDRLSAEA 363

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  ++++W 
Sbjct: 364 AIAGMQGFPIANSRVRLSWG 383

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 128/329 (38%), Gaps = 31/329 (9%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ--IXXXXXXXXXXXXXXXYAFIEY-STNHDANVALQ 89
           +Y+G LD +  E  +K  ++  G+  I               Y FIE+ S  H +N  L+
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 90  TLNGIQIE---NKNIKINWAFQSQTNL----------NDDTSFNLFIGDLNVNVDDTTLA 136
             NGI I     K +K+NW   S  +L          +  T++++F+GDL  NV +  L 
Sbjct: 132 --NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLF 189

Query: 137 NAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           + F S       A ++ D  T  S+ YGFV F+   + Q A+ +MQG  +NGRAI+I   
Sbjct: 190 DLFISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKIGTT 249

Query: 196 TKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXX------XXXXXXXXXXXQAVE 249
           T                      ++R                              Q + 
Sbjct: 250 TGGSAHTNTDNNALAPNIANSGGKSRFQGTTTNSPSSPANIGRGNTSNYRLTSLSSQFIF 309

Query: 250 DMIRRAP------PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYD 303
            + ++ P      P  TT ++G +    TE  L    Q FG I+       KGC F++Y 
Sbjct: 310 PVQQQPPLNHFTDPNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYF 369

Query: 304 THEQAAVCIVALSNFQFQGRNLRTGWGKE 332
               A   I+ +  F      +R  WG+ 
Sbjct: 370 DRISAETAILRMQGFPIGNSRIRLSWGRS 398

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 35/84 (41%), Gaps = 5/84 (5%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  +++G L   + E+ L+  FQ  G I                 F++Y     A  
Sbjct: 322 DPNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGC-----GFVQYFDRISAET 376

Query: 87  ALQTLNGIQIENKNIKINWAFQSQ 110
           A+  + G  I N  I+++W   S+
Sbjct: 377 AILRMQGFPIGNSRIRLSWGRSSR 400

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/191 (31%), Positives = 93/191 (48%), Gaps = 21/191 (10%)

Query: 25  GRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXX-----XXXXXXXXXYAFIEYS 79
           G  T    LY+G+LD S +E  +K  +   G+                     Y F+E+ 
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFP 137

Query: 80  TNHDANVALQTLNGIQIE---NKNIKINWAFQSQTN-----------LNDDTSFNLFIGD 125
           +   A+ AL   NG++I    +K +K+NW+ QS  N            N  T+ ++F+GD
Sbjct: 138 SPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGD 196

Query: 126 LNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHE 184
           L  +V +  L + F    P  + A VM+D  T  S+GYGFV F +  + Q A+ +MQG  
Sbjct: 197 LAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCF 256

Query: 185 INGRAIRINWA 195
           +NGRAI+I  A
Sbjct: 257 LNGRAIKIGIA 267

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 317 NFQFQGRNLRTGWGKE 332
            F      +R  WG+ 
Sbjct: 384 GFPIANSRVRLSWGRS 399

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  +++G L   + ED L+ YF+  G I                 F++Y     A  
Sbjct: 323 DPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGC-----GFVQYVERSSAET 377

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  ++++W 
Sbjct: 378 AITKMQGFPIANSRVRLSWG 397

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D  +  +F+G L+  V +  L + F+     +   +         +G GFV +    +A+
Sbjct: 323 DPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKI------PAGKGCGFVQYVERSSAE 376

Query: 175 AAMDQMQGHEINGRAIRINWA 195
            A+ +MQG  I    +R++W 
Sbjct: 377 TAITKMQGFPIANSRVRLSWG 397

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 123/308 (39%), Gaps = 44/308 (14%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           ETS   LY+G LD +++E  L   F   G +                YA++ ++      
Sbjct: 36  ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGR 95

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+ ++D+  L + F      
Sbjct: 96  QAIEKLNYTPIKGQPCRIMWS-QRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGNI 154

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L   +  D  T  S+G+GFV F++ E A+ A+D + G  +NG+ + +     R+      
Sbjct: 155 LSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLNGQEVYVAPHVSRKDRQSKL 214

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                       ++N                         Q  E+  ++  P VT+ ++ 
Sbjct: 215 EEAKANFTNVY-IKN------------------ISLETPEQEFEEFFKKVAP-VTSVHL- 253

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNL 325
                  E D    L+ FG              F+ Y+TH  AA  +  L+  +F G+ L
Sbjct: 254 -------EKDSEGKLRGFG--------------FVNYETHAGAAKAVEELNGVEFHGQQL 292

Query: 326 RTGWGKER 333
             G  +++
Sbjct: 293 HVGRAQKK 300

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 75/182 (41%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +YI N+     E   +++F+    +               + F+ Y T+  A  A++ LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 93  GIQIENKNIKINWA---FQSQTNLNDD------------TSFNLFIGDLNVNVDDTTLAN 137
           G++   + + +  A   ++ Q  L                  NLFI +L+ ++DD  L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 198 RE 199
           ++
Sbjct: 403 KD 404

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/313 (20%), Positives = 122/313 (38%), Gaps = 55/313 (17%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           +T+   LY+G LD S++E  L   F   G +                YA++ ++ +    
Sbjct: 46  DTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGR 105

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ K  +I W+ Q    L    + N+FI +L+ ++D+  L + F      
Sbjct: 106 TAIEKLNYSPIKGKPCRIMWS-QRDPALRKKGAGNIFIKNLHPDIDNKALHDTFSVFGNI 164

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L   +  D +T +S+G+GFV F+    A  A+D + G  +NGR + +     +       
Sbjct: 165 LSCKIATD-ETGKSKGFGFVHFEEDNAAVEAVDAINGMMLNGREVYVAQHVSK------- 216

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                        ++R                           E  +       T  Y+ 
Sbjct: 217 -------------KDR---------------------------ESKLEEVKANFTNVYVK 236

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVCIVALSNFQF 320
           N+     E +   L   +G I       +     +G  FI ++ H+ AA  +  L++ +F
Sbjct: 237 NVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELNDLEF 296

Query: 321 QGRNLRTGWGKER 333
           +G+ L  G  +++
Sbjct: 297 KGQKLYVGRAQKK 309

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 74/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D    ED     F   G I               + FI +  + DA  A++ LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
            ++ + + + +  A +    L +                   NLF+ +L+ ++DD  L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM + +  +S+ +GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 198 RE 199
           ++
Sbjct: 412 KD 413

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 89/184 (48%), Gaps = 5/184 (2%)

Query: 12  PVENVIPASAKEGGR--ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXX 68
           P +NV PAS +   +  ETS   LY+G LD S++E  L   F   G +            
Sbjct: 21  PQQNVAPASNEPESQKVETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITK 80

Query: 69  XXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNV 128
               YA++ ++ +     A++ LN   I+    +I W+ Q   ++    S N+FI +L+ 
Sbjct: 81  TSLGYAYVNFNDHEAGKTAIEKLNYAPIKGVPCRIMWS-QRDPSMRKKGSGNIFIKNLHP 139

Query: 129 NVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGR 188
           ++D+  L + F      L   +  D +   SRG+GFV F+  E A+ A+D + G  +NG+
Sbjct: 140 DIDNKALHDTFSVFGNILSCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQ 198

Query: 189 AIRI 192
            + +
Sbjct: 199 EVYV 202

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+     ++  +++F   G I               + F+ Y  ++DA  A++ LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
               + + + +  A +    L +                   NLF+ +L+  +DD  L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 198 RE 199
           ++
Sbjct: 404 KD 405

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 78/178 (43%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL   I+  AL   F V G I               + F+ +  +  A 
Sbjct: 125 RKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATDEAGNSRGFGFVHFEDDEAAK 184

Query: 86  VALQTLNGIQIENKNIKINWAFQS---QTNLNDDTS--FNLFIGDLNVNVDDTTLANAFK 140
            A+  +NG+ +  + + +         Q+ L++  +   N+++ +++ +  D      F 
Sbjct: 185 EAIDAINGMLLNGQEVYVAQHVSKKDRQSKLDEAKANFTNVYVKNIHPDTGDEEFEEFFT 244

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                  AH+  D +  + RG+GFV+++ H +A  A++++   +  G+ + +  A K+
Sbjct: 245 KVGPITSAHLEKDNE-GKLRGFGFVNYENHNDAAKAVEELNETDFKGQTLHVGRAQKK 301

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%)

Query: 117 TSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAA 176
           +S +L++G+L+ +V +  L + F          V  D  T  S GY +V+F+ HE  + A
Sbjct: 40  SSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTA 99

Query: 177 MDQMQGHEINGRAIRINWATK 197
           ++++    I G   RI W+ +
Sbjct: 100 IEKLNYAPIKGVPCRIMWSQR 120

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 92/193 (47%), Gaps = 7/193 (3%)

Query: 1   MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXX 60
           + D+QP+ T  P    I A +     E     LY+G LD S++E  L   F   G +   
Sbjct: 17  IQDEQPAAT--PATTAIEAESP--NVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSI 72

Query: 61  XX-XXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSF 119
                        YA++ ++ +     A++ LN   I+ +  +I W+ Q   ++    S 
Sbjct: 73  RVCRDAITKTSLGYAYVNFNDHEAGKTAIEKLNYTAIKGRPCRIMWS-QRDPSMRKKGSG 131

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           N+FI +L+ ++D+ TL   F      L   +  D +T +S+G+GFV F+  E A+ A+D 
Sbjct: 132 NIFIKNLHPDIDNKTLYETFSVFGNILSCKIAND-ETGKSKGFGFVHFENEEAAREAIDA 190

Query: 180 MQGHEINGRAIRI 192
           + G  +NG+ + +
Sbjct: 191 INGMLLNGQEVYV 203

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ NLD    E+  +  F+  G I               + F+++  + DA  A++ LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
             + + + + +  A +    L +                   NLFI +L+ ++DD  L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 198 RE 199
           ++
Sbjct: 405 KD 406

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 78/178 (43%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL   I+   L + F V G I               + F+ +     A 
Sbjct: 126 RKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAR 185

Query: 86  VALQTLNGIQIENKNIKINWAFQS---QTNLNDDTS--FNLFIGDLNVNVDDTTLANAFK 140
            A+  +NG+ +  + + +         Q+ L++  +   N+++ +L++   +    N FK
Sbjct: 186 EAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFK 245

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
              G + +  +      +SRG+GFV F+ HE+A  A++ +   E  G+ + +  A K+
Sbjct: 246 PY-GTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQKK 302

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 49/92 (53%)

Query: 106 AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFV 165
           A ++++   ++ + +L++G+L+ +V +  L + F          V  D  T  S GY +V
Sbjct: 30  AIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 89

Query: 166 SFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
           +F+ HE  + A++++    I GR  RI W+ +
Sbjct: 90  NFNDHEAGKTAIEKLNYTAIKGRPCRIMWSQR 121

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 109/290 (37%), Gaps = 29/290 (10%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+    DA  AL +LN   I N               +N ++NWA  +  Q+++  
Sbjct: 166 YCFVEFQNQEDAQYAL-SLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQSSIPV 224

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA-HVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F+     ++   VM D  T  SR +GF+ F   +  +
Sbjct: 225 TPEFSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDERK 284

Query: 175 AAMDQMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXX 234
            A+ +M G    GR +R+ +AT R                     +              
Sbjct: 285 RALSEMNGVWCQGRPLRVAYATPRNNNNIISNQQNTATQLSHHGNSYHNNSHNNGNNRSR 344

Query: 235 XXXXXXXXXXXQAVEDMIRRAPPR----------VTTAYIGNIPHFATEPDLIPLLQNFG 284
                          +     PP+          V+T +IG +     E  +  L + FG
Sbjct: 345 KNSSSILNYQNNYTANTNHGQPPQLSKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFG 404

Query: 285 FILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKERS 334
            I++    P K C F+K++    A   I  L  F   G  +R  WGK  S
Sbjct: 405 NIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGFIVAGNPIRLSWGKASS 454

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 35/89 (39%), Gaps = 5/89 (5%)

Query: 18  PASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIE 77
           P  +K   +      ++IG L   INE  ++  F+  G I                 F++
Sbjct: 367 PQLSKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNC-----GFVK 421

Query: 78  YSTNHDANVALQTLNGIQIENKNIKINWA 106
           +    DA  A+Q L G  +    I+++W 
Sbjct: 422 FENRIDAEAAIQGLQGFIVAGNPIRLSWG 450

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 86/165 (52%), Gaps = 14/165 (8%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           VLY+G+LD S +E  + Q +   G+                Y FI +  +  A+ AL   
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGE------PNVSVKMMNRYCFITFLDSLTASNALLK- 85

Query: 92  NGIQIEN---KNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQ 147
           NG+ I     K +K+NWA   Q + N    +++F+GDL+ NV +  L + F         
Sbjct: 86  NGMLIPGYGGKRLKLNWA---QASSNASNGYSIFVGDLSPNVTEAQLFDLFINKYASTDH 142

Query: 148 AHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
           A +++D  T  SRGYGFV F++  + Q A+ +MQG  +NGRAI+I
Sbjct: 143 AKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 317 NFQFQGRNLRTGWGKE 332
            F      +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  +++G L   + ED L++YF+  G I                 F++Y     A  
Sbjct: 240 DPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGC-----GFVQYIDRVSAEN 294

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  I+++W 
Sbjct: 295 AISKMQGFPIANSRIRLSWG 314

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 9/94 (9%)

Query: 105 WAFQSQTNLN---DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRG 161
           +  Q Q  LN   D  +  +F+G L+  V +  L   FK     +   +         +G
Sbjct: 227 YPVQQQPTLNHFTDPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKG 280

Query: 162 YGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
            GFV +    +A+ A+ +MQG  I    IR++W 
Sbjct: 281 CGFVQYIDRVSAENAISKMQGFPIANSRIRLSWG 314

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 124/307 (40%), Gaps = 55/307 (17%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LY+G LD S++E  L   F   G +                YA++ ++ +    VA++ L
Sbjct: 53  LYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEKL 112

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N   I+ K  +I W+ Q   ++  + S N+FI +L+ ++D+  L + F      L   + 
Sbjct: 113 NYTPIKGKPCRIMWS-QRDPSMRKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIA 171

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXXXXXXXX 211
            D +T +S+G+GFV F+    A  A+D + G  +NG  + +     R             
Sbjct: 172 TD-ETGKSKGFGFVHFEEDTAASEAIDAINGMMLNGLEVYVAAHVSR------------- 217

Query: 212 XXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFA 271
                  ++R                           E     A    T  Y+ N+   A
Sbjct: 218 -------KDR---------------------------ESKFEAAKANFTNVYVKNVDLEA 243

Query: 272 TEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLR 326
           TE +   L + FG I   +   +     +G  F+ Y+ HE AA  +  L++ +F+ + L 
Sbjct: 244 TEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELNDLEFKSQKLY 303

Query: 327 TGWGKER 333
            G  +++
Sbjct: 304 VGRAQKK 310

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 78/182 (42%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D    E+  ++ F+  G I               + F+ Y  +  A  A+  LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
            ++ +++ + +  A +    L +                   NLF+ +L+  +DD  L  
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F+S        VM + +T +S+G+GFV F + E A  A+ +     + G+ + +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

Query: 198 RE 199
           ++
Sbjct: 413 KD 414

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S +L++G+L+ +V +  L + F          V  D  T  S GY +V+F+ H++ + A+
Sbjct: 50  SASLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAI 109

Query: 178 DQMQGHEINGRAIRINWATK 197
           +++    I G+  RI W+ +
Sbjct: 110 EKLNYTPIKGKPCRIMWSQR 129

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 74/179 (41%), Gaps = 8/179 (4%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL   I+  AL   F V G I               + F+ +  +  A+
Sbjct: 134 RKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDTAAS 193

Query: 86  VALQTLNGIQIENKNIKINWAF-----QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A+  +NG+ +    + +         +S+         N+++   NV+++ T       
Sbjct: 194 EAIDAINGMMLNGLEVYVAAHVSRKDRESKFEAAKANFTNVYVK--NVDLEATEEEFEEL 251

Query: 141 SCP-GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
               G + +  M      + RG+GFV+++ HE+A  A+D++   E   + + +  A K+
Sbjct: 252 FKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELNDLEFKSQKLYVGRAQKK 310

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 122/314 (38%), Gaps = 58/314 (18%)

Query: 18  PASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFI 76
           P+SA     E S   LY+G+LD S++E  L   F   G +                YA++
Sbjct: 30  PSSAT---TENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 86

Query: 77  EYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLA 136
            ++ +     A++ LN   I+ +  +I W+ Q    L    S N+FI +L+ ++D+  L 
Sbjct: 87  NFNDHEAGKKAIEKLNYTPIKGRLCRIMWS-QRDPALRKKGSANIFIKNLHSDIDNKALY 145

Query: 137 NAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
           + F      L + +  D +T +S+G+GFV F+    A+ A+D + G  +NG+ I +    
Sbjct: 146 DTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQEIFVGPHL 204

Query: 197 KREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAP 256
            R+                                                 +  +  + 
Sbjct: 205 SRKER-----------------------------------------------DSQLEESK 217

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVC 311
              T  Y+ NI    T+ +   L   +G +L            KG  F+ ++ HE AA  
Sbjct: 218 ANFTNIYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKA 277

Query: 312 IVALSNFQFQGRNL 325
           +  L+  QF+ + L
Sbjct: 278 VEELNGSQFKDQEL 291

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 78/182 (42%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N++    ++   + F   G++               + F+++  + DA  A++ LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
           G Q +++ + ++ A +    + +                   NLFI +L+ ++DD  L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM   +  +SRG+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 198 RE 199
           ++
Sbjct: 402 KD 403

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 75/178 (42%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL   I+  AL   F V G I               + F+ +  +  A 
Sbjct: 123 RKKGSANIFIKNLHSDIDNKALYDTFSVFGNILSSKIATDETGKSKGFGFVHFEDDTAAK 182

Query: 86  VALQTLNGIQIENKNIKINWAFQ-----SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A+  LNG+ +  + I +          SQ   +     N+++ ++N+   D      F 
Sbjct: 183 EAIDALNGMLLNGQEIFVGPHLSRKERDSQLEESKANFTNIYVKNINLETTDEEFTELFS 242

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                L A  +   +  + +G+GFV F+ HE+A  A++++ G +   + + ++ A K+
Sbjct: 243 KYGKVLSA-ALEKTEDGKLKGFGFVDFENHEDAAKAVEELNGSQFKDQELFVSRAQKK 299

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 7/105 (6%)

Query: 100 NIKINWAFQSQTNLN-------DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMW 152
           N+KI+ + + QT  +       +++S +L++GDL+ +V +  L + F          V  
Sbjct: 14  NLKIDDSQEQQTATSTPSSATTENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCR 73

Query: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
           D  T  S GY +V+F+ HE  + A++++    I GR  RI W+ +
Sbjct: 74  DAITKTSLGYAYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWSQR 118

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 121/313 (38%), Gaps = 55/313 (17%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           E S   LY+G+L+ S++E  L   F   G +                YA++ ++ +    
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+ ++D+  L + F      
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L + +  D +  +S+G+GFV F+    A+ A+D + G  +NG+ I +     R+      
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER---- 207

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                                                      +  +       T  Y+ 
Sbjct: 208 -------------------------------------------DSQLEETKAHYTNLYVK 224

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVCIVALSNFQF 320
           NI    T+     L   FG I+  +   +     KG  F+ Y+ HE A   + AL++ + 
Sbjct: 225 NINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSEL 284

Query: 321 QGRNLRTGWGKER 333
            G  L  G  +++
Sbjct: 285 NGEKLYVGRAQKK 297

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 3/106 (2%)

Query: 95  QIENKNIKINW---AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           Q+EN NI+ +    A  S++   +++S +L++GDL  +V +  L + F          V 
Sbjct: 11  QLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVC 70

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            D  T  S GY +V+F+ HE  + A++Q+    I GR  RI W+ +
Sbjct: 71  RDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 75/182 (41%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           LY+ N++    ++  ++ F   G I               + F+ Y  + DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 93  GIQIENKNIKINWAFQSQTNLN---------------DDTSFNLFIGDLNVNVDDTTLAN 137
             ++  + + +  A +    ++                    NLF+ +L+ +VDD  L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 198 RE 199
           ++
Sbjct: 400 KD 401

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 100/205 (48%), Gaps = 28/205 (13%)

Query: 15  NVIPASAKEGGRETSDKV--LYIGNLDKSINEDALKQYFQVAGQ------IXXXXXXXXX 66
           N +P+S       + +K   LY+G+LD   +E  +KQ +   G+      I         
Sbjct: 44  NPLPSSMNRSSNPSVNKTTQLYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNSNMTSM 103

Query: 67  XXXXXXYAFIEYSTNHDANVALQTLNGIQIENKN---IKINWA---------------FQ 108
                 Y FIE+S  ++A+ AL   NG+ I   N   +K+NWA                 
Sbjct: 104 GRNNPGYCFIEFSNYNNASNALLK-NGLVIPGYNSKVLKLNWASMHTRSNGNTNCTANNN 162

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           + +N + +  F++F+GDL  NV +  L + F       + A +++D  T+ S+GYGFV F
Sbjct: 163 TSSNNSTNNDFSVFVGDLAPNVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGYGFVRF 222

Query: 168 DTHENAQAAMDQMQGHEINGRAIRI 192
           +   + Q ++++MQG  +NGR+IR+
Sbjct: 223 NNSADQQRSLNEMQGVFLNGRSIRV 247

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    +E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 317 NFQFQGRNLRTGWGK 331
            F      +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   ++E  L+ YFQ  G I                 F++Y     A  
Sbjct: 336 DPNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGC-----GFVQYVDRSAAET 390

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+  + G  I N  I+++W 
Sbjct: 391 AISKMQGFPIGNSRIRLSWG 410

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D  +  +FIG L+  V +  L + F+     +   +         +G GFV +     A+
Sbjct: 336 DPNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAE 389

Query: 175 AAMDQMQGHEINGRAIRINWA 195
            A+ +MQG  I    IR++W 
Sbjct: 390 TAISKMQGFPIGNSRIRLSWG 410

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 86/178 (48%), Gaps = 11/178 (6%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G +               Y ++++     A  A+Q 
Sbjct: 172 TIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQE 231

Query: 91  LNGIQIENKNIKINWAFQSQTNLND----------DTSFNLFIGDLNVNVDDTTLANAFK 140
           + G +I+ + I ++ +       ND          + S  LF+G+L+ N D   +   F 
Sbjct: 232 MQGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFS 291

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                +   +    +T + +G+G+V F   E+A+ A++ +QG  I+ RA+R++++T R
Sbjct: 292 KYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 88/171 (51%), Gaps = 9/171 (5%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQVAGQ--IXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           T    LY+G+LD + +E+ ++Q ++  G+  +               Y F+E+ +    N
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN 103

Query: 86  VALQTLNGIQIEN---KNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAF-KS 141
            AL   NGI I     + +K+NWA  S     +++ F++F+GDL+ NV +  L   F   
Sbjct: 104 NALLK-NGIVIPGFPQRRLKLNWA--SAGANGNNSGFSVFVGDLSPNVTEAQLFELFIGR 160

Query: 142 CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
            P    A V+ D  T  S+ YGFV F++  + Q  + +MQG  +NGR+I++
Sbjct: 161 YPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    +E DL    Q FG I+       KGC F++Y     A + I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 317 NFQFQGRNLRTGWGKE 332
            F      +R  WG+ 
Sbjct: 340 GFPLANSRIRLSWGRS 355

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  ++IG L   ++ED L+QYFQ  G I                 F++Y     A +
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGC-----GFVQYVDRLSAEL 333

Query: 87  ALQTLNGIQIENKNIKINWAFQSQ 110
           A+  + G  + N  I+++W   S+
Sbjct: 334 AISKMQGFPLANSRIRLSWGRSSK 357

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 9/94 (9%)

Query: 105 WAFQSQTNLN---DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRG 161
           +  Q Q  LN   D  +  +FIG L+  V +  L   F+     +   +         +G
Sbjct: 266 YPVQQQPTLNHLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKI------PTGKG 319

Query: 162 YGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
            GFV +    +A+ A+ +MQG  +    IR++W 
Sbjct: 320 CGFVQYVDRLSAELAISKMQGFPLANSRIRLSWG 353

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/314 (20%), Positives = 121/314 (38%), Gaps = 55/314 (17%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           E S   LY+G+L+ S++E  L   F   G +                YA++ ++ +    
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+ ++D+  L + F      
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L + +  D +  +S+G+GFV F+    A+ A+D + G  +NG+ I +     R+      
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKER---- 207

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                                                      +  +       T  Y+ 
Sbjct: 208 -------------------------------------------DSQLEETKAHFTNLYVK 224

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVCIVALSNFQF 320
           NI    T+     L   FG I+  +   +     KG  F+ Y+ HE A   +  L++ + 
Sbjct: 225 NINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLNDSEL 284

Query: 321 QGRNLRTGWGKERS 334
            G  L  G  ++++
Sbjct: 285 NGEKLYVGRAQKKN 298

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 76/182 (41%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           LY+ N++    ++  ++ F   G I               + F+ Y  + DA  A++TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 93  GIQIENKNIKINWAFQSQTNLN---------------DDTSFNLFIGDLNVNVDDTTLAN 137
             ++  + + +  A +    ++                    NLF+ +L+ +VDD  L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 198 RE 199
           ++
Sbjct: 400 KD 401

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 95  QIENKNIKINW---AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           Q+EN NI+ +       S+    +++S +L++GDL  +V +  L + F          V 
Sbjct: 11  QLENLNIQDDQKQATAGSEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVC 70

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            D  T  S GY +V+F+ HE  + A++Q+    I GR  RI W+ +
Sbjct: 71  RDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 69/322 (21%), Positives = 123/322 (38%), Gaps = 56/322 (17%)

Query: 19  ASAKEG-GRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFI 76
           A+  EG   E S   LY+G+L+ S++E  L   F   G +                YA++
Sbjct: 25  ATGSEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 84

Query: 77  EYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLA 136
            ++ +     A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+ ++D+  L 
Sbjct: 85  NFNDHEAGRKAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALY 143

Query: 137 NAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
           + F      L + +  D +  +S+G+GFV F+    A+ A+D + G  +NG+ I +    
Sbjct: 144 DTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHL 202

Query: 197 KREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAP 256
            R+                                                 +  +    
Sbjct: 203 SRKER-----------------------------------------------DSQLEETK 215

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVC 311
              T  Y+ NI    T+     L   FG I+  +   +     KG  F+ Y+ HE A   
Sbjct: 216 AHYTNLYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKA 275

Query: 312 IVALSNFQFQGRNLRTGWGKER 333
           + AL+     G  L  G  +++
Sbjct: 276 VEALNESDLNGEKLYVGRAQKK 297

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           LY+ N++    ++  +  F   G I               + F+ Y  + DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 93  GIQIENKNIKINWAFQSQTNLN---------------DDTSFNLFIGDLNVNVDDTTLAN 137
              +  + + +  A +    ++                    NLF+ +L+ +VDD  L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 198 RE 199
           ++
Sbjct: 400 KD 401

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 85/178 (47%), Gaps = 15/178 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-------IXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           LY+G+L+    E+ +K  + + G+       I               Y F+E+     A+
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 86  VALQTLNGIQI---ENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKS- 141
            AL   +G+++    N  +K+NWA  +       + F LF+GDL  NV +  L   F S 
Sbjct: 118 NALMK-SGLRVPMDSNYALKLNWASFATA---PGSEFTLFVGDLAPNVTEAQLFELFISR 173

Query: 142 CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
               L A +++D  T  S+GYGFV F      Q A+ +MQG  +NGRAIR+   +K +
Sbjct: 174 YSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSKNK 231

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 313 PNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQ 372

Query: 317 NFQFQGRNLRTGWGKE 332
            F      +R  WG+ 
Sbjct: 373 GFPIGNSRIRLSWGRS 388

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 5/77 (6%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           +  ++IG L   I ED L+ YFQ  GQI                 F++Y     A  A+ 
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGC-----GFVQYVDRISAETAIS 369

Query: 90  TLNGIQIENKNIKINWA 106
            + G  I N  I+++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFD 168
           S +   D  +  +FIG L+  + +  L + F+         +++ ++    +G GFV + 
Sbjct: 306 SLSQFTDPNNTTVFIGGLSTLITEDELRSYFQPF-----GQIVY-VKIPVGKGCGFVQYV 359

Query: 169 THENAQAAMDQMQGHEINGRAIRINWA 195
              +A+ A+ +MQG  I    IR++W 
Sbjct: 360 DRISAETAISKMQGFPIGNSRIRLSWG 386

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 128/338 (37%), Gaps = 65/338 (19%)

Query: 3   DQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX 62
           DQQ + T    EN           +TS   LY+G LD ++ E  L   F   G +     
Sbjct: 20  DQQTAPTSTESENA--------KVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRV 71

Query: 63  -XXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNL 121
                      YA++ +  +     A+Q LN   I+ +  +I W+ Q   +L    S N+
Sbjct: 72  CRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNI 130

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           FI +L+  +D+  L + F      L   +  D +   S+G+GFV F+   +A+ A+D + 
Sbjct: 131 FIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAIN 189

Query: 182 GHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXX 241
           G  +NG+ + +     +                    ++R                    
Sbjct: 190 GMLLNGQEVYVAPHVSK--------------------KDR-------------------- 209

Query: 242 XXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFIL------DFTHYPEK 295
                  +  +  A    T  Y+ NI    T+ +   L   FG I       D    P +
Sbjct: 210 -------QSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-R 261

Query: 296 GCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKER 333
           G  FI ++ HE AA  +  L++  F+ + L  G  +++
Sbjct: 262 GFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D    ++  +  F   G+I               + FI +  +  A  A+  LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 93  GIQIENKNIKINWAFQSQTNLND---------------DTSFNLFIGDLNVNVDDTTLAN 137
               +++ + +  A +    L +                   NLF+ +L+ ++DD  L +
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM D     S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 198 RE 199
           ++
Sbjct: 402 KD 403

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 90/184 (48%), Gaps = 13/184 (7%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           T    +++G L  SI+++ LK  F+ + G I               Y ++++     A  
Sbjct: 208 TEPATIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEK 267

Query: 87  ALQTLNGIQIENKNIKINWAF-QSQTNLNDD-----------TSFNLFIGDLNVNVDDTT 134
           A++ + G +I+ + I ++ +  +  +N  +D            S  LF+G+L+ N D   
Sbjct: 268 AIKEMQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDN 327

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194
           +   FK     +   +    +T++ +G+G+V + + E AQ A+D++QG  I+ R +R+++
Sbjct: 328 IFELFKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDF 387

Query: 195 ATKR 198
           ++ R
Sbjct: 388 SSPR 391

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 79/161 (49%), Gaps = 3/161 (1%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LY+G LD +++E  L   F   G +                YA++ ++ +     A++ L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N   I+ +  +I W+ Q    L    S N+FI +L+ ++D+  L   F      L + + 
Sbjct: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
            D +T +S+G+GFV F+   +A+ A+D + G  +NG+ I +
Sbjct: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 75/178 (42%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL   I+  AL + F V G I               + F+ +     A 
Sbjct: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177

Query: 86  VALQTLNGIQIENKNIKINWAF-----QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A+  LNG+ +  + I +          SQ         N+++ ++N+   D      F 
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
              G + +  +   +  + +G+GFV F+ HE+A  A++++ G E   + + ++ A K+
Sbjct: 238 KY-GNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/182 (18%), Positives = 76/182 (41%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N++    ++   + F   G +               + F+++  + DA  A++ LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
           G + +++ + ++ A +    + +                   NLF+ +L+ ++DD  L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM      +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 198 RE 199
           ++
Sbjct: 397 KD 398

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           +L++G+L+  V +  L + F          V  D  T  S GY +V+F+ HE  + A++Q
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 180 MQGHEINGRAIRINWATK 197
           +    I GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 81/174 (46%), Gaps = 3/174 (1%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           ETS   LY+G LD S++E  L   F   G +                YA++ +  +    
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ K  +I W+ Q   +L    S N++I +L+  +D+ +L   F +    
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           L   V  D     SRG+GFV F+   +A+ A++ + G  +N + + + W   ++
Sbjct: 153 LSCKVATD-DNGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAWHVSKK 205

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 80/178 (44%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     +YI NL  +I+  +L + F   G I               + F+ +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDAR 180

Query: 86  VALQTLNGIQIENKNIKINWAFQS---QTNLNDDTS--FNLFIGDLNVNVDDTTLANAFK 140
            A++ +NG+ + ++ + + W       Q+ L +  +   N+++ ++++          F 
Sbjct: 181 DAIEAVNGMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLF- 239

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           S  G + + V+      + RG+GF++F+ H  A  A+D++   +  G+ + +  A K+
Sbjct: 240 SKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQKK 297

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 72/182 (39%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D   +++  +Q F   G+I               + FI +  +  A  A+  LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 93  GIQIENKNIKINWAFQSQT---------------NLNDDTSFNLFIGDLNVNVDDTTLAN 137
                 + + +  A +                   L      NLFI +L+ ++DD  L +
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F          VM D +   SRG+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

Query: 198 RE 199
           +E
Sbjct: 400 KE 401

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           +S+T   + +  +L++G+L+ +V +  L + F          V  D  T+ S GY +V+F
Sbjct: 27  ESETPKVETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATK 197
             HE  + A++Q+    I G+  RI W+ +
Sbjct: 87  HDHEAGRKAIEQLNYTLIKGKPCRIMWSQR 116

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 35/82 (42%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           L+I NLD SI+++ LK  F   G I               + F+ +ST  +A  A+   N
Sbjct: 324 LFIKNLDDSIDDEKLKDEFAPFGTITSVKVMKDEAGSSRGFGFVCFSTPEEATKAITEKN 383

Query: 93  GIQIENKNIKINWAFQSQTNLN 114
              +  K + +  A + +   N
Sbjct: 384 QQLVAGKPLYVAIAQRKEVRRN 405

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 86/179 (48%), Gaps = 12/179 (6%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G +               Y ++++     A  A++ 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 91  LNGIQIENKNIKINWAFQSQTNLNDD-----------TSFNLFIGDLNVNVDDTTLANAF 139
           + G +I+ + I ++ +       N+D            S  LF+G+L+ N D   ++  F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 140 KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                 +   +    +T + +G+G+V +   E+A+ A++ +QG  I+ R +R++++T R
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 84/178 (47%), Gaps = 11/178 (6%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G I               Y ++++     A  A+Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 91  LNGIQIENKNIKINWAFQSQTNLND----------DTSFNLFIGDLNVNVDDTTLANAFK 140
           + G +I+ + I  + +       ND          + S  LF+G+L+ N D   +   F 
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFA 288

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                +   +    +T + +G+G+V F   E+A+ A+D +QG  I+ R +R+++++ R
Sbjct: 289 KHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           + Q N   +    +F+G L+ ++DD  L   F+   G + A V+++  T RSRGYG+V F
Sbjct: 157 KKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDF 216

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +    A+ A+ +MQG EI+GR I  + +T +
Sbjct: 217 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 247

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 94/198 (47%), Gaps = 16/198 (8%)

Query: 14  ENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXX 72
           E   P  AK  G   +   +++G L  SI+++ LKQ F+ + G +               
Sbjct: 162 EESSPKKAKTDGEPAT---VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRG 218

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQT------------NLNDDTSFN 120
           Y ++++     A  A++ ++G +I+ + I ++ +    T            ++  + S  
Sbjct: 219 YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDT 278

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ N D   +   F      +   +    +T + +G+G+V + + ++A+ A++ +
Sbjct: 279 LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

Query: 181 QGHEINGRAIRINWATKR 198
           QG  I+ R +R++++T +
Sbjct: 339 QGEYIDNRPVRLDYSTPK 356

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 89/206 (43%), Gaps = 26/206 (12%)

Query: 12  PVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAG------------QIXX 59
           P  N  P    +  +   + VLY+G LD S NE  +K  +   G            Q   
Sbjct: 24  PYNNYKPRYNYKQTQGKGNNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQH 83

Query: 60  XXXXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQI---ENKNIKINW---------AF 107
                        Y F+E+ST+  A+ A+   NG  I   + +  K+NW         A 
Sbjct: 84  NNAGPTEGKSNLGYCFVEFSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSAT 142

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVS 166
            ++        +++F+GDL  NV ++ L N FKS     L + ++ D  T  S+GYGF+ 
Sbjct: 143 HTENQGPQSNDYSVFVGDLGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIK 202

Query: 167 FDTHENAQAAMDQMQGHEINGRAIRI 192
           F    +   A+ +MQ   +NGR I++
Sbjct: 203 FHDQNDYNDALSKMQNKILNGRGIKV 228

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 123/323 (38%), Gaps = 56/323 (17%)

Query: 19  ASAKEG-GRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFI 76
           A+  EG   E S   LY+G+L+ +++E  L   F   G +                YA++
Sbjct: 25  ATGSEGQSVENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 84

Query: 77  EYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLA 136
            ++ +     A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+ ++D+  L 
Sbjct: 85  NFNDHEAGRKAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALY 143

Query: 137 NAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
           + F      L + +  D +   S+G+GFV F+    A+ A+D + G  +NG+ I +    
Sbjct: 144 DTFSVFGDILSSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYVAPHL 202

Query: 197 KREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAP 256
            R+                                                 +  +    
Sbjct: 203 SRKER-----------------------------------------------DSQLEETK 215

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVC 311
              T  Y+ NI    T+     +   FG I+  +   +     KG  F+ Y+ HE A   
Sbjct: 216 AHYTNLYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKA 275

Query: 312 IVALSNFQFQGRNLRTGWGKERS 334
           + AL+     G  L  G  ++++
Sbjct: 276 VEALNESDLNGEKLYVGRAQKKN 298

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 95  QIENKNIKINW---AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           Q+EN NI+ +    A  S+    +++S +L++GDL   V +  L + F          V 
Sbjct: 11  QLENLNIQDDQKQAATGSEGQSVENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVC 70

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            D  T  S GY +V+F+ HE  + A++Q+    I GR  RI W+ +
Sbjct: 71  RDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           LY+ N++    ++  ++ F   G I               + F+ Y  + DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 93  GIQIENKNIKINWAFQSQTNLN---------------DDTSFNLFIGDLNVNVDDTTLAN 137
              +  + + +  A +    ++                    NLF+ +L+  VDD  L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM   +  +S+G+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 198 RE 199
           ++
Sbjct: 400 KD 401

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 85/179 (47%), Gaps = 12/179 (6%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F+ + G I               Y ++++     A  A++ 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 91  LNGIQIENKNIKINWAFQSQTNLNDD-----------TSFNLFIGDLNVNVDDTTLANAF 139
           ++G +I+ + I  + +       N+D            S  LF+G+L+ N D   ++  F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 140 KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                 +   +    +T + +G+G+V +   E+A+ A+D +QG  I+ R +R++++T R
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPR 344

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 89/180 (49%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G I               Y ++++     A  A+Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 91  LNGIQIENK--NIKINWAFQSQTNLND----------DTSFNLFIGDLNVNVDDTTLANA 138
           + G +I+ +  N  ++ +  +  N ND          + S  LF+G+L+ N D  T+   
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFEL 261

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V F + E+++ A++ +QG  I+ R +R+++++ R
Sbjct: 262 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSSPR 321

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           + Q N        +F+G L+ ++DD  L   F+   G + A V+ +  T RSRGYG+V F
Sbjct: 130 KKQKNEESGEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDF 189

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +    A+ A+ +MQG EI+GR I  + +T +
Sbjct: 190 ENKSYAEKAIQEMQGKEIDGRPINCDLSTSK 220

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (62%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G L+ +VDD  L N F    G + A V+ +  T RSRGYG+V F+    A+ A+ +M
Sbjct: 151 LFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKEM 210

Query: 181 QGHEINGRAIRINWATKR 198
           QG EI+GR I ++ +T +
Sbjct: 211 QGKEIDGRPINVDMSTSK 228

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 83/180 (46%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            L++G L  S++++ LK  F  + G +               Y ++++     A  AL+ 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 91  LNGIQIENKNIKINWAFQSQT------------NLNDDTSFNLFIGDLNVNVDDTTLANA 138
           + G +I+ + I ++ +                 ++  + S  LF+G+L+ + D   L   
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEI 269

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V +   E+A+ A+D +QG  IN R +R++++T R
Sbjct: 270 FGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFSTPR 329

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 101/275 (36%), Gaps = 20/275 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y FIE+ +  DA   L +LN   I N               +  ++NWA  +  Q+++  
Sbjct: 119 YCFIEFDSLKDAQFGL-SLNSKPIPNFKSISTELETNPSGQRTFRLNWASGATLQSSIPT 177

Query: 116 DTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              ++LF+GDL+    +  L   F K+        VM D  T  SR +GF+        +
Sbjct: 178 TPEYSLFVGDLSPMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFERE 237

Query: 175 AAMDQMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXX 234
            A+D+M G  ++GR +R+  A  R                                    
Sbjct: 238 EALDKMNGTLLHGRQLRVALANPRNANLQEQAPSQVVEDKKKHNEPLLLETAKKLFSKEL 297

Query: 235 XXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPE 294
                      ++ ED     P   TT ++GN+    TE +L  + + FG I      P 
Sbjct: 298 LKNSSSNVNDVKSNEDHSDNDPTN-TTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPG 356

Query: 295 KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGW 329
           K C F+K+     A   +  L  +   G  +R  W
Sbjct: 357 KKCGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYA 74
           N + ++      + ++  +++GNL+  I ED L++ F+  G I                 
Sbjct: 306 NDVKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKC-----G 360

Query: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINW 105
           F+++    DA  ++  L G  +    I+I+W
Sbjct: 361 FVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           + Q N   +    +F+G L+ ++DD  L   F+   G + A V+++  T RSRGYG+V F
Sbjct: 136 KKQKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDF 195

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +    A+ A+ +MQG EI+GR I  + +T +
Sbjct: 196 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 226

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 87/180 (48%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G I               Y ++++     A  A+Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 91  LNGIQIENK--NIKINWAFQSQTNLND----------DTSFNLFIGDLNVNVDDTTLANA 138
           + G +I+ +  N  ++ +  +  N ND          + S  LF+G+L+ N D   +   
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFEL 267

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V F   E+A+ A+D +QG  I+ R +R+++++ R
Sbjct: 268 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 327

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 88/181 (48%), Gaps = 4/181 (2%)

Query: 14  ENVIPASAKEGGRETSDKV-LYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXX 71
           +N   ++  EG +  S+   LY+G+LD S++E  L   F   G +               
Sbjct: 22  QNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSL 81

Query: 72  XYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVD 131
            YA++ ++ +    VA++ LN   I+ +  +I W+ Q    L    + N+FI +LN ++D
Sbjct: 82  GYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWS-QRDPALRKKGNGNIFIKNLNADID 140

Query: 132 DTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIR 191
           +  L + F      L + +  D +   S+G+GFV F+    A+ A+D + G  +NG+ I 
Sbjct: 141 NKALYDTFSVFGNILSSKIATD-ENGNSKGFGFVHFEEEAAAKEAIDALNGMLLNGQEIY 199

Query: 192 I 192
           +
Sbjct: 200 V 200

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%)

Query: 84  ANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCP 143
           A+ A + L  + I+++      +  S+   +D  S +L++GDL+ +V +  L + F    
Sbjct: 5   ADKAAEQLEQLNIKDEQQNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIG 64

Query: 144 GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
                 V  D  T  S GY +V+F  HE  + A++++    I GR  RI W+ +
Sbjct: 65  SVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWSQR 118

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 76/179 (42%), Gaps = 8/179 (4%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+  +  ++I NL+  I+  AL   F V G I               + F+ +     A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 86  VALQTLNGIQIENKNIKINWAFQ-----SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFK 140
            A+  LNG+ +  + I +          SQ         N+++   NV +D T       
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVK--NVPLDTTEEEFKEL 240

Query: 141 SC-PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
              PG   + V+   +  + +G+GFV+++ HE+A  A++++   E  G+ + +  A K+
Sbjct: 241 FEKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 16/142 (11%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQS------------QTNLNDDTSF- 119
           + F+ Y  + DA  A++ LN  + + + + +  A +              T L     + 
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 120 --NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
             NLFI +L+ ++DD  L   F          VM   +  +S+G+GFV F + E A  A+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAI 381

Query: 178 DQMQGHEINGRAIRINWATKRE 199
            +     + G+ + +  A ++E
Sbjct: 382 TEKNQQIVAGKPLYVAIAQRKE 403

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 295 KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKER 333
           KG  F+ Y+ HE A   +  L+N +F+G+ L  G  +++
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 88/189 (46%), Gaps = 12/189 (6%)

Query: 20  SAKEGGRETSDKVLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEY 78
           S    G +  D  +Y+GN+D SI ++ L + F Q++                  YAFI++
Sbjct: 2   SGSGSGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDF 61

Query: 79  STNHDANVALQTL-NGIQIENKNIKI-----NWAFQSQTNLNDDTSF----NLFIGDLNV 128
            T  DAN A+Q   N +Q+ N+ +K+     N + +S TNL+  TS      +F+ +L+ 
Sbjct: 62  YTEEDANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDS 121

Query: 129 NVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGR 188
           +VD   L+  FK      +   ++ +     R   +V F  +E A  A+  + G  +  +
Sbjct: 122 SVDVAYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNK 180

Query: 189 AIRINWATK 197
            I I +A K
Sbjct: 181 RINIEYAFK 189

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G L+ ++DD  L   F+   G L A V+++  T RSRGYG+V F     A+ A+ +M
Sbjct: 163 IFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKEM 222

Query: 181 QGHEINGRAIRINWATKR 198
           QG EI+GR I  + +T +
Sbjct: 223 QGKEIDGRPINCDMSTSK 240

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 85/179 (47%), Gaps = 12/179 (6%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F+ + G +               Y ++++     A  A++ 
Sbjct: 162 TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKE 221

Query: 91  LNGIQIENKNIKINWAF-QSQTNLND----------DTSFNLFIGDLNVNVDDTTLANAF 139
           + G +I+ + I  + +  +  +N  D          + S  LF+G+L+ + D   +   F
Sbjct: 222 MQGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVF 281

Query: 140 KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                 +   +    +T + +G+G+V +   E+A+ A+D +QG  IN R +R++++T R
Sbjct: 282 SKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFSTPR 340

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (61%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G L+ ++DD  L   F+   G + A VM++  T RSRGYG+V F+    A+ A+ +M
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 181 QGHEINGRAIRINWATKR 198
            G EI+GR I  + +T +
Sbjct: 258 HGKEIDGRPINCDMSTSK 275

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/181 (19%), Positives = 82/181 (45%), Gaps = 13/181 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F+ + G I               Y ++++     A  A++ 
Sbjct: 197 TIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 91  LNGIQIENKNIKINWAFQSQT------------NLNDDTSFNLFIGDLNVNVDDTTLANA 138
           ++G +I+ + I  + +                 ++  + S  LF+G+L+   D   L   
Sbjct: 257 MHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEI 316

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V + + E+A  A + +QG  IN R +R++++  +
Sbjct: 317 FGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYSIPK 376

Query: 199 E 199
           +
Sbjct: 377 Q 377

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 88/181 (48%), Gaps = 14/181 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK+ F+ + G I               Y ++++     A  A+Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 91  LNGIQIENK--NIKINWAFQSQTNLNDDT-----------SFNLFIGDLNVNVDDTTLAN 137
           + G +I+ +  N  I+ +  +  N N+D            S  LF+G+L+ N D  T+  
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 257

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F      +   +    +T + +G+G+V +   ++A+ A+D +QG  I+ R +R+++++ 
Sbjct: 258 MFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSSP 317

Query: 198 R 198
           R
Sbjct: 318 R 318

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 51/91 (56%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           + Q N        +F+G L+ ++DD  L   F+   G + A V+ +  T RSRGYG+V F
Sbjct: 126 KKQKNEESQEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDF 185

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +    A+ A+ +MQG EI+GR I  + +T +
Sbjct: 186 ENQSYAEKAIQEMQGKEIDGRPINCDISTSK 216

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDAN 85
           E SD  L++GNL  + + D + + F   G++                + +++Y+   DA 
Sbjct: 236 EPSD-TLFLGNLSFNADRDTIFEMFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAK 294

Query: 86  VALQTLNGIQIENKNIKINWA 106
            AL  L G  I+N+ ++++++
Sbjct: 295 KALDALQGEYIDNRPVRLDYS 315

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/313 (19%), Positives = 121/313 (38%), Gaps = 55/313 (17%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           ETS   LY+G L+ +++E  L   F   G +                YA++ +  +    
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ K  +I W+ Q   +L    S N++I +L+  +D+ +L   F +    
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXX 205
           L   V  D +   SRG+GFV F+   +A+ A++ + G  +N + + +     +       
Sbjct: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSK------- 204

Query: 206 XXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIG 265
                        ++R                           +  +     + T  Y+ 
Sbjct: 205 -------------KDR---------------------------QSKLEEVKAKFTNVYVK 224

Query: 266 NIPHFATEPDLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAVCIVALSNFQF 320
           NI    ++ +   L   +G I       +     +G  F+ ++ H  AA  +  L+  +F
Sbjct: 225 NIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284

Query: 321 QGRNLRTGWGKER 333
           +G+ L  G  +++
Sbjct: 285 KGQKLYVGRAQKK 297

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 78/182 (42%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D+  +++  ++ F   G+I               + F+ +  +  A  A+  LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTS---------------FNLFIGDLNVNVDDTTLAN 137
            ++ + + + +  A +    L +                   NLF+ +L+ ++DD  L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM D +T  SRG+GFV F T E A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 198 RE 199
           +E
Sbjct: 400 KE 401

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           +S+T   + +  +L++G+L   V +  L + F          V  D  T+ S GY +V+F
Sbjct: 27  ESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATK 197
             HE    A++Q+    I G+  RI W+ +
Sbjct: 87  HDHEAGPKAIEQLNYTLIKGKPCRIMWSQR 116

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 36/82 (43%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           L++ NLD SI+++ LK+ F   G I               + F+ +ST  +A  A+   N
Sbjct: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383

Query: 93  GIQIENKNIKINWAFQSQTNLN 114
              +  K + +  A + +   N
Sbjct: 384 QQIVAGKPLYVAIAQRKEVRRN 405

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G L+ ++DD  L N F    G + A VM +  T RSRGYG+V F     A+ A+ +M
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 181 QGHEINGRAIRINWATKR 198
            G EI+GR I  + +T +
Sbjct: 219 HGKEIDGREINCDMSTSK 236

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 85/181 (46%), Gaps = 14/181 (7%)

Query: 32  VLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F  + G I               Y ++++S    A  A++ 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 91  LNGIQIENKNIKINWAFQSQTNLND-------------DTSFNLFIGDLNVNVDDTTLAN 137
           ++G +I+ + I  + +       N+             + S  LF+G+L+ N D  ++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F      +   +    +T + +G+G+V +   ++A+ A++ +QG  I+ R +R++++T 
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYSTP 337

Query: 198 R 198
           +
Sbjct: 338 K 338

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 83/180 (46%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F  + G +               Y ++++     A  A++ 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 91  LNGIQIENKNIKINWAFQSQT------------NLNDDTSFNLFIGDLNVNVDDTTLANA 138
           ++G +I+ + I  + +                 +L  + S  LF+G+L+ N D   +   
Sbjct: 248 MHGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEM 307

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V +   ++A+ A+D +QG  I+ R +R++++T R
Sbjct: 308 FSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYSTPR 367

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           + L++GNL  + + D + + F   G+I                + +++Y    DA  AL 
Sbjct: 288 ETLFLGNLSFNADRDNIYEMFSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALD 347

Query: 90  TLNGIQIENKNIKINWAFQSQTN 112
            L G  I+N+ ++++++     N
Sbjct: 348 ALQGEYIDNRPVRLDYSTPRPNN 370

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 3/167 (1%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           E ++  LY+G LD +I E  L   F   G I                YA++ Y+      
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A+Q LN  +I  +  +I W+ +    +    S N+FI +L+  +D+  L   F +    
Sbjct: 106 KAIQELNYAEINGRPCRIMWS-ERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEV 164

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
           L   V  D +   SRG+GFV F    +A+ A++ + G  +NG  + +
Sbjct: 165 LSCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +Y+ N+D    ++  +Q F   G+I               + F+ +  ++ A  A++ LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 93  GIQIENKNIKINWAFQS------------QTNLNDDTSF---NLFIGDLNVNVDDTTLAN 137
           G + +++ + +  A +             Q  L     F   NLFI +L+ ++DD  L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F        A VM D Q   S+G+GFV F + E A  AM +     + G+ + +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 198 RE 199
           ++
Sbjct: 412 KD 413

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 78/178 (43%), Gaps = 6/178 (3%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL  +I+  AL + F   G++               + F+ +    DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLND----DTSF-NLFIGDLNVNVDDTTLANAFK 140
            A++ +NG+ +    + +      +  ++       +F N+++ +++V   D      F 
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
                + A +  D +  + +G+GFV+F  H  A  A++++ G E   +A+ +  A K+
Sbjct: 253 QYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK 309

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           +L++G+L+ N+ +  L + F          V  D  T  S GY +V++  +E  + A+ +
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 180 MQGHEINGRAIRINWATK 197
           +   EINGR  RI W+ +
Sbjct: 111 LNYAEINGRPCRIMWSER 128

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 3/167 (1%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDAN 85
           E S   LY+G LD S+ E  L   F   G +                YA++ +  ++   
Sbjct: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            A++ LN   I+ +  +I W+ Q   +L    S N+FI +L+  +D+  L + F      
Sbjct: 96  TAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNI 154

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
           L   +  D +T +SR +GFV F+  E A+ A+D + G  +NG  + +
Sbjct: 155 LSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 84/205 (40%), Gaps = 22/205 (10%)

Query: 16  VIPASAKEGGRETSDKV------LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXX 69
           V P  +K+  +   D+V      +Y+ N+D    +D  ++ F   G I            
Sbjct: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259

Query: 70  XXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLND-----DTS------ 118
              + F+ +  ++ A  A++ LN      + + +  A +    L +     ++S      
Sbjct: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319

Query: 119 ----FNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
                NLF+ +L+ ++DD  L   F          VM D   S S+G+GFV F T E A 
Sbjct: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDAGS-SKGFGFVCFSTPEEAT 378

Query: 175 AAMDQMQGHEINGRAIRINWATKRE 199
            A+ +     + G+ + +  A ++E
Sbjct: 379 KAITEKNQQIVAGKPLYVAIAQRKE 403

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 53/109 (48%)

Query: 89  QTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
           + L  ++I+++      +  S++   + +S +L++G+L+ +V +  L + F         
Sbjct: 10  EQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSI 69

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            V  D  T  S GY +V+F  H     A++++    I GR  RI W+ +
Sbjct: 70  RVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 79/181 (43%), Gaps = 12/181 (6%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL  +I+  AL   F V G I               + F+ +     A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 86  VALQTLNGIQIENKNIKINWAFQS---QTNLNDDTS--FNLFIGDLNVNVDDTTLANAFK 140
            A+  +NG+ +    + +         Q+ L++  S   N+++     N+D  T  + F+
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVK----NIDPETKQDEFE 238

Query: 141 ---SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
              S  G + + V+      + RG+GFV+F+ H  A  A++++   + NG+ + +  A K
Sbjct: 239 KLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298

Query: 198 R 198
           +
Sbjct: 299 K 299

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G L+ N+DD  L N F+   G   A V+++  ++RSRGYG+V F     A+ A+ +M
Sbjct: 238 IFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKEM 297

Query: 181 QGHEINGRAIRINWATKR 198
            G E++GR I  + +T +
Sbjct: 298 HGKELDGRPINCDMSTSK 315

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 95/207 (45%), Gaps = 13/207 (6%)

Query: 5   QPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXX 63
           +PS+    V+     S+K+         +++G L  +I++  LK  F+ + G        
Sbjct: 210 KPSKRKAEVDEEQEESSKKAKLSGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIY 269

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQT------------ 111
                    Y +++++    A  A++ ++G +++ + I  + +    T            
Sbjct: 270 ERGSTRSRGYGYVDFTDKSYAEKAVKEMHGKELDGRPINCDMSTSKPTVNPREDRAKRFG 329

Query: 112 NLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHE 171
           ++  + S  LF+G+L+ N D   +   F      +   +    +T + +G+G+V + + +
Sbjct: 330 DMPSEPSDTLFLGNLSFNADRDQIYELFSPHGEVISVRIPTHPETEQPKGFGYVQYASVD 389

Query: 172 NAQAAMDQMQGHEINGRAIRINWATKR 198
           +AQ A++ +QG  I+ R +R++++T +
Sbjct: 390 SAQKALETLQGEYIDNRPVRLDFSTPK 416

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ T  DA  AL +LN   + N               +  ++NWA  +  Q+++  
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 98  NKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTS 157
           N N++ N    S T  +D T+  +F+G L     +  L + FK     L   +       
Sbjct: 338 NSNVRANEFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI------P 391

Query: 158 RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
             +  GFV F+   +A+A++  +QG  + G  IR++W 
Sbjct: 392 NGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +     E  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 317 NFQFQGRNLRTGWGKERST 335
            F   G  +R  WG+  S+
Sbjct: 416 GFIVGGSPIRLSWGRPSSS 434

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%)

Query: 114 NDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENA 173
           ND  +  +F+G L+ +VDD  L N F+     + A V+++  T RSRGYG+V F +   A
Sbjct: 173 NDGETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAA 232

Query: 174 QAAMDQMQGHEINGRAIRINWATKR 198
           + A+ +M G +I+GR I  + +T +
Sbjct: 233 ERAVKEMHGKQIDGREINCDMSTSK 257

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 83/180 (46%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  S++++ LK  F+  G  I               Y ++++S+   A  A++ 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 91  LNGIQIENKNIKINWAFQSQTNLN------------DDTSFNLFIGDLNVNVDDTTLANA 138
           ++G QI+ + I  + +       N               S  LF+G+L+ N D   +   
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYEL 298

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V +    +AQ+A+D +QG  I+ R +R++++T +
Sbjct: 299 FSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFSTPK 358

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 86/180 (47%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  S++++ LK  F  + G +               Y ++++     A  A++ 
Sbjct: 168 TIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKE 227

Query: 91  LNGIQIENKNIKINWAF--------QSQTNLNDDT----SFNLFIGDLNVNVDDTTLANA 138
           ++G +I+ + I  + +         + +     DT    S  LF+G+L+ N D   L   
Sbjct: 228 MHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFEL 287

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    ++++ +G+G+V + + E AQAA+D +QG  I+ R +RI++++ R
Sbjct: 288 FSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRIDFSSPR 347

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ T  DA  AL +LN   + N               +  ++NWA  +  Q+++  
Sbjct: 129 YCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSSIPS 187

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 317 NFQFQGRNLRTGWGKERST 335
            F   G  +R  WG+  S+
Sbjct: 413 GFIVGGSPIRLSWGRPSSS 431

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 6/89 (6%)

Query: 107 FQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVS 166
             S T   D T+  +F+G L     +  L + FK     L   +         +  GFV 
Sbjct: 344 LPSHTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGKNCGFVK 397

Query: 167 FDTHENAQAAMDQMQGHEINGRAIRINWA 195
           F+   +A+A++  +QG  + G  IR++W 
Sbjct: 398 FEKRIDAEASIQGLQGFIVGGSPIRLSWG 426

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ T  DA  AL +LN   + N               +  ++NWA  +  Q+++  
Sbjct: 130 YCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 188

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 189 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERR 248

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GRA+R+ +AT R
Sbjct: 249 RALIEMSGKWFQGRALRVAYATPR 272

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 317 NFQFQGRNLRTGWGKERST 335
            F   G  +R  WG+  S+
Sbjct: 417 GFIVGGSPIRLSWGRPSSS 435

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 100 NIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRS 159
           N+++N +  S T   D T+  +F+G L     +  L + FK     L   +         
Sbjct: 341 NMRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNG 394

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           +  GFV F+   +A+A++  +QG  + G  IR++W 
Sbjct: 395 KNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 45/72 (62%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V + TL   F   P F+ A V  D  T +S G+G+++F+  E A+ AM+++
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 181 QGHEINGRAIRI 192
              ++NGR IRI
Sbjct: 153 NYTDVNGREIRI 164

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ T  DA  AL +LN   + N               +  ++NWA  +  Q+++  
Sbjct: 129 YCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 187

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 188 TPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDERR 247

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GRA+R+ +AT R
Sbjct: 248 RALIEMSGKWFQGRALRVAYATPR 271

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 87  ALQTLNGIQI---ENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCP 143
           ALQ ++ + +    N N++ N +  S T   D T+  +F+G L     +  L + FK   
Sbjct: 324 ALQNVHSVHLNESSNSNMRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPFG 383

Query: 144 GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
             L   +         +  GFV F+   +A+A++  +QG  + G  IR++W 
Sbjct: 384 PILNVRI------PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 317 NFQFQGRNLRTGWGKERST 335
            F   G  +R  WG+  S+
Sbjct: 416 GFIVGGSPIRLSWGRPSSS 434

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 67/144 (46%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ T  DA   L +LN   + N               +N ++NWA  +  Q+++  
Sbjct: 160 YCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSSIPS 218

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFK-SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F+          VM D  T  SR +GFV F   E  +
Sbjct: 219 RPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 278

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 279 RALVEMNGVWCQGRCLRVAYATPR 302

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFD 168
           +Q    D  +  +FIG L   +++  L   F      L   +       + +  GFV F+
Sbjct: 411 AQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKI------PQGKNCGFVKFE 464

Query: 169 THENAQAAMDQMQGHEINGRAIRINWA 195
              +A+AA+  MQG  + G  IR++W 
Sbjct: 465 KRIDAEAAIQGMQGFVVGGCPIRLSWG 491

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 31/75 (41%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +     E  L  L   FG IL       K C F+K++    A   I  + 
Sbjct: 418 PNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQ 477

Query: 317 NFQFQGRNLRTGWGK 331
            F   G  +R  WG+
Sbjct: 478 GFVVGGCPIRLSWGR 492

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 5/88 (5%)

Query: 19  ASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEY 78
           +SA+    + ++  ++IG L   INE+ L+  F   G I                 F+++
Sbjct: 409 SSAQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNI-----LTVKIPQGKNCGFVKF 463

Query: 79  STNHDANVALQTLNGIQIENKNIKINWA 106
               DA  A+Q + G  +    I+++W 
Sbjct: 464 EKRIDAEAAIQGMQGFVVGGCPIRLSWG 491

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 3/161 (1%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LY+G LD S+ E  L   F   G +                YA++ +  ++    A++ L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N   I+ +  +I W+ Q   +L    S N+FI +L+  +D+  L + F      L   + 
Sbjct: 102 NYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
            D +T +SR +GFV F+  E A+ A+D + G  +NG  + +
Sbjct: 161 TD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 84/205 (40%), Gaps = 22/205 (10%)

Query: 16  VIPASAKEGGRETSDKV------LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXX 69
           V P  +K+  +   D+V      +Y+ N+D    ++  ++ F   G I            
Sbjct: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGK 259

Query: 70  XXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLND-----DTS------ 118
              + F+ +  ++ A  A + LN    + + + +  A +    L +     ++S      
Sbjct: 260 LRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319

Query: 119 ----FNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
                NLF+ +L+ +VDD  L   F          VM D +   S+G+GFV F T E A 
Sbjct: 320 KYQGVNLFVKNLDDSVDDQKLEEEFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEAT 378

Query: 175 AAMDQMQGHEINGRAIRINWATKRE 199
            A+ +     + G+ + +  A ++E
Sbjct: 379 KAITEKNQQIVAGKPLYVAIAQRKE 403

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           L++G+L+ +V +  L + F          V  D  T  S GY +V+F  H   + A++++
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 181 QGHEINGRAIRINWATK 197
               I GR  RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 12/181 (6%)

Query: 26  RETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           R+     ++I NL  +I+  AL   F V G I               + F+ +     A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 86  VALQTLNGIQIENKNIKINWAFQS---QTNLNDDTS--FNLFIGDLNVNVDDTTLANAFK 140
            A+  +NG+ +    + +         Q+ L++  S   N+++     N+D  T    F+
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVK----NIDSETTQEEFE 238

Query: 141 ---SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
              S  G + + V+      + RG+GFV+F+ H  A  A +++   +  G+ + +  A K
Sbjct: 239 KMFSNYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQK 298

Query: 198 R 198
           +
Sbjct: 299 K 299

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G L+ +VDD  L   F+   G + A V+ +  T RSRGYG+V F+    A+ A+ +M
Sbjct: 258 IFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEM 317

Query: 181 QGHEINGRAIRINWATKR 198
            G EI+GR I  + +T +
Sbjct: 318 HGKEIDGRPINCDMSTSK 335

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 86/180 (47%), Gaps = 13/180 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQ-VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  S++++ LK  F+ + G I               Y ++++     A  A++ 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 91  LNGIQIENKNIKINWAFQSQTN--LND------DT----SFNLFIGDLNVNVDDTTLANA 138
           ++G +I+ + I  + +         ND      DT    S  LF+G+L+ N D   +   
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFET 376

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T++ +G+G+V + + + AQ A + +QGH I+ R +R++++T +
Sbjct: 377 FAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTPK 436

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 82/181 (45%), Gaps = 13/181 (7%)

Query: 32  VLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            +++G L  SI+++ LK  F  + G +               Y ++++   H A  A++ 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 91  LNGIQIENKNIKINWAFQSQTNLNDD------------TSFNLFIGDLNVNVDDTTLANA 138
           ++G +I+ + I  + +         D             S  LF+G+L+ N D   L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F      +   +    +T + +G+G+V + + ++A+ A + +QG  I+ R +R++++  R
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPR 353

Query: 199 E 199
           +
Sbjct: 354 Q 354

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
            L++GNL  + + D L + F   G+ I               + +++Y +  DA  A + 
Sbjct: 275 TLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEA 334

Query: 91  LNGIQIENKNIKINWAFQSQTN 112
           L G  I+N+ ++++++   Q N
Sbjct: 335 LQGEYIDNRPVRLDYSIPRQNN 356

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (62%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V + TL + F   P F+ A V  D  + +S G+G+++F+  E A  AM+++
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 181 QGHEINGRAIRI 192
              E+NG+ IRI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 65/159 (40%), Gaps = 5/159 (3%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IG+L +++ E+ LK  F +    +               + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N  ++  K I+I  + ++ T    +   N+F  +L +N    T   AF     F +   +
Sbjct: 153 NYTEVNGKEIRIMPSLRN-TTFRKNFGTNVFFSNLPLNNPQLT-TRAFYDT--FSRYGKI 208

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +    +  GFV F+  + A+  +         G+ I
Sbjct: 209 LSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ +  DA  AL +LN   + N               +N ++NWA  +  Q+++  
Sbjct: 141 YCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSSIPS 199

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFK-SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F+          VM D  T  SR +GFV F   E  +
Sbjct: 200 RPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERR 259

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 260 RALVEMNGVWCQGRCLRVAYATPR 283

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 32/76 (42%)

Query: 256 PPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVAL 315
           PP  TT +IG +     E  L  L   FG IL       K C F+KY+    A   I  +
Sbjct: 382 PPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQGM 441

Query: 316 SNFQFQGRNLRTGWGK 331
             F   G  +R  WG+
Sbjct: 442 QGFIVGGNPVRLSWGR 457

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +FIG L   +++  L   F      L   +       + +  GFV ++   +A+AA+  M
Sbjct: 388 VFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYENRIDAEAAIQGM 441

Query: 181 QGHEINGRAIRINWA 195
           QG  + G  +R++W 
Sbjct: 442 QGFIVGGNPVRLSWG 456

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 31/77 (40%), Gaps = 5/77 (6%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           +  ++IG L   INE  L+  F   G I                 F++Y    DA  A+Q
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNC-----GFVKYENRIDAEAAIQ 439

Query: 90  TLNGIQIENKNIKINWA 106
            + G  +    ++++W 
Sbjct: 440 GMQGFIVGGNPVRLSWG 456

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 72/138 (52%), Gaps = 12/138 (8%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTN--LND------DT----SFN 120
           Y ++++     A  A++ ++G +I+ + I ++ +         ND      DT    S  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ N +   +   F      +   +    +T++ +G+G+V + + ENAQ A+D +
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 181 QGHEINGRAIRINWATKR 198
           QGH I+ R +R++++T +
Sbjct: 131 QGHYIDNRPVRLDFSTPK 148

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%)

Query: 156 TSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           T RSRGYG+V F+    A+ A+ +M G EI+GR I ++ +T +
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 60.8 bits (146), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 104/289 (35%), Gaps = 39/289 (13%)

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTN---LNDDT--------------- 117
           +EYS +HD   A++  NG     + I     F  Q N   ++D                 
Sbjct: 4   VEYSNSHDVEEAIRRFNGANFMQREI-----FVRQDNPPPVSDRRERRGTVPTPRRAYYG 58

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
            F +F+ +L  +++   L + FK C   + A V  D     SRG+G V   T +N  AA+
Sbjct: 59  GFEIFVANLPYSINWQALKDMFKECGDVIHADVSVDAD-GYSRGFGTVYVATKDNQLAAI 117

Query: 178 DQMQGHEINGRAIRINWATKREXXXXXXXXX-----XXXXXXXXQVRNRXXXXXXXXXXX 232
            +  G EI GR + +      E                        R++           
Sbjct: 118 KKWNGFEIEGRVLEVRKGKGSESVSGSRGDSYIPKGDGVSDSHRDNRHKSNLDTEDRFSG 177

Query: 233 XXXXXXXXXXXXXQAVED--MIRRAPP---RVTTAYIGNIPHFATEPDLIPLLQNFGFIL 287
                          V D     +A P   R    Y  N+P    E DL  L +  G ++
Sbjct: 178 SLETPQEESNTASNVVPDTAFTSKAGPGGERSRIIYCENMPPATVESDLYDLFETIGKVV 237

Query: 288 DFT-HYPE----KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGK 331
             +  Y E    KG    +++T E A  CI  L+N+ + G +L+  + K
Sbjct: 238 RASLKYDEEGNSKGVSVCEFETTEDAEECIQRLNNYHYGGCDLKISYAK 286

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 47/111 (42%), Gaps = 9/111 (8%)

Query: 1   MSDQQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXX 60
           +SD++     VP     P  A  GG E     +++ NL  SIN  ALK  F+  G +   
Sbjct: 39  VSDRRERRGTVPT----PRRAYYGGFE-----IFVANLPYSINWQALKDMFKECGDVIHA 89

Query: 61  XXXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQT 111
                       +  +  +T  +   A++  NG +IE + +++     S++
Sbjct: 90  DVSVDADGYSRGFGTVYVATKDNQLAAIKKWNGFEIEGRVLEVRKGKGSES 140

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 67/146 (45%), Gaps = 23/146 (15%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQSQTNLNDDT 117
           Y F+E++   DA  AL +LN   I N               +N ++NWA  S   LN   
Sbjct: 131 YCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNNNRNFRLNWA--SGATLNSSI 187

Query: 118 S----FNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHEN 172
                F+LF+GDL+  V +  L + F K         VM D  T  SR +GF+ F     
Sbjct: 188 PLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDELE 247

Query: 173 AQAAMDQMQGHEINGRAIRINWATKR 198
            + A+ +M G   NGR +R+ +AT R
Sbjct: 248 RKNALIEMNGIWCNGRPLRVAYATPR 273

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+    DA  AL TLN   + N               ++ ++NWA  +  Q+ +  
Sbjct: 114 YCFVEFQKLEDAQWAL-TLNSTPLPNILSNSTHSQTNPTLQRSFRLNWASGATLQSAIPS 172

Query: 116 DTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+ +  +  L + F K+        VM D  T  SR +GFV F   +  +
Sbjct: 173 TPEFSLFVGDLSPSATEAHLLSLFQKNFKSVKTVRVMTDPITGASRCFGFVRFADEQERR 232

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 233 RALVEMNGVWCQGRCLRVAYATPR 256

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P+ TT +IG +    +EP L  L   FG I +      KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 317 NFQFQGRNLRTGWGKE 332
            F   G  +R  WG+ 
Sbjct: 424 GFIVGGNPIRLSWGRS 439

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +FIG L   + +  L + F      L    + +++  + +G GFV F++  +A+AA+  M
Sbjct: 369 VFIGGLASQISEPQLYSLF------LPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGM 422

Query: 181 QGHEINGRAIRINWA 195
           QG  + G  IR++W 
Sbjct: 423 QGFIVGGNPIRLSWG 437

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDLN +V   TL + F   P F+ A V +D QT+ S G+G+++F   E+A+ A+D  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 181 QGHEINGRAIRI 192
              ++  + IRI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 17/180 (9%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           +  +++ NL  SI  + ++ +F   G I               +AF++YST   A  A++
Sbjct: 310 ENTVFVSNLPTSITVEEIRNHFNKIGNIMNLFISDKISSNAL-WAFVKYSTAACAIRAIK 368

Query: 90  TLNGIQIENKNIKINWAF---QSQTNLNDD-TSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
            LN   I  K I ++ AF   ++Q +L+   T   L++ +L+  + D    + F  C   
Sbjct: 369 ELNNTFIRKKQIVVSQAFRRGETQFHLSRKPTKRILYLKELS-RICDKDFVSQF--CH-- 423

Query: 146 LQAHVMWD------MQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
            Q  + +D      +   +S     +   T E+A+   + +    I G  I+ +W    E
Sbjct: 424 -QRRIKFDEISLTKVNLEKSTHTARIKCRTDEDARKLYNSINNRLIAGSIIKASWENSNE 482

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 67/159 (42%), Gaps = 4/159 (2%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IG+L++ + ++ L+  F V    +               + ++ +    DA  A+   
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N +++ +K I+I  + + + N       N+F    N+  +D  L ++ K    F Q   +
Sbjct: 163 NCMKLGDKVIRIMPSLRGK-NTKKSIGTNVFFT--NLPDEDNRLFHSRKFFEIFRQFGKI 219

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +   ++  GF+SF+  E A+  + +       G  I
Sbjct: 220 LSCRLDPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRI 258

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+++ +  +A   LQ LN   + N               +N ++NWA  +  Q+++  
Sbjct: 101 YCFVQFPSLQEAQAGLQ-LNSTPLPNLISSTTHNPTNPTAKRNFRLNWASGATLQSDIPT 159

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 160 TPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEQERR 219

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 220 RALVEMNGIWCQGRQLRVAYATPR 243

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG + +  TE  L  L   FG IL     P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 317 NFQFQGRNLRTGWGK 331
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D ++  +FIG LN  + ++ L + F      L   V         +G GFV F+   +A+
Sbjct: 394 DPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAE 447

Query: 175 AAMDQMQGHEINGRAIRINWA 195
           AA+  MQG  +   AIR++W 
Sbjct: 448 AAIQGMQGFIVGNSAIRLSWG 468

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 15  NVIPASAKE--GGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX 72
           N +P   +   G  + S+  ++IG L+  I E  L+  F   G I               
Sbjct: 380 NTLPMVTRPVPGYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKG----- 434

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
             F+++    DA  A+Q + G  + N  I+++W 
Sbjct: 435 CGFVKFEHRLDAEAAIQGMQGFIVGNSAIRLSWG 468

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 81/220 (36%), Gaps = 27/220 (12%)

Query: 119 FNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMD 178
           F +F+ +L  +V+   L + FK C   L+A V  D    RSRG+G V F   E+ + A+D
Sbjct: 242 FEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRAID 300

Query: 179 QMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXX 238
              G+EI GR + +    +                     RN                  
Sbjct: 301 DYNGYEIEGRRLDVREGYR-------------------NSRNGNRNGADETNKDSNETEA 341

Query: 239 XXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFIL------DFTHY 292
                      +       R    Y  N+P      DL  L +  G ++      D  + 
Sbjct: 342 QAQSNSTVDFTEGYISGDERNNFIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQ 401

Query: 293 PEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKE 332
           P  G   I+Y+  E A VCI  L+N+ + G +L   + K+
Sbjct: 402 P-TGVAVIEYENIEDADVCIERLNNYNYGGCDLVISYAKK 440

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/198 (16%), Positives = 78/198 (39%), Gaps = 34/198 (17%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  S+N  ALK  F+  G +               +  + +S   D   A+   N
Sbjct: 244 IFVANLPFSVNWQALKDMFKPCGNVLRADVELDHVGRSRGFGTVLFSNQEDMRRAIDDYN 303

Query: 93  GIQIENKNIKINWAFQSQTNLN----DDTSFN---------------------------- 120
           G +IE + + +   +++  N N    D+T+ +                            
Sbjct: 304 GYEIEGRRLDVREGYRNSRNGNRNGADETNKDSNETEAQAQSNSTVDFTEGYISGDERNN 363

Query: 121 -LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
            ++  +L  + D + L + F++    + A + +D   ++  G   + ++  E+A   +++
Sbjct: 364 FIYCSNLPFSTDRSDLYDLFETIGKVINAELRYD-SANQPTGVAVIEYENIEDADVCIER 422

Query: 180 MQGHEINGRAIRINWATK 197
           +  +   G  + I++A K
Sbjct: 423 LNNYNYGGCDLVISYAKK 440

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F++++   +A   LQ LN   + N               +N ++NWA  +  Q+++  
Sbjct: 100 YCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKRNFRLNWASGATLQSDIPA 158

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F++         VM D  T  SR +GFV F   +  +
Sbjct: 159 TPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERR 218

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 219 RALAEMNGVWCQGRQLRVAYATPR 242

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%)

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQ 319
           TT +IG + +  +E  L  L   FG IL     P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 320 FQGRNLRTGWGK 331
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D  +  +FIG L+  + +  L   F      L   V         RG GFV F+   +A+
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAE 375

Query: 175 AAMDQMQGHEINGRAIRINWA 195
           AA+  MQG  + G AIR++W 
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWG 396

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 14  ENVIP-ASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX 72
            N +P A+ ++   +T++  ++IG L   I+E  L   F   G I               
Sbjct: 308 SNSLPLAAPRQLPADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRG----- 362

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
             F+ +    DA  A+Q + G  +    I+++W 
Sbjct: 363 CGFVRFENRMDAEAAIQGMQGFIVGGNAIRLSWG 396

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 66/144 (45%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ +  DA   L  LN   + N               +  ++NWA  +  Q+++  
Sbjct: 172 YCFVEFESQKDAQEGL-ALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPT 230

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKS-CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              ++LF+GDL+    +  L + F++         VM D  T  SR +GFV F   E  +
Sbjct: 231 TPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 290

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 291 RALIEMNGVHFQGRTLRVAYATPR 314

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT ++G +     E  L  + Q FG IL     P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 317 NFQFQGRNLRTGWGK 331
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 263 YIGNIPHFATEPDLIPLLQN-------FGFILDFTHYPEKGCCFIKYDTHEQAAVCIVAL 315
           ++G++   ATE DL+ L Q           + D      +   F+++   E+    ++ +
Sbjct: 237 FVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEM 296

Query: 316 SNFQFQGRNLRTGWGKERSTFI 337
           +   FQGR LR  +   RST +
Sbjct: 297 NGVHFQGRTLRVAYATPRSTTV 318

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D T+  +F+G L   V +  L   F+     L       ++    +  GFV F+   +A+
Sbjct: 463 DPTNTTVFVGGLGPTVQEQQLRKIFQPFGNIL------SIKIPPGKNCGFVKFEHKIDAE 516

Query: 175 AAMDQMQGHEINGRAIRINWA 195
           AA+  +QG  +    IR++W 
Sbjct: 517 AAIQGLQGFVLVENPIRLSWG 537

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANV 86
           + ++  +++G L  ++ E  L++ FQ  G I                 F+++    DA  
Sbjct: 463 DPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNC-----GFVKFEHKIDAEA 517

Query: 87  ALQTLNGIQIENKNIKINWA 106
           A+Q L G  +    I+++W 
Sbjct: 518 AIQGLQGFVLVENPIRLSWG 537

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 20/145 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN----------------KNIKINWAFQS--QTNLN 114
           Y F+E+ +  DA  AL TLN   I N                +  ++NWA  +   + + 
Sbjct: 96  YCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRKFRLNWANGATLHSTIL 154

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQ-AHVMWDMQTSRSRGYGFVSFDTHENA 173
               F+LF+GDL+    +  L + F++    ++   VM D  T  SR +GFV F      
Sbjct: 155 PTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETER 214

Query: 174 QAAMDQMQGHEINGRAIRINWATKR 198
           + A+ +M G +  GR +R+ +AT R
Sbjct: 215 RNALIEMNGVQFQGRQLRVAYATPR 239

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%)

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQ 319
           TT ++G +     E  L  L + FG I D    P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 320 FQGRNLRTGWGK 331
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 117 TSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAA 176
           +S  +F+G LN N+++  L   FK          + D++    +  GFV ++    A+AA
Sbjct: 443 SSTTVFVGGLNPNINELQLFELFKPF------GTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 177 MDQMQGHEINGRAIRINWA 195
           ++ +QG  I G  IR++W 
Sbjct: 497 INGLQGFIIMGSPIRLSWG 515

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 261 TAYIGNIPHFATEPDLIPLLQN-------FGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 313
           + ++G++  FATE DL+ L Q           + D      +   F+++    +    ++
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 314 ALSNFQFQGRNLRTGWGKER 333
            ++  QFQGR LR  +   R
Sbjct: 220 EMNGVQFQGRQLRVAYATPR 239

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 28  TSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVA 87
            S   +++G L+ +INE  L + F+  G I                 F++Y+   +A  A
Sbjct: 442 VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQC-----GFVKYNERLEAEAA 496

Query: 88  LQTLNGIQIENKNIKINWA 106
           +  L G  I    I+++W 
Sbjct: 497 INGLQGFIIMGSPIRLSWG 515

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (48%), Gaps = 12/109 (11%)

Query: 84  ANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCP 143
            N+  QT N    E K IKI         L    +F+LFIGDL+  V    L N F   P
Sbjct: 28  VNLYGQTTN---YEGKKIKI---------LESGETFSLFIGDLHPKVTQEILENIFGKYP 75

Query: 144 GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
            FL A V +D +T  S G+G+++F +  +++ A+D      +    IR+
Sbjct: 76  SFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 24/178 (13%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++GNL      + LK+YF   G++                  +E++   D + A++  +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSRGHHRGM-GTVEFTNADDVDEAIRRFD 222

Query: 93  GIQIENKNIKINWAFQSQTNLNDDT-----------------SFNLFIGDLNVNVDDTTL 135
           G  + ++ I     F  Q N   ++                  + +FI +L  +V+   L
Sbjct: 223 GSTLLDREI-----FVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQAL 277

Query: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRIN 193
            + FK C   L+A V  D +   SRGYG V + T E  Q A+++  G+E+ GR + ++
Sbjct: 278 KDMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/201 (17%), Positives = 76/201 (37%), Gaps = 38/201 (18%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++I NL  S+N  ALK  F+  G +               Y  + Y T  +  VA++  N
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYN 322

Query: 93  GIQIENKNIKI---------------------------NWAFQSQTNLN----------D 115
           G ++E + + +                           ++A Q   +LN           
Sbjct: 323 GYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGGG 382

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQA 175
           D S  +F+ +L  +   + L + F++     +A + +     +  G   V +D   +A+ 
Sbjct: 383 DQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKF-AYNGKPSGAAVVEYDNPADAEV 441

Query: 176 AMDQMQGHEINGRAIRINWAT 196
            + ++  +   GR + I++ +
Sbjct: 442 CISRLNSYNYGGRDLDISYVS 462

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFGFI----LDFTHYPE-KGCCFIKYDTHEQAAVCIVA 314
           +T ++ N+P    + DL  L +  G +    L F +  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 315 LSNFQFQGRNLRTGW 329
           L+++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%)

Query: 113 LNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           LND  SF LFIG LN  V    L   FK  P F+ A V  DM+T +S GYG+++F
Sbjct: 88  LNDKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNF 142

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 85/173 (49%), Gaps = 7/173 (4%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LYIGN+D ++ +D L + F QV+                  YAFIE+ T  DA+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 92  NG-IQIENKNIKINWA----FQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFL 146
           N  +Q+ N+ +K+  A      SQ + + +    LF+ +L+  VD   LA  F     F 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 147 QAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           +   ++ ++ +  +   ++ + T +++  A+ ++    +  R+I +++A K E
Sbjct: 132 KQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFKDE 183

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQSQ--TNLND 115
           Y F+E+ +  DA  AL TLN   + +               +N ++NWA  +   + +  
Sbjct: 112 YCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIPS 170

Query: 116 DTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              F+LF+GDL+    +  L + F K         VM D  T  SR +GFV F   +  +
Sbjct: 171 TPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERR 230

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A+ +M G    GR +R+ +AT R
Sbjct: 231 RALVEMNGVWCQGRNLRVAYATPR 254

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 317 NFQFQGRNLRTGWGK 331
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 111 TNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTH 170
           TN N+ T   +FIG L   + +  L + F      +      +++    +G GFV +   
Sbjct: 391 TNPNNTT---VFIGGLTSQISERQLHSLFSPFGAII------NVKIPPGKGCGFVKYAYR 441

Query: 171 ENAQAAMDQMQGHEINGRAIRINWA 195
            +A+AA+  MQG  + G  IR++W 
Sbjct: 442 IDAEAAIQGMQGFIVGGNPIRLSWG 466

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 37/96 (38%), Gaps = 5/96 (5%)

Query: 11  VPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXX 70
           VP     P + +      ++  ++IG L   I+E  L   F   G I             
Sbjct: 376 VPAFMAQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKG--- 432

Query: 71  XXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
               F++Y+   DA  A+Q + G  +    I+++W 
Sbjct: 433 --CGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSWG 466

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 85/181 (46%), Gaps = 7/181 (3%)

Query: 23  EGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX-YAFIEYSTN 81
           +G        +Y+GN+D  ++++ L + F   G +                +AF+E+++ 
Sbjct: 2   DGSSTVPANTVYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEFNSP 61

Query: 82  HDANVALQTLNG-IQIENKNIKI---NWAFQSQTNLND-DTSFNLFIGDLNVNVDDTTLA 136
            DA  A + LN  +++ ++ +K+   N A  S T+ N  D    LFI +++  VD   L 
Sbjct: 62  QDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNIDELVDSEMLT 121

Query: 137 NAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
             F      ++   ++ ++    R   ++ + T E++ AA++++    +  + I I++A 
Sbjct: 122 KIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMNKCISIDYAY 180

Query: 197 K 197
           K
Sbjct: 181 K 181

>AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL004W (HRB1) and
           YCL011C (GBP2)
          Length = 337

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/328 (19%), Positives = 112/328 (34%), Gaps = 34/328 (10%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++IGNL      + L+Q F   G +                  +EY+   D + A++  N
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHHRGM-GTVEYTNAQDVDEAIRRFN 67

Query: 93  GIQIENKNIKINWAFQSQTNLNDDT-------------SFNLFIGDLNVNVDDTTLANAF 139
           G+   ++ + +            +               F +F+ +L  ++   TL + F
Sbjct: 68  GMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLKDMF 127

Query: 140 KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           K C   + A V  D     SRG+G V   T EN  AA+++  G+E+ GR + +      +
Sbjct: 128 KECSEVIHADVSVDAD-GYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEVREGKGTD 186

Query: 200 XXXXXXXXXXXXXX----------XXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVE 249
                                      +VR                            VE
Sbjct: 187 VGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAELPHSENASVSVSGKASPEYEQYTPSDVE 246

Query: 250 DMIRRAP--PRVTTAYIGNIPHFATEPDLIPLLQNFGFIL------DFTHYPEKGCCFIK 301
              + AP   +    Y  N+P    E DL  L +  G +L      D    P  G    +
Sbjct: 247 FTSKAAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNP-TGSSVCE 305

Query: 302 YDTHEQAAVCIVALSNFQFQGRNLRTGW 329
           ++T   A  CI  L+N+ + G +L+  +
Sbjct: 306 FETVADAQECIERLNNYHYGGCDLKMSY 333

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 8   ETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXX 67
           E   P +    + A  GG    ++++Y  N+  +  E  L   F+ AG++          
Sbjct: 238 EQYTPSDVEFTSKAAPGG--AKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSE 295

Query: 68  XXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
                 +  E+ T  DA   ++ LN       ++K+++A
Sbjct: 296 GNPTGSSVCEFETVADAQECIERLNNYHYGGCDLKMSYA 334

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V + TL   FK  P F+ A V  D  T +S G+G+++F+  E A+ AM+++
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 181 QGHEINGRAIRI 192
              ++NG+ IRI
Sbjct: 153 NYTKVNGKEIRI 164

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 89/231 (38%), Gaps = 12/231 (5%)

Query: 106 AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFV 165
           A+  Q+N+     + +F+ +L  +++   L + FK C   ++A V  D +  RSRG+G V
Sbjct: 210 AYSMQSNMK--QGYEIFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTV 266

Query: 166 SFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXX 225
            F T ++ + A+D+    E++GR + +    +                    + N     
Sbjct: 267 IFRTRDDMERAIDRYNRFEVDGRTLDV----REGHSNNRNDDMNIQHQTQNAMTNDATSD 322

Query: 226 XXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGF 285
                                   + +     R T  Y  N+P      DL  L ++ G 
Sbjct: 323 ATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGK 382

Query: 286 I----LDFTHYPE-KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGK 331
           +    L +    E  G   +++ + + A VCI  L+ + + G +L   + K
Sbjct: 383 VRNAELKYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYAK 433

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 11/114 (9%)

Query: 2   SDQQPSETVVPVENVIPASAK---------EGGRETSDKVLYIGNLDKSINEDALKQYFQ 52
           SD   +E  +P +   PAS +         EGG   +  ++Y  NL  S     L   F+
Sbjct: 321 SDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNT--LIYCSNLPPSTARSDLYDLFE 378

Query: 53  VAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWA 106
             G++                A +E+ +  DA+V ++ LN       +++I++A
Sbjct: 379 SIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYA 432

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  SIN  ALK  F+  G +               +  + + T  D   A+   N
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRYN 282

Query: 93  GIQIENKNIKINWAFQSQTNLNDD 116
             +++ + + +     +  N NDD
Sbjct: 283 RFEVDGRTLDVREGHSN--NRNDD 304

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 62/135 (45%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           + +I++ST       L+ LN  Q+  +N  IK +  F+ + + ND  S +       LF+
Sbjct: 169 FCYIDFSTEQKMKAVLE-LNENQLNGRNLLIKNSKNFEGRPDKNDLVSMSKNPPSRILFV 227

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F + E A  A+      
Sbjct: 228 GNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALKDKTCR 287

Query: 184 EINGRAIRINWATKR 198
            I  R IR+ +   R
Sbjct: 288 RIASRPIRMEYGEDR 302

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL     ++ LK++FQ  G+I                +AF+++ +   A  AL+
Sbjct: 223 RILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALK 282

Query: 90  TLNGIQIENKNIKINWA 106
                +I ++ I++ + 
Sbjct: 283 DKTCRRIASRPIRMEYG 299

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V + TL   FK  P F+ + V  D  T +S G+G+++F+  E A+ AM+++
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 181 QGHEINGRAIRI 192
              ++NG+ IRI
Sbjct: 153 NYTKVNGKEIRI 164

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%)

Query: 106 AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFV 165
              SQ+ +    +  LFIGDL+  +D+  L   FK         V  D +T +S GYG++
Sbjct: 90  GLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYL 149

Query: 166 SFDTHENAQAAMDQMQGHEINGRAIRI 192
           +F   ++  AA ++     I G+ +RI
Sbjct: 150 NFSRRQDTLAATEEFNYRPIFGKEVRI 176

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 64/162 (39%), Gaps = 11/162 (6%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXX-XXXXYAFIEYSTNHDANVALQTL 91
           L+IG+LD+ I+E+ L Q F+    +                Y ++ +S   D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL---NVNVDDTTLANAFKSCPGFLQA 148
           N   I  K ++I  + ++ T    +   N+F  +L   N N+      + FK     L  
Sbjct: 165 NYRPIFGKEVRIMPSLRN-TFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVYGNILSC 223

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
            +       + +  GF+ FD    A+  + +  G E  G  I
Sbjct: 224 KL------DKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKI 259

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 99  KNIKINWAFQSQ--TNLNDDTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQ 155
           +N ++NWA  +   + +     F+LF+GDL+    +  L + F K         VM D  
Sbjct: 153 RNFRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPI 212

Query: 156 TSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           T  SR +GFV F   +  + A+ +M G    GR +R+ +AT R
Sbjct: 213 TGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPR 255

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 317 NFQFQGRNLRTGWGK 331
            F   G  +R  WG+
Sbjct: 463 GFIVGGNPIRLSWGR 477

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 111 TNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTH 170
           TN N+ T   +FIG L  +  +  L + F           + +++    +G GFV +   
Sbjct: 401 TNPNNTT---VFIGGLTSHTSERQLHSLFAPF------GTIINVKIPPGKGCGFVKYAYR 451

Query: 171 ENAQAAMDQMQGHEINGRAIRINWA 195
            +A+AA+  MQG  + G  IR++W 
Sbjct: 452 IDAEAAIQGMQGFIVGGNPIRLSWG 476

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V +  L + F     F+ A +  D  T +S GYG+++F   E+A+  +++ 
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 181 QGHEINGRAIRI 192
               I GR +RI
Sbjct: 182 NYIPIFGREVRI 193

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 74/176 (42%), Gaps = 13/176 (7%)

Query: 21  AKEGGRETSDKV--LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIE 77
           +K+    TS K+  L+IG+LD+ + E  L+  F +    +               Y ++ 
Sbjct: 108 SKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN 167

Query: 78  YSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL---NVNVDDTT 134
           +S   DA   ++  N I I  + ++I  + ++ +    +   N+F  +L   N+ +    
Sbjct: 168 FSNEEDAERVIEEFNYIPIFGREVRIMPSLRN-SFYRKNIGTNVFFSNLPLENLALTTRV 226

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
             +AFK     L   +       R +  GFV F+   +A+ A+ +  G +  G  I
Sbjct: 227 FYDAFKKYGKILSCKL------DRRKNIGFVYFEKDSSAKQAIAEYNGKQFYGNNI 276

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 6/96 (6%)

Query: 17  IPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFI 76
           IP+ +K  G   +   ++I NL  + + D L  YF   G +               +AFI
Sbjct: 317 IPSGSKMKGPHPN--AVFIKNLPLNSDSDLLLDYFSQIGPVKSIFTSNVSKLNSA-WAFI 373

Query: 77  EYSTNHDANVALQTLNGIQIENKNIKINWA---FQS 109
            +    DA  A+ +LN  Q+  + I+++ A   FQS
Sbjct: 374 TFKKGSDAQDAIDSLNHSQLLGRTIELSRAQKNFQS 409

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V +  L + F     F+ A +  D  T +S GYG+++F   E+A+  +++ 
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 181 QGHEINGRAIRI 192
               I GR +RI
Sbjct: 178 NYIPIFGREVRI 189

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 73/176 (41%), Gaps = 13/176 (7%)

Query: 21  AKEGGRETSDKV--LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIE 77
           +K+    TS K+  L+IG+LD+ + E  L+  F +    +               Y ++ 
Sbjct: 104 SKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN 163

Query: 78  YSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL---NVNVDDTT 134
           +S   DA   ++  N I I  + ++I  + ++ +    +   N+F  +L   N+ +    
Sbjct: 164 FSNEEDAERVIEEFNYIPIFGREVRIMPSLRN-SFYRKNIGTNVFFSNLPLENLALTTRV 222

Query: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
             +AFK     L   +       R +  GFV F+    A+ A+ +  G E  G  I
Sbjct: 223 FYDAFKKFGKILSCKL------DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXX----XXXXXXXXXXXXXYAFIEYSTNHDANVAL 88
           +Y+GNLD  +N+  L + F  AG I                   YAFI++  N D +   
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKF-VNDDVDYVC 63

Query: 89  QTL-NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQ 147
           +   N + +  K +K+  + +     + D    LF+ +L+ ++D   L+N FK     L+
Sbjct: 64  KLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLR 123

Query: 148 AHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
              ++ +Q    R   +V F T +++  A+ Q+    +  + I I++A K
Sbjct: 124 KPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYK 172

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L++YF   G +                + F+ +      +  ++T 
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        ++      D +  +F+G L  +V        F      + A
Sbjct: 192 HILDGKVIDPK--------RAIPREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDA 243

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ + A+   +     E  G+ I I  A  R
Sbjct: 244 QLMLDKDTGRSRGFGFVTYDSPDAAEKVCESRY-REFKGKQIEIKRAEPR 292

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+ NV +  L + F+  P  +   +  D +T  S GYG+++F + ++A+ A++  
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 181 QGHEINGRAIRI 192
               + GR +RI
Sbjct: 77  SYVNLFGREVRI 88

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 72/166 (43%), Gaps = 7/166 (4%)

Query: 28  TSDKV--LYIGNLDKSINEDALKQYFQV-AGQIXXXXXXXXXXXXXXXYAFIEYSTNHDA 84
           TS KV  L+IG+LD ++ E  L   F+V    I               Y ++ + ++ DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 85  NVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPG 144
             A++T + + +  + ++I  + ++ +    +   N+F  +L +     T    +++   
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRN-SYFRKNIGTNVFFSNLPLEQPALTTRVFYET--- 125

Query: 145 FLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           F +   +   +  R +  GFV F++   A+ A+      E  G  +
Sbjct: 126 FREYGKVLSCKLDRRKNIGFVYFESDAAARKAIASYNNKEYYGNIV 171

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 87  ALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFL 146
           A+Q +N  ++ +  +  N ++ ++     D ++ +FIG LNV + +  +   F      +
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEYK---DRAY-IFIGGLNVELTEADILTIFSQYGIPV 61

Query: 147 QAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRIN--WATKRE 199
              ++ D +T  S+G+G++ ++   +A  A+D + G +I GR I+++  W T R+
Sbjct: 62  DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRD 116

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIG+L+ +V +  L   F   P F+ A V ++  T+ S G+G+++F + E+A+ A ++M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 181 QGHEINGRAIRI 192
              ++    IRI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 60/159 (37%), Gaps = 5/159 (3%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IGNLDK + E  L+  F V    I               + ++ + +  DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N  ++ N  I+I  + +   +       N++  +L    +  T    + S   F +   +
Sbjct: 151 NYSKVLNNEIRIMPSMR-DPDYRKKVGTNVYFRNLPTENNMLTTRYFYDS---FRKYGKI 206

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +  RS+  GF+ F     A   + +       G  I
Sbjct: 207 LSCKIERSKKIGFIYFACEVTANEVIKKFNNSSFLGNNI 245

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL+  V +  L + F   P  +   +  D  + RS GYG+++F   E+A+ A ++ 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 181 QGHEINGRAIRI 192
               + G+ +RI
Sbjct: 164 NYVPLFGKEVRI 175

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IG+LD+ + E  L+  F +    +               Y +I +S + DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL---NVNVDDTTLANAFKSCPGFLQA 148
           N + +  K ++I  + ++ +    +   N+F  +L   N+++      + FK     L  
Sbjct: 164 NYVPLFGKEVRIMPSLRN-SFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILSC 222

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
            +       R +  GF+ FD   +A++A+D   G E  G  I       RE
Sbjct: 223 KL------DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDRE 267

>KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON}
           Anc_7.93 YOL041C
          Length = 431

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 74  AFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDT 133
           A+I Y T     +  Q LNG++  N++++++       +   D   ++FIG+L+   D+ 
Sbjct: 212 AYIVYKTKDAVKLVCQKLNGVEFHNRHLRVDSVSHPTKH---DKQRSVFIGNLDFEEDEE 268

Query: 134 TLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           TL   F +C       ++ D +T+  +G+ +V F   E    A+
Sbjct: 269 TLWKHFATCGPIEYVRIVRDSKTNVGKGFAYVQFKQLETVSKAL 312

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 4/88 (4%)

Query: 105 WAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGF 164
           W  +S  N++ D    LF+G L+  VD+  L  +F          ++ D Q  +SRGYGF
Sbjct: 101 WHPESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGF 159

Query: 165 VSFDTHENAQAAMDQM---QGHEINGRA 189
           V F ++E+++    ++   +G EI GR 
Sbjct: 160 VQFTSYEDSKQCFRELGVRKGIEIMGRT 187

>ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [1230
           bp, 409 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 409

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 79/219 (36%), Gaps = 38/219 (17%)

Query: 119 FNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMD 178
           + +F+ +L  +++   L + FK C   ++A V    +   SRG+G V + T E  Q A+ 
Sbjct: 220 YEVFVANLPYSINWQALKDMFKECGNVIRADVEL-ARNGYSRGFGTVIYGTPEEMQDAIA 278

Query: 179 QMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXX 238
           +  G+E+ GR +                          +VR                   
Sbjct: 279 RFHGYELEGRIL--------------------------EVREGRKSAVDPPPQEPIDDSS 312

Query: 239 XXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFI------LDFTHY 292
                  + V D       R    Y  N+P      DL  L +  G +       D    
Sbjct: 313 NFNSEFTEGVTD----GGERNNLIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGA 368

Query: 293 PEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGK 331
           P  G   ++Y+  E A VCI  L+N+ + G +L   +GK
Sbjct: 369 P-TGVAIVEYENVEDADVCIDRLNNYNYGGCDLEISYGK 406

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 79/189 (41%), Gaps = 24/189 (12%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  SIN  ALK  F+  G +               +  + Y T  +   A+   +
Sbjct: 222 VFVANLPYSINWQALKDMFKECGNVIRADVELARNGYSRGFGTVIYGTPEEMQDAIARFH 281

Query: 93  GIQIENKNIKINWAFQS------QTNLNDDTSFN----------------LFIGDLNVNV 130
           G ++E + +++    +S      Q  ++D ++FN                ++  +L  + 
Sbjct: 282 GYELEGRILEVREGRKSAVDPPPQEPIDDSSNFNSEFTEGVTDGGERNNLIYCANLPFST 341

Query: 131 DDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
             + L + F++      A + +D + + + G   V ++  E+A   +D++  +   G  +
Sbjct: 342 ATSDLYDLFETIGKLNNAELRFDSKGAPT-GVAIVEYENVEDADVCIDRLNNYNYGGCDL 400

Query: 191 RINWATKRE 199
            I++  KRE
Sbjct: 401 EISYG-KRE 408

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIGDL  NV +  L N F     F    +  D  T +S GYG+++F   ++A+ A+D+ 
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 181 QGHEINGRAIRI 192
               I GR IR+
Sbjct: 200 NYMPIFGREIRM 211

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 58/157 (36%), Gaps = 11/157 (7%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDANVALQT 90
            L+IG+L  ++ ED L   F                      Y ++ +    DA  A+  
Sbjct: 139 ALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDE 198

Query: 91  LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDL---NVNVDDTTLANAFKSCPGFLQ 147
            N + I  + I++  + ++ T    +   N+F  +L   N  +      + FK     L 
Sbjct: 199 YNYMPIFGREIRMMPSLRN-TYFRKNIGTNVFFSNLPLDNTKLTTRVFYDEFKKFGKILS 257

Query: 148 AHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHE 184
             +       R +  GF+ F+    A+ A+ Q  G E
Sbjct: 258 CKL------DRRKNIGFIYFENDAAAKEAIKQYNGKE 288

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 19/173 (10%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED LK YF   GQ+                + F+ ++     +  ++T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 271 HILDGKVIDPKRA-IPREEQDKTG-------KIFVGGIGPDVRPKEFEEFFSQWGTIIDA 322

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH---EINGRAIRINWATKR 198
            +M D  T RSRG+GF+++DT +    A+D++  +   E  G+ I I  A  R
Sbjct: 323 QLMLDKDTGRSRGFGFITYDTPD----AVDRVCENKFIEFKGKRIEIKRAEPR 371

>TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.432
           YPR112C
          Length = 868

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMW-----DMQTSRSRGYGFVSFDTHEN 172
           + ++FI +LN     + L   FKS  GF+ A V       D Q + S G+GFV F T E 
Sbjct: 639 TVSIFIKNLNFTTTTSQLVERFKSFGGFVVAQVKTKPDPKDSQRTLSMGFGFVEFRTKEQ 698

Query: 173 AQAAMDQMQGHEINGRAIRINWA 195
           A A ++ M G  I+G  I++  +
Sbjct: 699 ALAVIEAMDGSVIDGHKIQMKLS 721

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 8/130 (6%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN-------LFIGD 125
           + F+E+ T   A   ++ ++G  I+   I++  + +  TN N + + +       + + +
Sbjct: 688 FGFVEFRTKEQALAVIEAMDGSVIDGHKIQMKLSHRQGTNNNSNNAKDKKKKSSKIIVKN 747

Query: 126 LNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           L        +   F S        V      S +RG+ FV F   + A+ AMDQ+QG  +
Sbjct: 748 LPFEATRKDIFELFSSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQGVHL 806

Query: 186 NGRAIRINWA 195
            GR + + +A
Sbjct: 807 LGRRLVMQYA 816

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 31/72 (43%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+ ++     +      F S     + HV  D +T +S+G+ +V F    +A  A  ++
Sbjct: 324 LFLRNILYTSTENDFKKLFSSFGEIDEVHVALDTRTGKSKGFAYVLFKNPADAVQAYIEL 383

Query: 181 QGHEINGRAIRI 192
                 GR + I
Sbjct: 384 DKQIFQGRLLHI 395

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED LK YF   G +                + F+ +      +  ++T 
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        +S      D +  +F+G +  +V      + F      + A
Sbjct: 258 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDA 309

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ + A   + Q +  E  G+ I I  A  R
Sbjct: 310 QLMLDKDTGRSRGFGFVTYDSGD-AVDRVCQNKYIEFKGKQIEIKRAEPR 358

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +FIG LN    +  L N F      ++  +M D  T RSRG+GF++F+   +    +   
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 181 QGHEINGRAIRINWATKRE 199
             H ++G+ I    +  RE
Sbjct: 258 --HILDGKVIDPKRSIPRE 274

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  +  D  LAN F +      A ++ D Q + SRG+GFVSF   ++ + A+D+ 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +  GR +R++ A +R+
Sbjct: 82  RKTKFKGRLLRVDIAKRRD 100

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQ---TSRSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++   T RSRGYGFV F  H+ A   +  +  HE+
Sbjct: 538 QAKVIMEVKGSSTGRSRGYGFVEFRDHKAALMGLRWLNAHEV 579

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 19/173 (10%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED LK YF   GQ+                + F+ ++     +  ++T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 270 HILDGKVIDPKRA-IPREEQDKTG-------KIFVGGIGPDVRPKEFEEFFSQWGTIIDA 321

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH---EINGRAIRINWATKR 198
            +M D  T RSRG+GF+++DT +    A+D++  +   E  G+ I I  A  R
Sbjct: 322 QLMLDKDTGRSRGFGFITYDTPD----AVDRVCENKFIEFKGKRIEIKRAEPR 370

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 77/197 (39%), Gaps = 13/197 (6%)

Query: 5   QPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX 64
            PS    P         + G  +  +  ++IGNL     E+ L+ +F   G++       
Sbjct: 52  HPSRVGPPPRRTYDRPYESGVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMS 111

Query: 65  XXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINW---------AFQSQTNLND 115
                      +E++   DA  A++  NG+    ++I +            F+S      
Sbjct: 112 YRGRSKGM-GTVEFTNPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQ- 169

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQA 175
              +  F+ +L  ++    L + F+ C   ++A V  D     SRG+G V +   E+   
Sbjct: 170 -QGYEAFVVNLPYSITWQNLKDIFRECGDVIRADVELDY-NGYSRGFGSVIYANEEDMFK 227

Query: 176 AMDQMQGHEINGRAIRI 192
           A+D   G E+ GR + +
Sbjct: 228 AIDSFNGAELEGRILEV 244

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 258 RVTTAYIGNIPHFATEPDLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAAVC 311
           R  T Y  N+P   T PDL  L  + G       + D T     G   ++Y + + A VC
Sbjct: 297 RNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGT-STGAAVVEYASQDAADVC 355

Query: 312 IVALSNFQFQGRNLRTGW 329
           I  L+ + + GR+L   +
Sbjct: 356 INKLNGYNYGGRDLHITY 373

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 29/75 (38%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
            +Y  NL  S     L   F   G+I                A +EY++   A+V +  L
Sbjct: 300 TVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKL 359

Query: 92  NGIQIENKNIKINWA 106
           NG     +++ I +A
Sbjct: 360 NGYNYGGRDLHITYA 374

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%)

Query: 257 PRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALS 316
           P  TT +IG +    TE +L  L Q FG I+       KGC F++Y+T + A + I  + 
Sbjct: 252 PTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMK 311

Query: 317 NFQFQGRNLRTGWGKERST 335
               +   +R  WGK   T
Sbjct: 312 GVSIKNSKIRLSWGKAAKT 330

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 29  SDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVAL 88
           ++  ++IG L   + E+ L+  FQ  G+I                 F++Y T   A +A+
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGC-----GFVQYETRKAAELAI 307

Query: 89  QTLNGIQIENKNIKINWAFQSQTN 112
             + G+ I+N  I+++W   ++T+
Sbjct: 308 HKMKGVSIKNSKIRLSWGKAAKTS 331

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D T+  +FIG L+  V +  L + F+     +   + +       +G GFV ++T + A+
Sbjct: 251 DPTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPF------GKGCGFVQYETRKAAE 304

Query: 175 AAMDQMQGHEINGRAIRINWA 195
            A+ +M+G  I    IR++W 
Sbjct: 305 LAIHKMKGVSIKNSKIRLSWG 325

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 73/172 (42%), Gaps = 17/172 (9%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFI--EYSTNHDANVALQ 89
           ++IG L+    ED L+ YF   G +                + F+  E S++ D  V  Q
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 90  TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
            +    ++ K I    A   +     D +  +FIG +  +V        F      + A 
Sbjct: 232 HI----LDGKVIDPKRAIPREEQ---DKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDAQ 284

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH---EINGRAIRINWATKR 198
           +M D  T RSRG+GFV++D+ +    A+D++  H   E  G+ I I  A  R
Sbjct: 285 LMLDKDTGRSRGFGFVTYDSPD----AVDRVCQHKFIEFKGKQIEIKRAQPR 332

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 19/173 (10%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L++YF   G  I               + F+ +      +  ++T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        +S      D +  +F+G +  +V        F      + A
Sbjct: 219 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDA 270

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM-QGHEIN--GRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ E    A+D++ Q   I+  G+ I I  A  R
Sbjct: 271 QLMLDKDTGRSRGFGFVTYDSPE----AVDRVCQNKYIDFKGKQIEIKRAEPR 319

>Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ADR035C
          Length = 855

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 6/117 (5%)

Query: 87  ALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFL 146
           A  T++ +   N+N  +N      T ++  T+ ++F+ +LN +     L + FKS  GF+
Sbjct: 599 AKATVDDVMAANRNETLNEHDDLDTQVHGPTT-SIFVKNLNFSTKTEDLTDKFKSFAGFI 657

Query: 147 QAHVMWDMQTSR-----SRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            A +       R     S G+GFV F T E A A +  ++G  I+G  I++  + ++
Sbjct: 658 VAQIKTKPDPKRKGKTQSMGFGFVEFRTKEQANAVISALEGTVIDGHKIQLKLSHRQ 714

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN-----LFIGDLN 127
           + F+E+ T   AN  +  L G  I+   I++  + +  T     TS       + + +L 
Sbjct: 678 FGFVEFRTKEQANAVISALEGTVIDGHKIQLKLSHRQGTASTAKTSKKNINGKIIVKNLP 737

Query: 128 VNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEING 187
                  +   F S        V      S +RG+ FV F   + A+ AMDQ++G  + G
Sbjct: 738 FEATRKDIFELFSSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLEGVHLLG 796

Query: 188 RAIRINWA 195
           R + + +A
Sbjct: 797 RRLVMQYA 804

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%)

Query: 117 TSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAA 176
           +S  L+IGDL  +V +  L + F S   F+ A +  D +T  S GYG+++    E A + 
Sbjct: 150 SSIALYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSL 209

Query: 177 MDQMQGHEINGRAIRI 192
           +++     I GR +RI
Sbjct: 210 LERYNYTNIFGREVRI 225

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           + ++++ TN      ++ L+  Q+  +N  IK + +++ + + ND  S +       LF+
Sbjct: 184 FCYMDFKTNEQMESIIK-LSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFV 242

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ F+ F + E A  A+      
Sbjct: 243 GNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCR 302

Query: 184 EINGRAIRINWATKR 198
           +I  R IR+ +   R
Sbjct: 303 KIAARPIRMEYGEDR 317

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL     ++ LK++FQ  G+I                +AFI++ +   A  AL+
Sbjct: 238 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALK 297

Query: 90  TLNGIQIENKNIKINWA 106
                +I  + I++ + 
Sbjct: 298 DKTCRKIAARPIRMEYG 314

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+ YF   G++                + F+ + +    +  ++T 
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 184 HILDGKVIDPKRA-IPREEQDKTG-------KIFVGGIGPDVRPKEFEEFFAQWGTIIDA 235

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GF+++DT + A   + Q +  +  GR I I  A  R
Sbjct: 236 QLMLDKDTGRSRGFGFITYDTPD-AVDKVCQNKFIDFKGRKIEIKRAAPR 284

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S  +FIG LN    +  L + F       +  +M D  T RSRG+GF++F++  +    +
Sbjct: 121 SCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVV 180

Query: 178 DQMQGHEINGRAIRINWATKRE 199
                H ++G+ I    A  RE
Sbjct: 181 KTQ--HILDGKVIDPKRAIPRE 200

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           + ++++ T+    +A+  L+  Q+  +N  +K +  ++ + + ND  S +       LF+
Sbjct: 168 FCYLDFKTDEKM-LAVVALSESQLNGRNLLVKNSKDYEGRPDKNDLISMSKNPPSRILFV 226

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     T + +G+ FV F   E A  A+      
Sbjct: 227 GNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDKSCR 286

Query: 184 EINGRAIRINWATKR 198
           +I GR +R+ +   R
Sbjct: 287 KIAGRPLRMEFGEDR 301

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 10/58 (17%)

Query: 272 TEPDL----IPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNL 325
           TE D+    +PL +N G          KG C++ + T E+  + +VALS  Q  GRNL
Sbjct: 144 TEEDIERVNMPLAKNDG-----KQIKNKGFCYLDFKTDEKM-LAVVALSESQLNGRNL 195

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL     +D L+++FQ  G+I                +AF+++     A  AL 
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  + +++ + 
Sbjct: 282 DKSCRKIAGRPLRMEFG 298

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 78/174 (44%), Gaps = 7/174 (4%)

Query: 30  DKVLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVAL 88
           D  +Y+GN+D  +  + L + F Q+                   +AF+E+    D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 89  QTL-NGIQIENKNIKI---NWAFQSQTNLND-DTSFNLFIGDLNVNVDDTTLANAFKSCP 143
           + L N +++ ++ +K+   N A  +  N N  D    LF+ +++  VD T L   F    
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 144 GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
              +A  ++ ++    +   +VS+ T E++  A+ ++    +  + I +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 10/115 (8%)

Query: 91  LNGIQIENKNIKINWAFQSQTNLNDDTSFN-------LFIGDLNVNVDDTTLANAFKSCP 143
           LNG ++  KN K    ++ + N +D  S +       LF+G+L+ +  D  L + F+ C 
Sbjct: 190 LNGRKLLIKNSK---NYEGRPNRDDLVSMSKNPPSRILFVGNLSYDTTDELLRSHFQHCG 246

Query: 144 GFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
             ++        T + +G+ F+ F T E+A  A+      +I GR IR+ +   R
Sbjct: 247 EIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDKSCRKIAGRPIRMEYGEDR 301

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL     ++ L+ +FQ  G+I                ++FI++ T   A  AL+
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  + I++ + 
Sbjct: 282 DKSCRKIAGRPIRMEYG 298

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 71/169 (42%), Gaps = 11/169 (6%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFI--EYSTNHDANVALQ 89
           L+IG L+    ED LK YF   G +                + F+  E S++ D  V  Q
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 90  TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
            +    ++ K I    A   +     D +  +F+G +  +V        F      + A 
Sbjct: 255 HI----LDGKVIDPKRAIPREEQ---DKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 307

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           +M D  T RSRG+GF+++D+ E A   + Q +  +  G+ I I  A  R
Sbjct: 308 LMLDKDTGRSRGFGFITYDSSE-AVDRVCQNKYIDFKGKQIEIKRAAPR 355

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 115 DDTSFN------LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFD 168
           +DTS N      LF+ ++  +  D  L + F        A ++ D   S SRG+GFVSF 
Sbjct: 6   NDTSKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGS-SRGFGFVSFA 64

Query: 169 THENAQAAMDQMQGHEINGRAIRINWATKRE 199
              + QAA+D+ +  +  GR +R++ A +RE
Sbjct: 65  VESDTQAALDKGRKTQFKGRLLRVDVAKRRE 95

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIG+L+++V++  L   FK  P  +   +  +  T  S GYG+++F   E+A+ A ++ 
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 181 QGHEINGRAIRI 192
               + G  ++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 64/159 (40%), Gaps = 5/159 (3%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IGNL   +NE+ LKQ F +    +               Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N I +    +KI  + ++      +   NLF  +L ++  + T    + +   F +   +
Sbjct: 140 NYINLFGNEVKIMPSLRNSF-YRKNIGTNLFFCNLPLDNKELTTRRFYDT---FKKYGKI 195

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +  + +  GFV FD  ++A+  +      E  G  I
Sbjct: 196 LSCKLDKRKNIGFVYFDNDKSAKEVIKDFNNKEFFGTKI 234

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 63/135 (46%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           + ++++ T      A++ L+  Q+  +N  IK + +++ + +  D  S +       LF+
Sbjct: 169 FCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILFV 227

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F   E A  A+      
Sbjct: 228 GNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDKSCR 287

Query: 184 EINGRAIRINWATKR 198
           +I GR +R+ +   R
Sbjct: 288 KIAGRPLRMEFGEDR 302

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 272 TEPDLI----PLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNL 325
           TE DL+    PL +N G          KG C++ + T EQ    I  LS  Q  GRNL
Sbjct: 145 TEEDLVRVNMPLAKNDG-----KQIKNKGFCYVDFKTQEQVEAAI-KLSESQLNGRNL 196

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 17/175 (9%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++IGNL  +   + LK+YF   G++                  +E++ + D + A++  +
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIITSRGHHRGM-GTVEFNNSTDVDTAIRDCD 201

Query: 93  GIQIENKNIKINW-----AFQSQTNLND----------DTSFNLFIGDLNVNVDDTTLAN 137
           G  +  + I +       A  S+T  N+          D  F +F+  L  +V+   L +
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKD 261

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
            FK C   L A V+ D +  +SRG+G V   T E    A+    G E  GR + +
Sbjct: 262 MFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDV 315

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 113 LNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRS--RGYGFVSFDTH 170
           +N + + ++FIG+L  N     L   F    G +      D+ TSR   RG G V F+  
Sbjct: 135 VNRNYANSIFIGNLTYNTTPEDLKEYF----GKIGEVRRADIITSRGHHRGMGTVEFNNS 190

Query: 171 ENAQAAMDQMQGHEINGRAI 190
            +   A+    G  +NGRAI
Sbjct: 191 TDVDTAIRDCDGAFLNGRAI 210

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+QYF   G  I               + F+ +  +   +  ++T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 212 HILDGKVIDPKRA-IPREEQDKTGK-------IFVGGIGPDVRPKEFEEFFSQWGSIIDA 263

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ + A   + Q +  E  G+ I I  A +R
Sbjct: 264 QLMLDKDTGRSRGFGFVTYDSPD-AVDKVCQNKFIEFKGKTIEIKRAEQR 312

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 87/212 (41%), Gaps = 31/212 (14%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  +V D  L   F +      A V+ D+   +SRG+GFVSF T E+ + A+ + 
Sbjct: 24  LFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDV-NKKSRGFGFVSFATEEDTKDALGKA 82

Query: 181 QGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXX 240
           +  ++NG  +R++ A +R+                   RN+                   
Sbjct: 83  RRSKLNGNVLRVDIAKRRD-------------------RNKKNGEEKAISLPLDTIGDKE 123

Query: 241 XXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPD-LIPLLQNFGFILDFTHYPEK---G 296
                   ED   +  P++    I N+P    +P+ L  +   FG +++ +  P K    
Sbjct: 124 VEQSDDEEEDSQFKGKPKL---IIRNMPWSCRDPNKLKKIFGRFGNVVEAS-IPRKRDGK 179

Query: 297 CCFIKYDTHEQAAVCIVALSN---FQFQGRNL 325
            C   + T ++ + C +AL N    +  GRN+
Sbjct: 180 LCGFAFVTMKKISNCRLALENTKDLKIDGRNV 211

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA V+ +++ S   RSRGYGFV +  H++A   +  +  H +    +
Sbjct: 539 QAKVIMEVKGSSIGRSRGYGFVEYKDHKHALMGLRWLNVHAVTAEEV 585

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFI--EYSTNHDANVALQ 89
           ++IG L+    E+ L+ YF   G +                + F+  E+ ++ D  V  Q
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 90  -TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        +S      D +  +F+G +  +V        F      + A
Sbjct: 156 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDA 207

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+  +A   + Q +  E  G+ I I  A  R
Sbjct: 208 QLMLDKDTGRSRGFGFVTYDS-PDAVDRVCQSKYIEFKGKQIEIKRAQPR 256

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 4/107 (3%)

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGF 145
           V L   NG    N  IK   +    + L   +   LFIGDL  +V +  L + F      
Sbjct: 68  VKLNYTNGDSAANVGIKSKLS----STLESKSVVALFIGDLEPSVTENMLRDIFGKFRSL 123

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
               +  D  + +S GYG+++F   E+A+ A ++     I G+ +RI
Sbjct: 124 TSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEFNYRPIEGQEVRI 170

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/159 (18%), Positives = 65/159 (40%), Gaps = 5/159 (3%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IG+L+ S+ E+ L+  F +                    Y ++ ++ + DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           N   IE + ++I  + ++ +    +   N+F  +L +  D       F     F +   +
Sbjct: 159 NYRPIEGQEVRIMPSLRN-SFYRKNVGTNVFFSNLPLE-DSRLTTRVFYDT--FKKYGKI 214

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +  + +  GF+ F+  ++A+  +    G E  G  +
Sbjct: 215 LSCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFGNKV 253

>Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF}
           YCL011C (GBP2) - Protein with RNA recognition motifs
           [contig 83] PARTIAL
          Length = 216

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 14/131 (10%)

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTS-------------FNLF 122
           +E+S     + A+Q  +G     + + +        ++  + S             + +F
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 123 IGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQG 182
           I +L  +    +L + FK+C    +A V  D +  RS+G+G V F+T + A+ A+D+ Q 
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFETIDEARTALDKFQH 122

Query: 183 HEINGRAIRIN 193
            ++ GR + + 
Sbjct: 123 FDLEGRILELK 133

>Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON}
           YCL011C (REAL)
          Length = 433

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/314 (18%), Positives = 109/314 (34%), Gaps = 25/314 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL      + LK+ F   G+I                  +E++ N     A+   +
Sbjct: 128 IFVRNLTFDCTPEDLKELFGTVGEILEADIITSKGHHRGM-GTVEFTNNEAVQDAISKFD 186

Query: 93  G---------IQIENKNIKINWAFQSQTNLND-DTSFNLFIGDLNVNVDDTTLANAFKSC 142
           G         ++ +N   + +  F  +    + D  F +FI +L  +++  +L + FK C
Sbjct: 187 GALFMDRKLMVRQDNPPPEASKEFSKKATREEVDNGFEVFIINLPYSINWQSLKDMFKEC 246

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKREXXX 202
              L+A V  D     SRG+G V + T +    A+D   G E+ GR + +          
Sbjct: 247 GHVLRADVELDF-NGFSRGFGSVIYPTKDEMMRAIDTFNGMEVEGRVLEVREGRFNNRRK 305

Query: 203 XXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVTTA 262
                          +R+                             + +     R    
Sbjct: 306 DNDRYNQDPQDPEEDIRD--------AEPDLVQDITVHIDETATKFTEGVNPGGDRNCFI 357

Query: 263 YIGNIPHFATEPDLIPLLQNFGFILDFTHYPEK-----GCCFIKYDTHEQAAVCIVALSN 317
           +  N+P      DL  L    G I +    P++     G   ++Y+    A  CI  L+N
Sbjct: 358 HCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNN 417

Query: 318 FQFQGRNLRTGWGK 331
           + + G +L+  + K
Sbjct: 418 YNYGGCSLQISYAK 431

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 10  VVPVENVIPASAKEGGRE-TSDKV-----LYIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           +V  +N  P ++KE  ++ T ++V     ++I NL  SIN  +LK  F+  G +      
Sbjct: 196 MVRQDNPPPEASKEFSKKATREEVDNGFEVFIINLPYSINWQSLKDMFKECGHVLRADVE 255

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKI 103
                    +  + Y T  +   A+ T NG+++E + +++
Sbjct: 256 LDFNGFSRGFGSVIYPTKDEMMRAIDTFNGMEVEGRVLEV 295

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 83  DANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSC 142
           DA+   +TL  + I  +N+         TN+ ++ +  LF+G+L   +    L   FK  
Sbjct: 38  DASSRSETLEIVDIRTENL--------GTNVQNNIA--LFVGNLAEEITSERLTEMFKVY 87

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
             F+ A V  +   +RS G+G+++F   E+A+ A +    ++I G+ IRI
Sbjct: 88  KSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDFNYNKIMGKEIRI 137

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 65/170 (38%), Gaps = 10/170 (5%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++I NL    N + +   F   G I               +AF+ Y        A+   N
Sbjct: 278 IFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFN 337

Query: 93  GIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLA---NAFKSCPGFLQAH 149
           G  I N+N+ +  A+ S+ N+       LF+ +L+   D   L    N     P  ++ H
Sbjct: 338 GKAIGNRNVFVTHAY-SKYNIPTPKPI-LFLSNLSPICDRKFLKQIMNQLSVKPEDIKVH 395

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
              + +   S G   + F T ++   A   +    ++G  I   +AT R+
Sbjct: 396 QSENPEHVTSTGT--IQFKTQDDLDKAKKFLNNKLVSGSII---YATTRK 440

>Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {ON}
           ANNOTATED BY YGOB - YCL011C (GBP2) - Protein with RNA
           recognition motifs [contig 83] PARTIAL
          Length = 226

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 14/131 (10%)

Query: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTS-------------FNLF 122
           +E+S     + A+Q  +G     + + +        ++  + S             + +F
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 123 IGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQG 182
           I +L  +    +L + FK+C    +A V  D +  RS+G+G V F+T + A+ A+D+ Q 
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFETIDEARTALDKFQH 122

Query: 183 HEINGRAIRIN 193
            ++ GR + + 
Sbjct: 123 FDLEGRILELK 133

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+ YF   G +                + F+ ++ +   +  ++T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 244 HILDGKVIDPKRA-IPREEQDKTG-------KIFVGGIGPDVRPKEFEEFFSQYGTIIDA 295

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GF+++DT  +A   + Q +  E  G+ I I  A  R
Sbjct: 296 QLMLDKDTGRSRGFGFITYDT-PDAVDRVCQNKFIEFKGKRIEIKRAEPR 344

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           +LFIGDL+  V +  L +AF          +  D +T +S GYG+++F + + A  A+++
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 180 MQGHEINGRAIRI 192
               ++ G+ +RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 69/159 (43%), Gaps = 5/159 (3%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX-YAFIEYSTNHDANVALQTL 91
           L+IG+LDK + E  L   F     +                Y ++ +++  +A+ A++  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 92  NGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVM 151
           + +++  K ++I  + ++ +    +   N+F  +L +     T    ++S   F +   +
Sbjct: 156 SYVKLFGKEVRIMPSMRN-SYFRKNIGTNVFFTNLPLENPALTTRVFYES---FRKYGRV 211

Query: 152 WDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
              +  R +  GFV F++  +A+ A+D     E  G  I
Sbjct: 212 LSCKLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKI 250

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFD 168
           S+ N N      LF+  +  +V D  LA+ F +      A V+ D+   RSRG+GFVSF 
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDV-NKRSRGFGFVSFA 74

Query: 169 THENAQAAMDQMQGHEINGRAIRINWATKRE 199
             ++ + A+ + +  + NG ++R++ A +R+
Sbjct: 75  VEDDTKEALAKARKTKFNGHSLRVDVAKRRD 105

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++ S   RSRGYGFV F  H+NA   +  +  H +
Sbjct: 539 QAKVIMEVKGSTAGRSRGYGFVEFRDHKNALMGLRWLNCHAV 580

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 14/137 (10%)

Query: 73  YAFIEYSTN--HDANVALQT--LNGIQIENKNIKINWAFQSQTNLNDDTSFN-------L 121
           +A+++++T+   DA + L    LNG  +  KN K   ++  +   ND  S +       L
Sbjct: 162 FAYVDFATSAQMDAVIGLSEAQLNGRNLLIKNAK---SYDGRPAKNDLISMSKNPPSRIL 218

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           F+G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F     A AA+    
Sbjct: 219 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRS 278

Query: 182 GHEINGRAIRINWATKR 198
              I GR +R+ +   R
Sbjct: 279 CRAIAGRPLRMEYGEDR 295

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 14/137 (10%)

Query: 73  YAFIEYSTNHDAN--VALQT--LNGIQIENKNIKINWAFQSQTNLNDDTSFN-------L 121
           +A + + T    N  VAL    LNG    N  IK + +F  + + ND  S +       L
Sbjct: 181 FAHMNFKTQEQMNAVVALSESHLNG---RNLLIKDSSSFDGRPDKNDLISMSKNPPSRIL 237

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           F+G+L+ +  D  L   F+ C   ++  +     T + +G+ FV F   E    A+    
Sbjct: 238 FVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDKT 297

Query: 182 GHEINGRAIRINWATKR 198
             +I GR +R+ +   R
Sbjct: 298 CRKIAGRPLRMEFGEDR 314

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 26/201 (12%)

Query: 4   QQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXX-X 62
           QQP+++  PV+  +   + +         ++IG L+    E+ L+ YF   G++      
Sbjct: 138 QQPADSSRPVKADLSKDSCK---------MFIGGLNWETTEETLRDYFNKYGKVVELKIM 188

Query: 63  XXXXXXXXXXYAFI--EYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN 120
                     + F+  E +T+ D  V  Q +    ++ K I    A   +     D +  
Sbjct: 189 KDNNTGRSRGFGFLTFEDATSVDEVVKTQHI----LDGKVIDPKRAIPREEQ---DKTGK 241

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +F+G +  +V      + F      + A +M D  T RSRG+GFV++D+ +    A+D++
Sbjct: 242 IFVGGIGADVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSPD----AVDRV 297

Query: 181 QGH---EINGRAIRINWATKR 198
             +   E  G+ I I  A  R
Sbjct: 298 CQNKFIEFKGKQIEIKRAEPR 318

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S  +FIG LN    + TL + F      ++  +M D  T RSRG+GF++F+   +    +
Sbjct: 155 SCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVV 214

Query: 178 DQMQGHEINGRAIRINWATKRE 199
                H ++G+ I    A  RE
Sbjct: 215 KTQ--HILDGKVIDPKRAIPRE 234

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 100 NIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRS 159
           NI+ + +  S+ N N      LF+  +  +V D  LA+ F +      A V+ D    RS
Sbjct: 7   NIESSKSNVSKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRS 65

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           RG+GFVSF   ++ + A+ + +  + NG  +R++ A +R+
Sbjct: 66  RGFGFVSFAVEDDTKEALAKARKTKFNGHTLRVDVAKRRD 105

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA V+ +++ S   RSRGYGFV F  H+NA   +  +  H +    I
Sbjct: 542 QAKVIMEVKGSTAGRSRGYGFVEFRDHKNALMGLRWLNCHAVTSDEI 588

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 1/119 (0%)

Query: 77  EYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLA 136
           E    H A   +  L   +IEN+ + +       ++        LF+  LN   +   LA
Sbjct: 201 ELIEKHQAKSKMSLLKS-EIENQELALEIIGDIPSSTIKPLKTVLFVCKLNAMTNAKDLA 259

Query: 137 NAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
             F      +   ++ D  T RS GYGF+ FD+    + A   M+G  I+ + I ++++
Sbjct: 260 QIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDFS 318

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 32  VLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX-YAFIEYSTNHDANVALQT 90
           VL++  L+   N   L Q F   GQI                Y FIE+ +     +A   
Sbjct: 243 VLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSN 302

Query: 91  LNGIQIENKNIKINWAFQSQTNL 113
           + G+ I++K I ++++ QS + L
Sbjct: 303 MEGVIIDDKKIHVDFS-QSVSKL 324

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 19/144 (13%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIEN---------------KNIKINWAFQS--QTNLND 115
           Y F+E+ +  D   AL +LN   I N               +  ++NWA  +  Q+ +  
Sbjct: 121 YCFVEFESQQDVIAAL-SLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSLIPA 179

Query: 116 DTSFNLFIGDLNVNVDDTTLANAF-KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
              ++LFIGDL+    +  + + F K         VM D     SRG+GF+ F   +  +
Sbjct: 180 TPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDEDERK 239

Query: 175 AAMDQMQGHEINGRAIRINWATKR 198
            A++ M G   + R  R+  AT R
Sbjct: 240 DALENMNGVMCHSRYFRLALATPR 263

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%)

Query: 260 TTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALSNFQ 319
           TT +IG +     E +L  L + FG IL       K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 320 FQGRNLRTGWGK 331
             G  +R  WGK
Sbjct: 402 INGNPIRLSWGK 413

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D+++  +FIG L+ + ++  L   F+     L   +         +  GFV F     A 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPI------GKNCGFVKFKRKIEAN 391

Query: 175 AAMDQMQGHEINGRAIRINWA 195
           AA+  MQG  ING  IR++W 
Sbjct: 392 AAIKGMQGFIINGNPIRLSWG 412

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 61/141 (43%), Gaps = 12/141 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+ YF   G+ I               + F+ + ++   +  ++T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        ++      D +  +F+G +  +V        F      + A
Sbjct: 221 HILDGKVIDPK--------RAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDA 272

Query: 149 HVMWDMQTSRSRGYGFVSFDT 169
            +M D  T RSRG+GFV++D+
Sbjct: 273 QLMLDKDTGRSRGFGFVTYDS 293

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +FIG LN    + TL + F      +   +M D  T RSRG+GF++FD+  +    +   
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 181 QGHEINGRAIRINWATKRE 199
             H ++G+ I    A  RE
Sbjct: 221 --HILDGKVIDPKRAIPRE 237

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/324 (18%), Positives = 114/324 (35%), Gaps = 46/324 (14%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           D  ++IGNL      + L  +F  AG++                  +E+++    + A++
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRHRGM-GTVEFTSPEGVDNAIR 176

Query: 90  TLNGIQIENKNI----------------KINWAFQSQTNLNDDTSFNLFIGDLNVNVDDT 133
             NG++   + +                 +   F           F +FI +L  ++   
Sbjct: 177 DFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQ 236

Query: 134 TLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRIN 193
           TL + F+     ++A +  D +   SRG+G V + T E    A+++  G +++GR +++ 
Sbjct: 237 TLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVR 295

Query: 194 WATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIR 253
                                  ++                           Q  E+++ 
Sbjct: 296 EGKNSTGYQAPYQAPPPPQEQEIEME--------------------PPTGPSQFTENVVG 335

Query: 254 RAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFI------LDFTHYPEKGCCFIKYDTHEQ 307
               R T  Y  N+P      DL  L +  G +       D +  P  G   I+Y+  E 
Sbjct: 336 GG-ERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVED 393

Query: 308 AAVCIVALSNFQFQGRNLRTGWGK 331
           A  CI  L+N+ + G +L   + K
Sbjct: 394 ADFCIQRLNNYNYGGCDLDISYAK 417

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 14/137 (10%)

Query: 73  YAFIEYSTNH--DANVALQT--LNGIQIENKNIKINWAFQSQTNLNDDTSFN-------L 121
           +A + + T    DA +AL    LNG    N  IK + +F  + + ND  S +       L
Sbjct: 181 FAHMNFRTQKQMDAVIALSESHLNG---RNMLIKNSASFDGRPDKNDLISMSKNPPSRIL 237

Query: 122 FIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQ 181
           F+G+L+ +  D  L   F+ C   ++  +     T + +G+ FV F   E    A+    
Sbjct: 238 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDKT 297

Query: 182 GHEINGRAIRINWATKR 198
              I GR +R+ +   R
Sbjct: 298 CRRIAGRPLRMEFGEDR 314

>YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}
           GBP2Poly(A+) RNA-binding protein, involved in the export
           of mRNAs from the nucleus to the cytoplasm; similar to
           Hrb1p and Npl3p; also binds single-stranded telomeric
           repeat sequence in vitro
          Length = 427

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/316 (18%), Positives = 108/316 (34%), Gaps = 31/316 (9%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL      + LK+ F   G++                  +E++ N     A+   +
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSKGHHRGM-GTVEFTKNESVQDAISKFD 182

Query: 93  GIQIENKNIKINW---------AFQSQTNLND-DTSFNLFIGDLNVNVDDTTLANAFKSC 142
           G    ++ + +            F  +    + D  F +FI +L  +++  +L + FK C
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKEC 242

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA--TKREX 200
              L+A V  D     SRG+G V + T +    A+D   G E+ GR + +      KR+ 
Sbjct: 243 GHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKN 301

Query: 201 XXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVT 260
                             R                              + +     R  
Sbjct: 302 NDRYNQ------------RREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNC 349

Query: 261 TAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEK-----GCCFIKYDTHEQAAVCIVAL 315
             Y  N+P      DL  L    G I +    P++     G   ++Y+    A  CI  L
Sbjct: 350 FIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKL 409

Query: 316 SNFQFQGRNLRTGWGK 331
           +N+ + G +L+  + +
Sbjct: 410 NNYNYGGCSLQISYAR 425

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 10  VVPVENVIPASAKEGGRETSDKVL------YIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           +V  +N  P +AKE  ++ + + +      +I NL  S+N  +LK  F+  G +      
Sbjct: 192 MVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVE 251

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKI 103
                    +  + Y T  +   A+ T NG+++E + +++
Sbjct: 252 LDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 291

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 13/171 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L++YF   G +                + F+ ++     +  ++T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        ++      D +  +F+G +  +V        F      + A
Sbjct: 233 HILDGKVIDPK--------RAIPREEQDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDA 284

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
            +M D  T RSRG+GF+++D+ + A   + Q +  E  G+ I I  A  R+
Sbjct: 285 QLMLDKDTGRSRGFGFITYDSPD-AVDRVCQNKFIEFKGKRIEIKRAEPRQ 334

>KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa]
           {ON} Anc_3.432 YPR112C
          Length = 867

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSR-----SRGYGFVSFDT 169
           D  + ++F+ +LN +     L + FK   GF+ A V       R     S G+GFV F T
Sbjct: 636 DGPTVSIFVKNLNFSTTSVQLTDRFKKFGGFVVAQVKTKPDPKREGHTLSMGFGFVEFRT 695

Query: 170 HENAQAAMDQMQGHEINGRAIRINWATKR 198
            E A A +  M G  I+G  I++  + ++
Sbjct: 696 KEQANAVISAMDGEVIDGHKIQLKLSHRQ 724

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 7/128 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLN------DDTSFNLFIGDL 126
           + F+E+ T   AN  +  ++G  I+   I++  + +   N +      +  S  + + +L
Sbjct: 688 FGFVEFRTKEQANAVISAMDGEVIDGHKIQLKLSHRQSNNTSSHGSNKNSKSGKIIVKNL 747

Query: 127 NVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
                   +   F S        V      S +RG+ FV F   + A+ AMDQ+QG  + 
Sbjct: 748 PFEATRKDVFELFNSFGQLKSVRVPKKFDKS-TRGFAFVEFLLPKEAEDAMDQLQGVHLL 806

Query: 187 GRAIRINW 194
           GR + + +
Sbjct: 807 GRRLVMQY 814

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 34/72 (47%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+ ++  N  +    + F       + H+  D++T +S+G+ ++ F   ++A  A  ++
Sbjct: 326 LFLRNILYNSTEQDFRDLFSPFGELEEVHIAVDIRTGKSKGFAYILFKNPKDAIQAYIEL 385

Query: 181 QGHEINGRAIRI 192
                 GR + I
Sbjct: 386 DKQIFQGRLLHI 397

>Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {ON}
           YPR112C (REAL)
          Length = 886

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 5/111 (4%)

Query: 90  TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
           +LN +   NK+     +     ++ D  + ++FI +LN    +  L N FK   GF+ A 
Sbjct: 633 SLNDLMETNKDANEETSATHDEDVIDGPTVSIFIKNLNFTTTNQDLTNRFKVFTGFVVAQ 692

Query: 150 VMWD-----MQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           V           + S G+GFV F T E A A +  M G  I+G  I++  +
Sbjct: 693 VKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVISAMDGTVIDGHKIQLKLS 743

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 61/128 (47%), Gaps = 7/128 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVD- 131
           + F+E+ T   AN  +  ++G  I+   I++  + + Q + N++T+         + V  
Sbjct: 710 FGFVEFRTKEQANAVISAMDGTVIDGHKIQLKLSHR-QASQNNNTNVKSKKKSGKIIVKN 768

Query: 132 ---DTTLANAFKSCPGF--LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
              + T  + F+    F  L++  +       +RG+ FV F   + A+ AMDQ+QG  + 
Sbjct: 769 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 828

Query: 187 GRAIRINW 194
           GR + + +
Sbjct: 829 GRRLVMQY 836

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 147 QAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
           + HV  D +T +S+G+ +V F   +NA  A  ++      GR + I
Sbjct: 372 EVHVALDTRTGQSKGFAYVLFKDPKNAVEAYVELDKQIFQGRLLHI 417

>TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {ON}
           Anc_3.432 YPR112C
          Length = 872

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTS-----RSRGYG 163
           S  N+ D  + ++FI +LN +     L+  FK+  GF+ A V             S G+G
Sbjct: 637 STDNVVDGPTVSIFIKNLNFSTTSQQLSQQFKNFNGFIVAQVKTKSDPKIEGKILSMGFG 696

Query: 164 FVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           F  F T E A AA+  M G  I+G  I+I  +
Sbjct: 697 FAEFKTKEQALAAISAMDGSVIDGHKIQIKLS 728

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 72/174 (41%), Gaps = 12/174 (6%)

Query: 33  LYIGNLDKSINEDALKQYFQ-----VAGQIXXXXX-XXXXXXXXXXYAFIEYSTNHDANV 86
           ++I NL+ S     L Q F+     +  Q+                + F E+ T   A  
Sbjct: 649 IFIKNLNFSTTSQQLSQQFKNFNGFIVAQVKTKSDPKIEGKILSMGFGFAEFKTKEQALA 708

Query: 87  ALQTLNGIQIENKNIKINWAFQ----SQTNLND-DTSFNLFIGDLNVNVDDTTLANAFKS 141
           A+  ++G  I+   I+I  + +    S++N++    S  + + +L        +   F S
Sbjct: 709 AISAMDGSVIDGHKIQIKLSHRQGTASKSNVSQRKPSGKIIVKNLPFEATRKDVFELFSS 768

Query: 142 CPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
                   V      S +RG+ FV F   + A+ AMDQ+QG  + GR + I +A
Sbjct: 769 FGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVIQYA 821

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  + ++V D  LA+ F +      A V+ D+   +SRG+GFVSF   ++ + A+ Q 
Sbjct: 28  LFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDV-NKKSRGFGFVSFAVEDDTKEALKQA 86

Query: 181 QGHEINGRAIRINWATKRE 199
           +  ++ G  +R++ A +R+
Sbjct: 87  RKAKLKGHLLRVDIAKRRD 105

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 81/190 (42%), Gaps = 19/190 (10%)

Query: 27  ETSDKVLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDAN 85
           E S   L+  N   + ++  L Q F Q  G +               +A+I+ ++  +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 86  VALQTLNGIQIENKNIKINWAFQSQTNLNDDTSF----NLFIGDLNVNVDDTTLANAFKS 141
           +AL+ L+G++IEN  + +  +  S      D +      + + +LN N ++  L+  F  
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 142 CPGFLQAHV-------------MWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGR 188
                Q ++               + +   + G+ F++F     A++++  + G EI+ R
Sbjct: 233 FGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSLS-LNGTEIDNR 291

Query: 189 AIRINWATKR 198
            + +  A +R
Sbjct: 292 ILDVTLADRR 301

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%)

Query: 113 LNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHEN 172
           L  D+  +LFIG+L+ NV +  L   F   PGF+ A + ++  T +S G+G+++F    +
Sbjct: 86  LASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKID 145

Query: 173 AQAAMDQMQGHEINGRAIRI 192
           A  A   +    I    IR+
Sbjct: 146 AIRATKDLNYCNILSSEIRL 165

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 33  LYIGNLDKSINEDALKQYFQV-AGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           L+IGNL K++ E+ L+  F V  G I               + ++ +S   DA  A + L
Sbjct: 94  LFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAIRATKDL 153

Query: 92  NGIQIENKNIKI-----NWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFL 146
           N   I +  I++     N A++ Q         N+F+ +L +++   T    +    GF 
Sbjct: 154 NYCNILSSEIRLMPSMRNAAYRKQIGT------NVFMSNLPLDIPFLTTRFFYVYFSGFG 207

Query: 147 QAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           +   +   +    +G GF+ F+++  A   ++   G  + G+ +  +    +E
Sbjct: 208 E---VLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQVFCSIHKSKE 257

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 63/135 (46%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLND-------DTSFNLFI 123
           + ++++ T      A++ L+  Q+  +N  IK +  F+ + + +D         S  LF+
Sbjct: 160 FCYVDFKTIEQMESAVK-LSESQLNGRNLLIKNSKNFEGRPDKDDLVAASKNPPSRILFV 218

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F   + A  A+      
Sbjct: 219 GNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDKSCR 278

Query: 184 EINGRAIRINWATKR 198
           +I GR+IR+ +   R
Sbjct: 279 KIAGRSIRMEYGEDR 293

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL    ++D L+++FQ  G I                +AF+++     A  AL+
Sbjct: 214 RILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALK 273

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  ++I++ + 
Sbjct: 274 DKSCRKIAGRSIRMEYG 290

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 75/195 (38%), Gaps = 31/195 (15%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX----YAFIEYSTNHDANVAL 88
           L+IG +DK+I    L   F V G I                   Y F+ Y     A   +
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 89  QTLNGIQIENKNIKINWAFQSQTN-----LNDDTSFN------LFIGDL---NVNVDDTT 134
             LNG +I + N+ IN+    +       L+ D + N      +FIG+L    VN +  T
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 135 LANAFKSCPG----------FLQAHVMWDMQTSRS---RGYGFVSFDTHENAQAAMDQMQ 181
                ++              L  +   D    RS   +GYGFV   THE A   ++   
Sbjct: 290 CGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSFN 349

Query: 182 GHEINGRAIRINWAT 196
           G+E +G  + +N A 
Sbjct: 350 GYEFHGSKLIVNRAV 364

>Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}
           YCL011C (REAL)
          Length = 428

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/316 (19%), Positives = 109/316 (34%), Gaps = 31/316 (9%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  +   + LK+ F   G+I                  +E++ N     A+   +
Sbjct: 125 IFVRNLTFNCTPEDLKELFGTVGEIVEADIITSKGHHRGM-GTVEFTNNEAVQDAISKFD 183

Query: 93  GIQIENKNIKINWA----------FQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSC 142
           G    ++ + +              +  T    D  F +FI +L  +++  +L + FK C
Sbjct: 184 GALFMDRKLMVRQDNPPPEAAREFSKKATKEEIDNGFEVFIINLPYSINWQSLKDMFKEC 243

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA--TKREX 200
              L+A V  D     SRG+G V + T +    A+D   G E+ GR + +      KR+ 
Sbjct: 244 GHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRK- 301

Query: 201 XXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPRVT 260
                           Q R                          +  E  +     R  
Sbjct: 302 ----------DNDRYNQKREDLEEARDVKPDLVQDTTAHIDETAAKFTE-GVNPGGDRNC 350

Query: 261 TAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEK-----GCCFIKYDTHEQAAVCIVAL 315
             Y  N+P      DL  L    G I +    P+      G   ++Y+    A  CI  L
Sbjct: 351 FIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQDNGQPTGIAVVEYENLVDADFCIQKL 410

Query: 316 SNFQFQGRNLRTGWGK 331
           +N+ + G +L+  + +
Sbjct: 411 NNYNYGGCSLQISYAR 426

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 10  VVPVENVIPASAKEGGRETSDKVL------YIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           +V  +N  P +A+E  ++ + + +      +I NL  SIN  +LK  F+  G +      
Sbjct: 193 MVRQDNPPPEAAREFSKKATKEEIDNGFEVFIINLPYSINWQSLKDMFKECGHVLRADVE 252

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKI 103
                    +  + Y T  +   A+ T NG+++E + +++
Sbjct: 253 LDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEV 292

>TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON}
           Anc_1.408 YNL004W
          Length = 429

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 77/218 (35%), Gaps = 22/218 (10%)

Query: 119 FNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMD 178
           + +F+ ++       TL + FK     L+A V  D +   SRG+G V   T E+ + +++
Sbjct: 224 YEIFVANVPFATTWQTLKDLFKETGDVLRADVELD-RDGYSRGFGIVIMATKEDMERSIE 282

Query: 179 QMQGHEINGRAIRINWATKREXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXX 238
           +  G+E+ GR + +     R+                                       
Sbjct: 283 RFNGYELEGRKLDVRAGHGRKSPSSSSHEY-------------DSYYNDSAARSDSRKQE 329

Query: 239 XXXXXXXQAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFI------LDFTHY 292
                  Q  E ++     R    Y  N+P      DL  L    G I       D    
Sbjct: 330 RSDGVHRQFTEGVV-GGGERSNLIYCSNLPFTTARSDLYDLFGTIGQITNTDLKYDSDGK 388

Query: 293 PEKGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWG 330
           P  G   ++YD  E A +CI  L+N+ + G +L   +G
Sbjct: 389 P-TGIAIVEYDNIEDADICIDRLNNYTYGGCDLDISYG 425

>Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {ON}
           YPR112C (REAL)
          Length = 886

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 7/128 (5%)

Query: 75  FIEYSTNHDAN-VALQ-TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDD 132
            I  +TN + N V ++ + N +   NKNI    +     +  D  + ++FI +LN +  +
Sbjct: 616 LINNTTNEEENPVEIKPSSNDLMETNKNINEGSSAIHDEDSIDGPTVSIFIKNLNFSTTN 675

Query: 133 TTLANAFKSCPGFLQAHVMWD-----MQTSRSRGYGFVSFDTHENAQAAMDQMQGHEING 187
            TL + FK   GF+ A V           + S G+GFV F T E A A +  M G  I+G
Sbjct: 676 QTLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDG 735

Query: 188 RAIRINWA 195
             I++  +
Sbjct: 736 HKIQLKLS 743

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 9/129 (6%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLN-------DDTSFNLFIGD 125
           + F+E+ T   AN  +  ++G  I+   I++  + + QT+ N       +  S  + + +
Sbjct: 710 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHR-QTSKNGNAKAKSNKKSGKIIVKN 768

Query: 126 LNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           L        +   F S        V      S +RG+ FV F   + A+ AMDQ+ G  +
Sbjct: 769 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLHGVHL 827

Query: 186 NGRAIRINW 194
            GR + + +
Sbjct: 828 LGRRLVMQY 836

>Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii ABL134C
          Length = 390

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 63/135 (46%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           +A++++ +  +  +A+  L+ +Q+  +N  +K +  F  + + ND  S +       LF+
Sbjct: 178 FAYVDFKS-QEQMLAVIGLSELQLNGRNLLVKNSKGFTGRPDKNDLISLSKNPPSRILFV 236

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ N  +  L   F+ C   ++  +     T + +G+ FV F       A++      
Sbjct: 237 GNLSFNTTEELLKKHFQHCGNIVKIRMATFEDTGKCKGFAFVDFKDETGPTASLTDKSCR 296

Query: 184 EINGRAIRINWATKR 198
           +I  R IR+ +   R
Sbjct: 297 KIANRPIRMEYGEDR 311

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL  +  E+ LK++FQ  G I                +AF+++        +L 
Sbjct: 232 RILFVGNLSFNTTEELLKKHFQHCGNIVKIRMATFEDTGKCKGFAFVDFKDETGPTASLT 291

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I N+ I++ + 
Sbjct: 292 DKSCRKIANRPIRMEYG 308

>TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.491
           YPL043W
          Length = 742

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 109 SQTNLNDDTSFN-------LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRG 161
           ++ N ND  S +       LF+  + ++  D  LA+ F +      A ++ D Q  RSRG
Sbjct: 17  TKNNKNDSNSTDNDLDFKTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQ-KRSRG 75

Query: 162 YGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           +GFV+F   E+ + A+ Q +  ++    IR++ A +R+
Sbjct: 76  FGFVTFAVEEDTKEALKQARKTKLKNHLIRVDIAKRRD 113

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 43/232 (18%), Positives = 85/232 (36%), Gaps = 42/232 (18%)

Query: 8   ETVVPVENVIPASAKEGGRETSD----KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           E    VEN +  + K     T +    K L++ ++     +  L  YF     I      
Sbjct: 7   EKTTKVENPVTKNNKNDSNSTDNDLDFKTLFVRSIPLDTTDGELADYFSNFAPIRHAVIV 66

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNL---------N 114
                    + F+ ++   D   AL+     +++N  I+++ A +   N          N
Sbjct: 67  KDDQKRSRGFGFVTFAVEEDTKEALKQARKTKLKNHLIRVDIAKRRDRNKTKASSEQISN 126

Query: 115 DDTSFNLFI----GDLNVNVDDTTLANAFKSCPGFLQAHVMW------------------ 152
           D  S    +    G+ N + +D    + FK  P  +  ++ W                  
Sbjct: 127 DQNSEKKQVIDNHGEYNNDNEDPE-DSEFKGKPKLIIRNMPWSCRDPIKLKKIFSRFGNV 185

Query: 153 -DMQTSRSR-----GYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            D    R R     G+ FV+     N + A++  +  +I+GRA+ +++A ++
Sbjct: 186 VDASIPRKRDGKLCGFAFVTMKKISNCRIALENTKDLKIDGRAVAVDFAIQK 237

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA ++ +++ S   RSRGYGF+ +  H++A   +  +  H+I    I
Sbjct: 562 QAKIIMEVKGSTIGRSRGYGFIEYRDHKSALMGLRWLNAHKITTEEI 608

>NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON}
           Anc_1.408 YCL011C
          Length = 359

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/313 (19%), Positives = 111/313 (35%), Gaps = 45/313 (14%)

Query: 30  DKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQ 89
           D  +++GNL      + L  YF   G++                  +E++   DA  A++
Sbjct: 67  DNRVFVGNLSFDTTAEDLVDYFSQVGEVVTADIITFKGRHKGL-GTVEFTNADDATEAIE 125

Query: 90  TLNGIQIENKNIKIN------WAFQSQTNLN-----DDTSFNLFIGDLNVNVDDTTLANA 138
             +      ++I +        A Q    +      +   +  F+ +L  ++    L + 
Sbjct: 126 RCDNTHFMGRDIYVKDDQPPPGARQKTMRIAPIRDINRQGYEAFVINLPYSITWQNLKDL 185

Query: 139 FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F+ C   L+A +  D     SRG G V + T +    A+D   G+E+ GR + +     R
Sbjct: 186 FRECGDILRADIELDYN-GFSRGLGSVLYATEDAMHRAIDTFNGYELEGRVLEV-----R 239

Query: 199 EXXXXXXXXXXXXXXXXXQVRNRXXXXXXXXXXXXXXXXXXXXXXXXQAVEDMIRRAPPR 258
           E                 +V                             VE ++     R
Sbjct: 240 EGKFNPSHKEHIPEGTLDEVE-------------------PSIPTQSPFVEGVVGNG-ER 279

Query: 259 VTTAYIGNIPHFATEPDLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAAVCI 312
             T +  ++P   T PDL  L  +FG       I D T+    G   ++Y + + A +CI
Sbjct: 280 NPTVFCQSLPLSTTVPDLYDLFGSFGDINHAELIYD-TNGLSTGSAVVEYMSADYAEMCI 338

Query: 313 VALSNFQFQGRNL 325
             L+N+ + G  L
Sbjct: 339 DKLNNYNYGGHQL 351

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  +V D  LA+ F +      A V+ D    RSRG+GFVSF   ++ + A+ + 
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAKA 86

Query: 181 QGHEINGRAIRINWATKRE 199
           +  + NG  +R++ A +R+
Sbjct: 87  RKTKFNGHILRVDIAKRRD 105

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA V+ +++ S   RSRGYGFV F  H+NA   +  +  H +    I
Sbjct: 537 QAKVIMEVKGSTAGRSRGYGFVEFRDHKNALMGLRWLNCHAVTSDEI 583

>NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}
           Anc_7.93 YOL041C
          Length = 448

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 13/129 (10%)

Query: 74  AFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDT 133
           A+I Y      N+    LNG    N +++++       +   D   ++F+G+L+   D+ 
Sbjct: 233 AYIVYKNKQAVNIISSKLNGNVFHNHHLRVDSVAHPAPH---DKKRSIFVGNLDFEEDEE 289

Query: 134 TLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM----DQM------QGH 183
            L N FKSC       ++ D +T+  +G+ +V F   E+   A+     QM      + +
Sbjct: 290 NLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLNEKQMTKIKTDKDN 349

Query: 184 EINGRAIRI 192
           +  GR +R+
Sbjct: 350 KKKGRKLRV 358

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  +V D  LA+ F +      A V+ D    RSRG+GFVSF   ++ + A+ + 
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALIKA 86

Query: 181 QGHEINGRAIRINWATKRE 199
           +  + NG  +R++ A +R+
Sbjct: 87  RKTKFNGHTLRVDVAKRRD 105

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++ S   RSRGYGFV F  H+NA   +  +  H +
Sbjct: 532 QAKVIMEVKGSTAGRSRGYGFVEFRDHKNALMGLRWLNCHAV 573

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/224 (16%), Positives = 80/224 (35%), Gaps = 33/224 (14%)

Query: 8   ETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXX 67
           ET+  VE      +K+       K L++ ++ + + ++ L  +F     I          
Sbjct: 3   ETIESVEAPTSNVSKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTN 62

Query: 68  XXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTN--------LNDDTSF 119
                + F+ ++   D   AL      +     ++++ A +   +        +    SF
Sbjct: 63  KRSRGFGFVSFAVEDDTKEALIKARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESF 122

Query: 120 NLFIGDLNVNVDDTTLANA-FKSCPGFLQAHVMWDMQTS-------------------RS 159
              IG    N  D    ++  K  P  +  ++ W  + S                   R 
Sbjct: 123 EKTIGQKTENEHDADGEDSMLKGKPKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPRK 182

Query: 160 R-----GYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           R     G+ FV+     N + A++  +  +I+GR + +++A ++
Sbjct: 183 RDGKLCGFAFVTMKKISNCRIALENSKDLKIDGRKVAVDFAVQK 226

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 71/170 (41%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+ YF   G+ I               + F+ +      +  ++T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        ++      D +  +F+G +  +V        F      + A
Sbjct: 219 HILDGKVIDPK--------RAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDA 270

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ + A   + Q +  +  G+ I I  A  R
Sbjct: 271 QLMLDKDTGRSRGFGFVTYDSPD-AVDRVCQNKFIDFKGKKIEIKRAEPR 319

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           +FIG LN    + TL + F      +   +M D  T RSRG+GF++FD   +    +   
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 181 QGHEINGRAIRINWATKRE 199
             H ++G+ I    A  RE
Sbjct: 219 --HILDGKVIDPKRAIPRE 235

>NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON}
           Anc_3.432
          Length = 843

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN------LFIGDL 126
           + F E+ T   AN  +  ++G  I+   I++  + +  T  N+ +S N      + + +L
Sbjct: 691 FGFAEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQGTKGNNTSSKNKTKSAKIIVKNL 750

Query: 127 NVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
                   +   F S        V      S +RG+ F+ F   + A+ AMDQ+QG  + 
Sbjct: 751 PFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFIEFLLPKEAENAMDQLQGVHLL 809

Query: 187 GRAIRINWA 195
           GR + + +A
Sbjct: 810 GRRLVMQYA 818

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQ-----TSRSRGYGFVSFDT 169
           D  + ++FI +LN +   + L + FK   GF+ A V           + S G+GF  F T
Sbjct: 639 DGPTVSIFIKNLNFSTSSSDLTSRFKVFNGFVVAQVKTKPDPKHPNKTLSMGFGFAEFRT 698

Query: 170 HENAQAAMDQMQGHEINGRAIRINWA 195
            E A A +  M G  I+G  I++  +
Sbjct: 699 KEQANAVIAAMDGTVIDGHKIQLKLS 724

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 109 SQTNLNDDTSFN-LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSF 167
           S T  ND      LF+  +  +V D  +   F +      A ++ D Q  +SRG+GFVSF
Sbjct: 15  SSTKSNDGLDMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQ-KKSRGFGFVSF 73

Query: 168 DTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
              ++  AA+ + +  ++  R +RI+ A +R+
Sbjct: 74  AVEDDTLAALKEARKTKLKDRLLRIDIAKRRD 105

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA V+ +++ S   RSRGYGFV F  H++A   +  M  H++    I
Sbjct: 542 QAKVIMEVKGSNVGRSRGYGFVEFKDHKHALMGLRWMNVHQVTSDEI 588

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           + ++++ T      A+ +L+   +  +N  IK + +F  + + ND  S +       LF+
Sbjct: 167 FCYMDFETTEQMEAAI-SLSESHLNGRNLLIKNSKSFDGRPDKNDLVSLSKNPPSRILFV 225

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F   E A  A+      
Sbjct: 226 GNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKDEEGATNALKDKGCR 285

Query: 184 EINGRAIRINWATKR 198
           +I  R IR+ +   R
Sbjct: 286 KIAQRPIRMEYGEDR 300

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL     ++ LK++FQ  G+I                +AF+++     A  AL+
Sbjct: 221 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKDEEGATNALK 280

Query: 90  TLNGIQIENKNIKINWA 106
                +I  + I++ + 
Sbjct: 281 DKGCRKIAQRPIRMEYG 297

>KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.250
           YIL061C
          Length = 285

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 114 NDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENA 173
           N D    +FIG L  NV +  L   F       +  ++ D++T + +GYGF+ F+    A
Sbjct: 101 NTDPYKTIFIGRLPYNVTEIELQKIFIKFGEIEKIRIVKDIKTDKPKGYGFILFNEANAA 160

Query: 174 QAAMDQMQGH---EINGRA 189
           + A+ ++  H   EINGR+
Sbjct: 161 KMAVREIGTHRGIEINGRS 179

>ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR112C
           (MRD1)
          Length = 838

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 109 SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMW-----DMQTSRSRGYG 163
           S+    D  + ++F+ +LN +     LA  FK   GF+ A V       +     S G+G
Sbjct: 602 SEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFG 661

Query: 164 FVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           F+ F T E A A +  M G  I+G  I++  + K+
Sbjct: 662 FIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQ 696

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 60/129 (46%), Gaps = 7/129 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVD- 131
           + FIE+ T   A   +  ++G  I+   I++  + + Q++L   +  +       + V  
Sbjct: 660 FGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHK-QSSLPKTSKGSKKKISGKIIVKN 718

Query: 132 ---DTTLANAFK--SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
              + T  + F+  S  G L++  +       +RG+ FV F     A+ AMDQ+QG  + 
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLL 778

Query: 187 GRAIRINWA 195
           GR + + +A
Sbjct: 779 GRRLVMQYA 787

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 32/73 (43%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
            LF+ ++  +  +      F       + HV  D +T +S+G+ +V F   E+A  A  +
Sbjct: 302 RLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIE 361

Query: 180 MQGHEINGRAIRI 192
           +      GR + I
Sbjct: 362 LDKQIFQGRLLHI 374

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +   V D  L   F +      A V+ D+   +SRG+GFVSF + E+ + A+ + 
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDV-NKKSRGFGFVSFASEEDTKEALLKA 77

Query: 181 QGHEINGRAIRINWATKRE 199
           +  ++NG+ +R++ A +RE
Sbjct: 78  RKEKLNGQLLRVDIAKRRE 96

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++ S   RSRGYGF+ +  H++A   +  +  HE+
Sbjct: 537 QAKVIMEVKNSTVGRSRGYGFIEYKDHKHALMGLRWLNVHEV 578

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           +LFIG L   V +  L   FK    F  A +  D  T +S GYG+++F   ++A+AA  +
Sbjct: 112 SLFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKE 171

Query: 180 MQGHEINGRAIRI 192
                  G+ ++I
Sbjct: 172 FNYRIFFGQEVKI 184

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 70/170 (41%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L+ YF   G +                + F+ +      +  ++T 
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        ++      D +  +F+G +  +V        F      + A
Sbjct: 226 HILDGKVIDPK--------RAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDA 277

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GFV++D+ + A   + Q +  E  G+ I I  A  R
Sbjct: 278 QLMLDKDTGRSRGFGFVTYDSPD-AVDRVCQSKYIEFKGKQIEIKRAEPR 326

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S  +FIG LN    + TL + F      ++  +M D  T RSRG+GF++F   ENA +  
Sbjct: 163 SCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTF---ENASSVD 219

Query: 178 DQMQG-HEINGRAIRINWATKRE 199
           + ++  H ++G+ I    A  RE
Sbjct: 220 EVVKTQHILDGKVIDPKRAIPRE 242

>YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}
           SGN1Cytoplasmic RNA-binding protein, contains an RNA
           recognition motif (RRM); may have a role in mRNA
           translation, as suggested by genetic interactions with
           genes encoding proteins involved in translational
           initiation
          Length = 250

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S ++F+G++  +V    + + FK C    +  +++D  T   +GYG++ F++    + A+
Sbjct: 63  SRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

Query: 178 DQMQGHEINGRAIRI 192
            Q+ G E+ G+ I +
Sbjct: 123 -QLNGGELKGKKIAV 136

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S  L+IGDL   V +  L N F      L   +  D  +  S GYG+++  T E A   M
Sbjct: 98  SIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLM 157

Query: 178 DQMQGHEINGRAIRI 192
           ++     I G+ +RI
Sbjct: 158 ERFNYTPIFGKVVRI 172

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 84/181 (46%), Gaps = 20/181 (11%)

Query: 33  LYIGNLDKSINEDALKQYFQV-AGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LYIG+L+K + ED LK +F +    +               Y ++  +T  +A+  ++  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 92  NGIQIENKNIKINWAFQ-SQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHV 150
           N   I  K ++I  + + SQT  N  T  N+F  DL ++    T  + +     F +A+ 
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGT--NVFFSDLPLSEKSITTRDFY----NFFKAYG 214

Query: 151 -MWDMQTSRSRGYGFVSFDTHENAQAAMDQ------MQGHEIN-----GRAIRINWATKR 198
            +   + + S+  GF+ F+   +A+  + +      + G++IN      ++IR N  T++
Sbjct: 215 NILSCKLNTSKNIGFIFFENESSAKEVISKFNANELLYGYKINCGVHIDKSIRKNLGTEK 274

Query: 199 E 199
           +
Sbjct: 275 Q 275

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +     D  L N F        A ++ D + + SRG+GFVSF   ++ + A+++ 
Sbjct: 23  LFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAVEDDTKDALEKA 81

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +  GR +R++ A +RE
Sbjct: 82  RKTKFKGRLLRVDIAKRRE 100

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++ S   RSRGYGFV F  H+ A   +  +  HE+
Sbjct: 546 QAKVIMEVKGSSVGRSRGYGFVEFRDHKAALMGLRWLNAHEV 587

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 4/168 (2%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           LY+GN+D  +  + L + F Q    +               YAF+   +  DA+ A+Q L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 92  -NGIQIENKNIKINWAFQSQTNLNDDTSF-NLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
            N + +  + +KI  A        D      L++G L   VD   LA  F       +  
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYRPP 127

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            +     +  R Y  V F ++ +A AA+D + G  + G  + + +A +
Sbjct: 128 TVHPAGEA-GRRYALVEFRSYGDADAALDALAGATLAGGRVSVAYARR 174

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 13/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQ-IXXXXXXXXXXXXXXXYAFI--EYSTNHDANVALQ 89
           ++IG L+    ED L+ YF   G  I               + F+  E+ ++ D  V  Q
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 90  -TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        +S      D    +F+G +  +V        F      + A
Sbjct: 259 HILDGKVIDPK--------RSIPKEEQDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDA 310

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
            +M D  T RSRG+GF+++D+ + A   + Q +  +  G+ I +  A +R
Sbjct: 311 QLMLDKDTGRSRGFGFITYDSAD-AVDKVCQNKYIDFKGKQIEVKRAQQR 359

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 108 QSQTNLNDDTSFN---LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGF 164
           Q Q N+  D S +   +FIG LN    +  L N F      ++  +M D  T RSRG+GF
Sbjct: 183 QPQQNVKADISKDSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGF 242

Query: 165 VSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
           ++F+ H ++   + + Q H ++G+ I    +  +E
Sbjct: 243 LTFE-HPSSVDEVVKTQ-HILDGKVIDPKRSIPKE 275

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAV--CI 312
           AP R  T Y+GNIP   T  +L+  +++ G + D    PEK C FI +     A +    
Sbjct: 166 APSR--TVYLGNIPTTLTVKELLDHVRS-GVVEDVKILPEKMCAFISFVDDSSALLFHSD 222

Query: 313 VALSNFQFQGRNLRTGWGK 331
             L     +GR+++ GWGK
Sbjct: 223 AILKRLNIEGRDIKIGWGK 241

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 262 AYIGNI---------PHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI 312
            YIGNI             TE +L  L Q +G +      P K CCFI Y     A   I
Sbjct: 502 VYIGNIDFEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAI 561

Query: 313 VAL-SNFQFQGRNLRTGWGKER 333
             + SN  F  ++L+  +GK+R
Sbjct: 562 DKIKSNPYF--KDLKINFGKDR 581

>Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {ON}
           YPR112C (REAL)
          Length = 879

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 13/132 (9%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAF-QSQTNLNDDTSFNLFIGDLNVN-- 129
           + F+E+ T   AN  +  ++G  I+   I++  +  QS  N N  T  N   G + V   
Sbjct: 703 FGFVEFRTKEQANAVISAMDGTVIDGHKIQLKLSHRQSSQNSNTKTKSNKRSGKIIVKNL 762

Query: 130 ------VDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
                  D   L N+F    G L++  +       +RG+ FV F   + A+ AMDQ+ G 
Sbjct: 763 PFEATRKDVFELFNSF----GQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 818

Query: 184 EINGRAIRINWA 195
            + GR + + +A
Sbjct: 819 HLLGRRLIMQYA 830

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWD-----MQTSRSRGYGFVSFDTHEN 172
           + ++FI +LN +  +  L + FK+  GF+ A V           + S G+GFV F T E 
Sbjct: 654 TVSIFIKNLNFSTTNQNLTDRFKAFSGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQ 713

Query: 173 AQAAMDQMQGHEINGRAIRINWA 195
           A A +  M G  I+G  I++  +
Sbjct: 714 ANAVISAMDGTVIDGHKIQLKLS 736

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 32/72 (44%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+ ++  N  +      F       + HV  D +T +S+G+ +V F   +NA  A  ++
Sbjct: 339 LFLRNILYNSKEEDFKELFGPFGDLEEVHVALDTRTGQSKGFAYVLFKDPKNAVNAYVEL 398

Query: 181 QGHEINGRAIRI 192
                 GR + I
Sbjct: 399 DKQIFQGRLLHI 410

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F   E A  A+   
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 295 SCRKIAGRPLRMEFGEDR 312

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/181 (18%), Positives = 73/181 (40%), Gaps = 23/181 (12%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++GNL      + L+ +F   G++                  +E++   D N A+   +
Sbjct: 70  VFVGNLTYDCTPEDLRDHFSTIGEVVRADIITSRGHHRGM-GTVEFTNADDVNEAISQYD 128

Query: 93  GIQIENKNIKINW---------------------AFQSQTNLNDDTSFNLFIGDLNVNVD 131
           G  + ++ I +                          +  +L+    + +FI +L  +++
Sbjct: 129 GSYLLDRQIFVRQDNPPPEASHESEPPRERRERRTLGNDGSLHSHIGYEVFIANLPYSIN 188

Query: 132 DTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIR 191
              L + FK C   ++A V  D +   SRG+G V   + E+ + A+    G+E+ GR + 
Sbjct: 189 WQALKDMFKECGSVIRADVELD-RNGYSRGFGTVILGSQEDMERAISMYNGYELEGRVLE 247

Query: 192 I 192
           +
Sbjct: 248 V 248

 Score = 36.2 bits (82), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 263 YIGNIPHFATEPDLIPLLQNFGFI----LDFTHYPE-KGCCFIKYDTHEQAAVCIVALSN 317
           Y  N+P    + DL  L +  G +    L F       G   ++Y+  + A VC+  L+N
Sbjct: 301 YCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVDRLNN 360

Query: 318 FQFQGRNLRTGWGK 331
           + + G +L   +GK
Sbjct: 361 YNYGGCDLDISYGK 374

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 34/201 (16%), Positives = 74/201 (36%), Gaps = 36/201 (17%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           ++I NL  SIN  ALK  F+  G +               +  +   +  D   A+   N
Sbjct: 178 VFIANLPYSINWQALKDMFKECGSVIRADVELDRNGYSRGFGTVILGSQEDMERAISMYN 237

Query: 93  GIQIENKNIKINWAFQSQTN----LNDDTSFN---------------------------- 120
           G ++E + +++     +  +    +++D   N                            
Sbjct: 238 GYELEGRVLEVREGRSNNQDEEMPISEDIEINDNGNDINDENAGTSDQFTDGVVGGGEKN 297

Query: 121 --LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMD 178
             ++  +L  +   + L + F++      A + +D Q     G   V ++  ++AQ  +D
Sbjct: 298 ELIYCSNLPFSTAKSDLFDLFETIGKLKNAELKFD-QKGNPTGVAIVEYENVDDAQVCVD 356

Query: 179 QMQGHEINGRAIRINWATKRE 199
           ++  +   G  + I++  KRE
Sbjct: 357 RLNNYNYGGCDLDISYG-KRE 376

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 12/180 (6%)

Query: 29  SDKVLYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVA 87
           SD  +Y+GN+D  I +D L + F Q+   +               YAFIE+    DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 88  LQTLNG-IQIENKNIKINWAFQS--QTNLNDDTSFN-------LFIGDLNVNVDDTTLAN 137
           +Q +N  +++ ++ IK+     S    NL+ + S +       LF+ +L  ++D   LA 
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSIDIDQLAK 126

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F      +    ++ +   + +    V F+  E A  A+  +    +    I I++A K
Sbjct: 127 IFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDYAFK 185

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFI  LN       +A  F+     L   ++ D +T  S GYGF+ F+T E  + A  +M
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 181 QGHEINGRAIRINWA 195
               I+ R I ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 19/174 (10%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    E+ L+ YF   G +                + F+ +      +  ++T 
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K   I    Q +T         +F+G +  +V        F      + A
Sbjct: 248 HILDGKVIDPKRA-IPREEQDKTG-------KIFVGGIGPDVRPKEFEEFFSQWGSIIDA 299

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH---EINGRAIRINWATKRE 199
            +M D  T RSRG+GF+++DT +    A+D++  +   E  G+ I I  A  R+
Sbjct: 300 QLMLDKDTGRSRGFGFITYDTPD----AVDRVCQNKFIEFKGKQIEIKRAEPRQ 349

>Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON}
           YCL011C (REAL)
          Length = 429

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 12/170 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  +   + LK+ F   G+I                  +E++ N     A+   +
Sbjct: 126 IFVRNLTFNCTPEDLKELFGTVGEIVEADIITSKGHHRGM-GTVEFTNNESVQDAISKFD 184

Query: 93  GIQIENKNIKINWA----------FQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSC 142
           G    ++ + +              +  T    D  F +FI +L  +++  +L + FK C
Sbjct: 185 GALFMDRKLMVRQDNPPPEAAKEFSKKATKEEIDNGFEVFIINLPYSINWQSLKDMFKEC 244

Query: 143 PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
              L+A V  D     SRG+G V + T +    A+D   G E+ GR + +
Sbjct: 245 GHVLRADVEVDF-NGFSRGFGSVIYPTKDEMIRAIDTFNGMEVEGRVLEV 293

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 10  VVPVENVIPASAKEGGRETSDKVL------YIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           +V  +N  P +AKE  ++ + + +      +I NL  SIN  +LK  F+  G +      
Sbjct: 194 MVRQDNPPPEAAKEFSKKATKEEIDNGFEVFIINLPYSINWQSLKDMFKECGHVLRADVE 253

Query: 64  XXXXXXXXXYAFIEYSTNHDANVALQTLNGIQIENKNIKI 103
                    +  + Y T  +   A+ T NG+++E + +++
Sbjct: 254 VDFNGFSRGFGSVIYPTKDEMIRAIDTFNGMEVEGRVLEV 293

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 75/168 (44%), Gaps = 4/168 (2%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           +Y+GNLD  ++++ L + F QVA                  +AF+E  +  D + A+++L
Sbjct: 9   VYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIKSL 68

Query: 92  NG-IQIENKNIKINWAFQSQTNLNDD-TSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
           N  + +  K +K+    ++  N         LF+ +L+  +D   L   F       +  
Sbjct: 69  NNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPLAKPP 128

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            ++ ++    R   +V F T  ++  A++++    +  + I I++A K
Sbjct: 129 QLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+ ++     D  L + F        A ++ D   + SRG+GFVSF   E+ Q A+++ 
Sbjct: 18  LFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGDGN-SRGFGFVSFAVDEDTQTALNEG 76

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +  GR +R++ A +RE
Sbjct: 77  RKMKFQGRLLRVDIAKRRE 95

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
           Q+ ++ +++ S   RS+GYGFV +  H++A   +  +  HE++
Sbjct: 529 QSKIIMEVKGSVVGRSKGYGFVEYRDHKSALMGLRWLNAHEVS 571

>Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}
           YIR001C (REAL)
          Length = 250

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S ++F+G++ ++V    +   F+ C    +  +++D  T   +GYG++ F++    + A+
Sbjct: 63  SRSIFVGNITLDVTPEQIEEHFQDCGLIKRITLLYDRNTGAPKGYGYIEFESPAFREKAL 122

Query: 178 DQMQGHEINGRAIRI 192
            Q+ G E+NG+ I +
Sbjct: 123 -QLNGVELNGKKIAV 136

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 116 DTSFNLFIGDLNVNVDDTTLANAFKSC-PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQ 174
           D +  L I  LN N D+ T+     S  P   +  V+ + +T RSRG  +V+F + ++A+
Sbjct: 185 DDAMTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAE 244

Query: 175 AAMDQMQGHEINGRAIRINWATKRE 199
            A+  + G       ++++W+  ++
Sbjct: 245 TALRLLHGRGFMNLILQVDWSKPKK 269

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 120 NLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQ 179
           NLF+ +L+ +VDD  L   F      + A VM   +  +S+ +GFV F T E A  A+ +
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMR-TEDGKSKNFGFVCFSTPEEATRAITE 80

Query: 180 MQGHEINGRAIRINWATKRE 199
                + G+ + +  A ++E
Sbjct: 81  KNQQIVAGKPLYVAIAQRKE 100

>TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa]
           {ON} Anc_1.408 YNL004W
          Length = 345

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           ++ +F+ +L  +++   L + FK     ++A V  D +   SRG+G   F T E  QAA+
Sbjct: 152 AYEVFVANLPYSINWQALKDMFKEVGNVIRADVELD-RNGYSRGFGTAIFGTSEEMQAAI 210

Query: 178 DQMQGHEINGRAIRI 192
           ++  G+E+ GR + +
Sbjct: 211 ERYNGYELEGRVLDV 225

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 31/71 (43%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           +++ NL  SIN  ALK  F+  G +               +    + T+ +   A++  N
Sbjct: 155 VFVANLPYSINWQALKDMFKEVGNVIRADVELDRNGYSRGFGTAIFGTSEEMQAAIERYN 214

Query: 93  GIQIENKNIKI 103
           G ++E + + +
Sbjct: 215 GYELEGRVLDV 225

>CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {ON}
           highly similar to uniprot|Q06106 Saccharomyces
           cerevisiae YPR112c MRD1
          Length = 861

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSR-----SRGYGFVSFDT 169
           D  + ++FI +LN       L + FK   GF+ A V       +     S G+GFV F T
Sbjct: 636 DGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRT 695

Query: 170 HENAQAAMDQMQGHEINGRAIRINWA 195
            E A A +  M G  I+G  I++  +
Sbjct: 696 KEQATAVISAMDGTVIDGHKIQLKLS 721

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 50/123 (40%), Gaps = 7/123 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQ-----SQTNLNDDTSFNLFIGDLN 127
           + F+E+ T   A   +  ++G  I+   I++  + +     SQ          + + +L 
Sbjct: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEKKKAKNG-KIIVKNLP 746

Query: 128 VNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEING 187
                  +   F S        V      S +RG+ FV F   + A+ AMDQ+QG  + G
Sbjct: 747 FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLG 805

Query: 188 RAI 190
           R +
Sbjct: 806 RRL 808

>NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON}
           Anc_8.797
          Length = 258

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 82/179 (45%), Gaps = 16/179 (8%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           +Y+GN+D ++ +  L + F QV+                  YAFIE+ T  D N  ++ +
Sbjct: 51  VYVGNIDPNVTKAQLYELFVQVSPISKIAYPKDKLLQTHQGYAFIEFYTPEDTNYVVKVM 110

Query: 92  NG-IQIENKNIKINWAFQSQTNLNDDTSF-----------NLFIGDLNVNVDDTTLANAF 139
           N  + + ++ +K+  + Q+  + N+ T              +F+ +L+ +VD   L+N F
Sbjct: 111 NNTVSLYDRFLKVRKSVQNLPSSNNKTYTTSKQVEVLPIAKVFVKNLDESVDIQQLSNIF 170

Query: 140 -KSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            K  P F +  + +    +    + F  F  + ++ AA+ ++    I  + I +++A K
Sbjct: 171 EKFGPLFKEPEIFYLSNNTLRCAHIFFKF--YPDSDAAIGKLDNELIANKRINLDYAYK 227

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (48%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +V D  L   F+ C   ++  +     + + +G+ F+ F   E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL   + +D L+++FQ  G I                +AFI++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  + +++ + 
Sbjct: 299 DKSCRKIAGRPLRMEYG 315

>Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp,
           331 aa] {ON} similar to Ashbya gossypii ADL063W 1-intron
          Length = 331

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 104 NWAFQSQTNLNDDTSFN-LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGY 162
            W  +  +N+ND   F  +F+G L   VD+  L   F       +  ++ D  T+  +GY
Sbjct: 91  KWVPEEDSNINDTDPFRTIFVGRLPYEVDELELQKQFIKFGDIERVRIVRDKLTNEPKGY 150

Query: 163 GFVSFDTHENAQAAMDQMQGHE---INGRAIRIN 193
            FV F   E ++ A  ++  H    I GR + ++
Sbjct: 151 AFVLFKDTEGSRKAYREIGVHRGLLIKGRPVIVD 184

>Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}
           YIR001C (REAL)
          Length = 250

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S ++F+G++ ++V    +   F+ C    +  +++D  T   +GYG++ F++    + A+
Sbjct: 63  SRSIFVGNITLDVTPEQIEELFQDCGIIKRITLLYDRNTGAPKGYGYIEFESPAFREKAL 122

Query: 178 DQMQGHEINGRAIRI 192
            Q+ G E+ G+ I +
Sbjct: 123 -QLNGAELKGKKIAV 136

>Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}
           YIR001C (REAL)
          Length = 249

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S ++F+G++  NV    +   F+ C    +  +++D  T   +GYG++ F++    + A+
Sbjct: 63  SRSIFVGNITPNVTPEQIEEHFQECGLIKRITLLYDRNTGTPKGYGYIEFESPAFREKAL 122

Query: 178 DQMQGHEINGRAIRI 192
            Q+ G E+ G+ I +
Sbjct: 123 -QLNGAELKGKKIAV 136

>TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66
           YGL044C
          Length = 279

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 8/82 (9%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQA 308
           AP +V   Y+G+IP+  TE  ++ L  N G       + D      KG  F++Y   E +
Sbjct: 13  APSKVV--YLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESS 70

Query: 309 AVCIVALSNFQFQGRNLRTGWG 330
           A  +  L+ +QF  R L+ G+ 
Sbjct: 71  ASAVRNLNGYQFGSRLLKCGYA 92

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 150 VMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
           +M+D QT +S+GY FV +   E++ +A+  + G++   R ++  +A+
Sbjct: 47  MMFDPQTGKSKGYAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYAS 93

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDT 117
           YAF+EY     +  A++ LNG Q  ++ +K  +A  S  +++D +
Sbjct: 59  YAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYASNSDISVSDSS 103

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (48%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +V D  L   F+ C   ++  +     + + +G+ F+ F   E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL   + +D L+++FQ  G I                +AFI++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  + +++ + 
Sbjct: 299 DKSCRKIAGRPLRMEYG 315

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIG+L   V +  L   FK    F  A V  D  T +S GYG+++F    +A++A  + 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 181 QGHEINGRAIRI 192
                 G+ ++I
Sbjct: 173 NYTVFFGQEVKI 184

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/172 (19%), Positives = 80/172 (46%), Gaps = 8/172 (4%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           +Y+GN+D  + ++ L + F QV+                  +AF+E+ T  D    +Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 92  NG-IQIENKNIKINWA-FQSQTNLNDDTSF----NLFIGDLNVNVDDTTLANAFKSCPGF 145
           N  +Q+ ++ +K+  A  QS  +   D +      +F+ +L+ ++D+  L+  F      
Sbjct: 72  NNTVQLYDRFLKVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPL 131

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            +   ++ +   + R   ++ F  ++++  A+  + G  +  + + +++A K
Sbjct: 132 AKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 6/96 (6%)

Query: 19  ASAKEGGRETSDKVL------YIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXX 72
           A+ +  G +T D  +      ++ NLD SI+E  L + F   G +               
Sbjct: 87  ANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSDGQLR 146

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQ 108
            A+I +     +++AL TLNG  + NK + +++AF+
Sbjct: 147 CAYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (48%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +V D  L   F+ C   ++  +     + + +G+ F+ F   E +  A+   
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 298 SCRKIAGRPLRMEYGEDR 315

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/77 (19%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL   + +D L+++FQ  G +                +AFI++     +  AL+
Sbjct: 236 RILFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 295

Query: 90  TLNGIQIENKNIKINWA 106
             +  +I  + +++ + 
Sbjct: 296 DKSCRKIAGRPLRMEYG 312

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 13/171 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFIEYSTNHDANVALQT- 90
           ++IG L+    ED L++YF   G +                + F+ ++     +  ++T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 91  --LNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQA 148
             L+G  I+ K        +S        +  +F+  +  +V        F      + A
Sbjct: 225 HILDGKVIDPK--------ESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDA 276

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKRE 199
            +M D  T RSRG+GF+++D+ + A   + Q +  E  G+ I I  A  R+
Sbjct: 277 QLMLDKDTGRSRGFGFITYDSPD-AVDRVCQNKFIEFKGKRIEIKRAEPRQ 326

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 106 AFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFV 165
           A Q + +L+ D +  +FIG LN    +  L   F       +  +M D  T RSRG+GF+
Sbjct: 151 AKQVKADLSRDIN-KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFL 209

Query: 166 SF 167
           SF
Sbjct: 210 SF 211

>YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON}
           MRD1Essential conserved protein that is part of the 90S
           preribosome; required for production of 18S rRNA and
           small ribosomal subunit; contains five consensus
           RNA-binding domains
          Length = 887

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 115 DDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWD-----MQTSRSRGYGFVSFDT 169
           D  + ++FI +LN +  +  L + FK   GF+ A V           + S G+GFV F T
Sbjct: 659 DGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRT 718

Query: 170 HENAQAAMDQMQGHEINGRAIRINWA 195
            E A A +  M G  I+G  I++  +
Sbjct: 719 KEQANAVIAAMDGTVIDGHKIQLKLS 744

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 13/131 (9%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAF-QSQTNLNDDTSFNLFIGDLNVN-- 129
           + F+E+ T   AN  +  ++G  I+   I++  +  Q+  + N  T  N   G + V   
Sbjct: 711 FGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVKNL 770

Query: 130 ------VDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
                  D   L N+F    G L++  +       +RG+ FV F   + A+ AMDQ+ G 
Sbjct: 771 PFEATRKDVFELFNSF----GQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826

Query: 184 EINGRAIRINW 194
            + GR + + +
Sbjct: 827 HLLGRRLVMQY 837

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 147 QAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRI 192
           + HV  D +T +S+G+ +V F   +NA  A  ++      GR + I
Sbjct: 373 EVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHI 418

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 312
           AP R  T Y+GNIP   T  DL+  +++ G I +    PEK C FI +   E +++    
Sbjct: 165 APSR--TVYLGNIPPTLTASDLLDHVRS-GVIEEVKILPEKMCAFISF-LDENSSLLFHS 220

Query: 313 -VALSNFQFQGRNLRTGWGK 331
              L      G++++ GWGK
Sbjct: 221 DAILKRLNIDGKDIKIGWGK 240

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 10/81 (12%)

Query: 262 AYIGNI---------PHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI 312
            YIGNI           + T+ +L  +   +G +        K CCF+ Y     A   I
Sbjct: 508 VYIGNIDFTADGTKRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAI 567

Query: 313 VALSNFQFQGRNLRTGWGKER 333
             + N     +NL+  +GK+R
Sbjct: 568 DKIKN-NPTFKNLKINFGKDR 587

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 10/142 (7%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXX-XXXXXXXXXXXYAFI--EYSTNHDANVALQ 89
           L+IG L+    E+ LK YF   G +                + F+  E+ ++ D  V  Q
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 90  TLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAH 149
            +    ++ K I    A   +     D +  +F+G +  +V        F      + A 
Sbjct: 291 HI----LDGKVIDPKRAIPREEQ---DKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 343

Query: 150 VMWDMQTSRSRGYGFVSFDTHE 171
           +M D  T RSRG+GF+++D+ E
Sbjct: 344 LMLDKDTGRSRGFGFITYDSGE 365

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           S  LFIG LN    +  L + F      +   +M D  + RSRG+GF+SF+ H ++   +
Sbjct: 228 SCKLFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFE-HPSSVDEV 286

Query: 178 DQMQGHEINGRAIRINWATKRE 199
            + Q H ++G+ I    A  RE
Sbjct: 287 VKSQ-HILDGKVIDPKRAIPRE 307

>Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015W
           (REAL)
          Length = 662

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LFIG L   V +  L   FK    F  A V  D  T +S GYG+++F +  +A AA    
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 181 QGHEINGRAIRI 192
                 G+ ++I
Sbjct: 178 NYTLFFGQEVKI 189

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 72/192 (37%), Gaps = 13/192 (6%)

Query: 4   QQPSETVVPVENVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXX 63
           Q   + V  + NV  +S K+  +      L+IG L  ++ E+ LKQ F+           
Sbjct: 89  QTQKKLVSGMYNVKESSEKKCSKTPKVSSLFIGKLKPTVTEEMLKQTFKKYQSFESAKVC 148

Query: 64  XXXXXXXXX-YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLF 122
                     Y ++ + +  DA+ A +  N      + +KI  + +       +T F   
Sbjct: 149 RDFLTKKSLGYGYLNFKSEGDADAAKKDFNYTLFFGQEVKIMPSMK-------NTLFRKN 201

Query: 123 IGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTS----RSRGYGFVSFDTHENAQAAMD 178
           IG  NV   +  L N   +   F    + +    S    + +  GFV FD   +A+  + 
Sbjct: 202 IGT-NVFFSNLPLDNPHLTTRSFYLIMIEYGNVLSCLLEKRKDIGFVYFDNDISARNVIK 260

Query: 179 QMQGHEINGRAI 190
           +    E  G  +
Sbjct: 261 RYNNQEFFGNKV 272

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (48%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +V D  L   F+ C   ++  +     + + +G+ F+ F   E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 301 GCRKIAGRPLRMEYGEDR 318

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXX-XXXXXXXXYAFIEYSTNHDANVALQ 89
           ++L++GNL   + +D L+++FQ  G I                +AFI++     +  AL+
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 90  TLNGIQIENKNIKINWA 106
                +I  + +++ + 
Sbjct: 299 DKGCRKIAGRPLRMEYG 315

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 312
           AP R  T Y+GNIP F     L+  +++ G I +    P++ C FI +   E +A+    
Sbjct: 158 APSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFHS 213

Query: 313 -VALSNFQFQGRNLRTGWGK 331
              L     +GR+++ GWGK
Sbjct: 214 DAILKRLNIEGRDIKVGWGK 233

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 12/81 (14%)

Query: 263 YIGNIPHFA---------TEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 313
           Y+GNI   A         TE +L    Q FG +       EK CCFI +     A + I 
Sbjct: 495 YVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAID 554

Query: 314 ALS-NFQFQGRNLRTGWGKER 333
            +  N  F  +NL+  +GK+R
Sbjct: 555 KIKCNPYF--KNLKVNFGKDR 573

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 55/122 (45%), Gaps = 11/122 (9%)

Query: 87  ALQTLNGIQIENKNIKINWAFQSQT-------NLNDDTSFNLFIGDLNVNVDDTTLANAF 139
           A+ +L+G+ I NK  KI W   S +        ++   S N+++G+++ N  D T    F
Sbjct: 453 AMSSLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDETGETIF 512

Query: 140 KSC---PGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
                   F +   +  +     +   F++F    NA  A+D+++ +    + +++N+  
Sbjct: 513 TEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKIKCNPY-FKNLKVNFGK 571

Query: 197 KR 198
            R
Sbjct: 572 DR 573

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 81/180 (45%), Gaps = 16/180 (8%)

Query: 33  LYIGNLDKSINEDALKQYF-QVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTL 91
           +Y+GN+D  + ++ L + F QV+                  YAFIE+ T  D    +Q +
Sbjct: 12  VYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVM 71

Query: 92  NG-IQIENKNIKINWAFQ--------SQTNLNDDTSF-----NLFIGDLNVNVDDTTLAN 137
           N  + + ++ +K+  + Q        + T+ N + S       LF+ +L+ ++++  L  
Sbjct: 72  NNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQLIK 131

Query: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197
            F+      +   ++ +   + R   ++ F  +EN+  A+ ++    I  + I +++A K
Sbjct: 132 LFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINVDYAFK 190

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%)

Query: 33  LYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQTLN 92
           L++ NLD+SI    L + FQ  G +                A+I +    ++++A+  LN
Sbjct: 115 LFVKNLDESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLN 174

Query: 93  GIQIENKNIKINWAFQSQT 111
              I NK I +++AF+  T
Sbjct: 175 NELIVNKRINVDYAFKENT 193

>KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON}
           Anc_3.432 YPR112C
          Length = 850

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDT------SFNLFIGDL 126
           + F+E+ T   AN  +  L+G  I+   I++  + ++  +    T      S  + + +L
Sbjct: 671 FGFVEFRTKEQANAVIAALDGTVIDGHKIQLKLSHRTTASNTTTTKKKGVKSGKIIVKNL 730

Query: 127 NVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
                   +   F S        V      S +RG+ FV F   + A+AAMDQ+QG  + 
Sbjct: 731 PFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAEAAMDQLQGVHLL 789

Query: 187 GRAIRINWA 195
           GR + + +A
Sbjct: 790 GRRLVMQYA 798

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 108 QSQTNLNDDTSFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSR-----SRGY 162
           +SQ ++ +  + ++FI +LN +     L + F    GF+ A V     +       S G+
Sbjct: 612 ESQDDVINGPTVSVFIKNLNFSTTSAQLNDKFSQFSGFVIAQVKTKPDSKHPGKTVSMGF 671

Query: 163 GFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           GFV F T E A A +  + G  I+G  I++  +
Sbjct: 672 GFVEFRTKEQANAVIAALDGTVIDGHKIQLKLS 704

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  N  D  L+  F +      A ++ D +  +SRG+GFVSF   ++   A+ Q 
Sbjct: 29  LFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKD-KNQKSRGFGFVSFAVEDDTMEALKQA 87

Query: 181 QGHEINGRAIRINWATKR 198
           +  ++NG  +R++ A +R
Sbjct: 88  RRTKLNGHQVRVDLAKRR 105

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA V+ +++ S   RSRGYGFV F  H++A   +  M  H++
Sbjct: 556 QAKVINEVKGSSKGRSRGYGFVEFKDHKHALMGLRWMNVHQV 597

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  + ++V D  L + F +      A V+ D+   +SRG+GFVSF   ++ + A+ + 
Sbjct: 28  LFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDV-NKKSRGFGFVSFAVEDDTKEALKKA 86

Query: 181 QGHEINGRAIRINWATKRE 199
           +  ++ G  +R++ A +R+
Sbjct: 87  RQTKLKGHLLRVDIAKRRD 105

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEI 185
           QA ++ +++ S   RSRGYGF+ +  H +A   +  M  H +
Sbjct: 549 QAKIIMEVKGSSAGRSRGYGFIEYKDHRSALMGLRWMNCHSV 590

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+G+L+ +  D  L   F+ C   ++  +     + + +G+ FV F   E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 181 QGHEINGRAIRINWATKR 198
              +I GR +R+ +   R
Sbjct: 300 TCRKIAGRPLRMEFGEDR 317

>SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 62/135 (45%), Gaps = 10/135 (7%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKN--IKINWAFQSQTNLNDDTSFN-------LFI 123
           +A++++      N  +  L+  Q+  +N  IK + +++ + + ND  + +       LF+
Sbjct: 175 FAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRILFV 233

Query: 124 GDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGH 183
           G+L+ +  D  L   F+ C   ++  +     + + +G+ F+ F   +    A+      
Sbjct: 234 GNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDKSCR 293

Query: 184 EINGRAIRINWATKR 198
           +I GR +R+ +   R
Sbjct: 294 KIAGRPLRMEFGEDR 308

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +  +V D  LA+ F +      A V+ D+   +SRG+GFVSF   ++ + A+ + 
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDV-NKKSRGFGFVSFAVEDDTKIALKEA 82

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +++G  ++++ A +R+
Sbjct: 83  RKTKLDGAQLKVDIARRRD 101

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/202 (16%), Positives = 79/202 (39%), Gaps = 34/202 (16%)

Query: 31  KVLYIGNLDKSINEDALKQYFQVAGQIXXXXXXXXXXXXXXXYAFIEYSTNHDANVALQT 90
           K L++ ++ +S+ ++ L  +F     I               + F+ ++   D  +AL+ 
Sbjct: 22  KTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 91  LNGIQIENKNIKINWAFQ-SQTNLNDDTSFNLFI---------GDLNVNVDDTTLANAFK 140
               +++   +K++ A +  ++  N+D S    I         GD N    +   ++  K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 141 SCPGFLQAHVMW-------------------DMQTSRSR-----GYGFVSFDTHENAQAA 176
             P  +  ++ W                   D    R R     G+ FV+ +   N + A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 177 MDQMQGHEINGRAIRINWATKR 198
           ++  +   I+GR + +++A ++
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQK 223

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEINGRAI 190
           QA ++ +++ S   RSRGYGFV +  H++A   +  +  H +    I
Sbjct: 537 QAKIIMEVKGSTVGRSRGYGFVEYKDHKHALMGLRWLNAHMVTTEEI 583

>ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar to
           uniprot|P25299 Saccharomyces cerevisiae YGL044C RNA15
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           interacts with the A-rich polyadenylation signal in
           complex with Rna14p and Hrp1p
          Length = 271

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 256 PPRVTTAYIGNIPHFATEPDLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAA 309
           P RV   Y+G+IP+  TE  ++ L  N G       + D      KG  F++Y   E +A
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSA 68

Query: 310 VCIVALSNFQFQGRNLRTGWG 330
             +  L+ +QF  R L+ G+ 
Sbjct: 69  SAVRNLNGYQFGSRLLKCGYA 89

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 149 HVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWAT 196
            +M+D QT +S+GY FV +   E++ +A+  + G++   R ++  +AT
Sbjct: 43  KMMFDPQTGKSKGYAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYAT 90

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 1/84 (1%)

Query: 24  GGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIXXXXXX-XXXXXXXXXYAFIEYSTNH 82
           GG+    +V+Y+G++     E+ +       G +                YAF+EY    
Sbjct: 6   GGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLE 65

Query: 83  DANVALQTLNGIQIENKNIKINWA 106
            +  A++ LNG Q  ++ +K  +A
Sbjct: 66  SSASAVRNLNGYQFGSRLLKCGYA 89

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 116 DTSFNLFIGDLNVNVDDTTLANA--FKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENA 173
           D    L I  LN N D+ TL     F   P   +A V+ + +T RSRG  FV+F + E A
Sbjct: 190 DDMCTLKIMQLNENADENTLREELLFPFAP-IPKAVVVRNRETGRSRGLAFVTFSSEEMA 248

Query: 174 QAAMDQMQGHEINGRAIRINWATKRE 199
           + A+  + G       +R+ W+  ++
Sbjct: 249 EKALHFLDGRGFMNLILRVEWSKPKK 274

>TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON}
           Anc_7.250 YIL061C
          Length = 318

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 4/111 (3%)

Query: 82  HDANVALQTLNGIQIENKNIKINWAFQSQTNLND-DTSFNLFIGDLNVNVDDTTLANAFK 140
            D   A  + N  Q E +N    W  Q+  N+ D D    +F+G L  ++ +  L   F 
Sbjct: 69  QDYEKAADSKNREQRELENKLSEWDPQNDPNMKDTDPYRTIFVGRLPYDISEVELQRKFN 128

Query: 141 SCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM---QGHEINGR 188
                 +  V+ D   ++S+GY F+ F   +++++A  +    +G EI GR
Sbjct: 129 EFGEIEKVRVVRDKINNQSKGYAFIVFTDPQSSKSACKEYGLHRGIEIKGR 179

>ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL061C
           (SNP1); 1-intron
          Length = 320

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 5/107 (4%)

Query: 88  LQTLNGIQIENKNIKI-NWAFQSQTNLNDDTSFN-LFIGDLNVNVDDTTLANAFKSCPGF 145
           L+T+N  + +    ++  WA ++ TN+     F  +F+G L+ +VD+  L   F      
Sbjct: 74  LKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEI 133

Query: 146 LQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHE---INGRA 189
            +  ++ D  T++ RGY FV F   E ++ A  ++  H    I GR+
Sbjct: 134 ERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREIGVHRGLMIRGRS 180

>KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q00916 Saccharomyces cerevisiae
           YIL061C SNP1 U1snRNP 70K protein homolog
          Length = 278

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 92  NGIQIENK--NIKIN-WAFQSQTNLNDDTSFN-LFIGDLNVNVDDTTLANAFKSCPGFLQ 147
           N  Q+E K  N K+  W      N+ D   +  +F+G L   V +  L   F       +
Sbjct: 71  NARQVEAKALNAKLAIWNPDEDPNIADSDPYRTIFVGRLPFAVTEVELQKEFVRFGEIEK 130

Query: 148 AHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM---QGHEINGRAIRIN 193
             V+ D  +++SRGYGF+ F    +A++A  ++   +G +I GR + ++
Sbjct: 131 VRVVRDKTSNKSRGYGFIMFKDEISARSACREIGVHRGVQIGGRPVIVD 179

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  +     D    N F        A ++ D + + SRG+GFVSF   ++ + A++Q 
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGA-SRGFGFVSFAVEDDTKTALNQA 75

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +  GR +RI+ A +RE
Sbjct: 76  RKTKFMGRLLRIDIAKRRE 94

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 147 QAHVMWDMQTS---RSRGYGFVSFDTHENAQAAMDQMQGHEIN 186
           Q+ ++ +++ S   RSRGYGFV F  H+ A   +  +  HE++
Sbjct: 543 QSKIIMEIKGSSGGRSRGYGFVEFRDHKAALMCLRWLNAHEVS 585

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 121 LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQM 180
           LF+  + +   D    + F +      A ++ D    +SRG+GFVSF + E++Q A+ + 
Sbjct: 24  LFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDT-NKKSRGFGFVSFASEEDSQEALTKA 82

Query: 181 QGHEINGRAIRINWATKRE 199
           +  +I    +R+++A +R+
Sbjct: 83  RTSKIQNHLLRVDFAKRRD 101

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 27/38 (71%)

Query: 161 GYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198
           G+ FV+F    N + A+++ +G +I+GRA+ +++A ++
Sbjct: 190 GFAFVTFKNLANCKVALEKSKGLKIDGRAVAVDFAVQK 227

>Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C
           (MRD1) - Multiple RNA Binding Domain [contig 255] FULL
          Length = 876

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 118 SFNLFIGDLNVNVDDTTLANAFKSCPGFLQAHVMW-----DMQTSRSRGYGFVSFDTHEN 172
           + ++F+ +LN +     L   FK+  GF+ A V       +   + S G+GF  F T E 
Sbjct: 648 TVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQ 707

Query: 173 AQAAMDQMQGHEINGRAIRINWA 195
           A A +D M G  ++G  I++  +
Sbjct: 708 ALAVIDAMDGAVLDGHRIQLKLS 730

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 73  YAFIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFN-----LFIGDLN 127
           + F E+ T   A   +  ++G  ++   I++  + +     +           + + +L 
Sbjct: 697 FGFAEFKTREQALAVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLP 756

Query: 128 VNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEING 187
             V+   +   F S  G L++  +       +RG+ FV F   + A+ AM+Q+QG  + G
Sbjct: 757 FEVERKQIFELFSSF-GQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLG 815

Query: 188 RAIRINWA 195
           R + +  A
Sbjct: 816 RRLVMQHA 823

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 312
           AP R  T Y+GN+P + T  +L+  +++ G + D    PEK C FI +   E +A+    
Sbjct: 153 APSR--TVYLGNVPPYITTRELLDHVRS-GVVEDVKILPEKMCAFISF-VDENSALLFHS 208

Query: 313 -VALSNFQFQGRNLRTGWGK 331
              L       R+++ GWGK
Sbjct: 209 DAILKRLNIDDRDIKIGWGK 228

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 12/81 (14%)

Query: 263 YIGNI----------PHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI 312
           Y+GNI          P F TE  L  + Q FG +       E+ CCFI +     A + I
Sbjct: 489 YLGNIDFEDDRKLEQPIF-TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAI 547

Query: 313 VALSNFQFQGRNLRTGWGKER 333
             + +     ++L+  +GK+R
Sbjct: 548 DKIKSIP-TFKDLKINFGKDR 567

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 120 NLFIGDL--NVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAM 177
           NL+I  +  ++ +DD  L   F +    L   ++ D+ T  S GYGF+SF     A   +
Sbjct: 230 NLYIRGIPKDLTIDD--LKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCI 287

Query: 178 DQMQGHEINGRAIRINWATKRE 199
           +++ G  +NG  + IN+  +R+
Sbjct: 288 NKLNGTAMNGSTLFINYHVERK 309

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195
           +GYGF+ F  HE+A  AM +++   + G  + IN A
Sbjct: 436 KGYGFIKFQEHEHAIDAMTKLEDLRLFGNKLIINKA 471

>SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 aa]
           {ON} similar to uniprot|Q00916 Saccharomyces cerevisiae
           YIL061C SNP1 U1snRNP 70K protein homolog
          Length = 302

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 103 INWAFQSQTNLNDDTSFN-LFIGDLNVNVDDTTLANAFKSCPGFLQAHVMWDMQTSRSRG 161
           + W  ++  ++     F  +FIG L   V +  L   F       +  V+ D  TS+SRG
Sbjct: 90  LEWDPENDEHIKGTDPFRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRG 149

Query: 162 YGFVSFDTHENAQAAMDQM---QGHEINGRAI 190
           Y F+ F     ++AA  ++   +G +I GR++
Sbjct: 150 YAFIVFRDETGSRAACKEIGVHRGLDIQGRSV 181

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 255 APPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 312
           AP R  T Y+GNIP   T  +L+  +++ G I D    PEK C FI +   E +A+    
Sbjct: 219 APSR--TVYLGNIPSDLTVKELLDHVRS-GVIEDVKIIPEKLCAFISF-LDENSALLFHS 274

Query: 313 -VALSNFQFQGRNLRTGWGK 331
              L      G++++ GWGK
Sbjct: 275 DAILKRLNINGKDIKIGWGK 294

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query: 263 YIGNI----------PHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI 312
           YIGNI          P F TE  L  +   +G +      PEK CCFI +     A + +
Sbjct: 593 YIGNIDFATDKKRDNPIF-TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILAL 651

Query: 313 VAL-SNFQFQGRNLRTGWGKER 333
             + SN  F  ++L+  +GK+R
Sbjct: 652 DKIKSNPVF--KDLKINFGKDR 671

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 116 DTSFNLFIGDLNVNVDDTTLAN----AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHE 171
           D    L I  LN N D+TTL       F + P  +   V+ + +T RSRG  FV+F + E
Sbjct: 188 DDMATLKITQLNENADETTLREELLFPFGNIPRVV---VVRNRETGRSRGLAFVTFSSEE 244

Query: 172 NAQAAMDQMQGHEINGRAIRINWATKRE 199
            A+ A   + G       ++++W+  +E
Sbjct: 245 VAEKARRLLNGRGFMNLILQVDWSKPKE 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,834,190
Number of extensions: 1128448
Number of successful extensions: 5234
Number of sequences better than 10.0: 515
Number of HSP's gapped: 4866
Number of HSP's successfully gapped: 1066
Length of query: 365
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 254
Effective length of database: 40,753,473
Effective search space: 10351382142
Effective search space used: 10351382142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)