Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0J003402.533ON21821811751e-166
KNAG0A070402.533ON3521493592e-40
ZYRO0B02002g2.533ON294962471e-24
TDEL0A030702.533ON2391002353e-23
KNAG0C058102.533ON5541162401e-22
CAGL0K03003g2.533ON6471182401e-22
Kpol_1018.332.533ON5891092392e-22
KAFR0A018602.533ON4901102337e-22
NCAS0A048002.533ON5111152275e-21
TPHA0G035102.533ON387612231e-20
NDAI0H014002.533ON541672222e-20
NCAS0F009002.533ON525672213e-20
TBLA0G022302.533ON2161042107e-20
SAKL0A09482g2.533ON3881092161e-19
NDAI0K018602.533ON730792153e-19
Smik_13.2492.533ON4731322134e-19
TBLA0I014802.533ON513902135e-19
KLTH0D06842g2.533ON506782126e-19
Kwal_26.80212.533ON5071142118e-19
AGL071C2.533ON396592099e-19
KLLA0E18547g2.533ON431572101e-18
Ecym_72552.533ON544632082e-18
YMR070W (MOT3)2.533ON490632082e-18
Skud_13.2262.533ON475632082e-18
Suva_13.2462.533ON419632072e-18
TPHA0C041902.533ON417621791e-14
Suva_13.2062.598ON709861287e-08
ZYRO0B14894g4.351ON1119621261e-07
KNAG0H005502.598ON620501252e-07
KLLA0F26961g2.598ON694641252e-07
AER159C4.351ON1191781252e-07
KLLA0B04477g4.351ON1332561243e-07
Ecym_23012.598ON767561243e-07
ABR089C2.598ON571581233e-07
TPHA0N014602.598ON519581233e-07
CAGL0L05786g8.116ON348681223e-07
Smik_13.2072.598ON703861233e-07
ZYRO0F01012g2.598ON584571233e-07
NCAS0A129102.598ON8221441224e-07
KNAG0G011408.117ON519631224e-07
YMR037C (MSN2)2.598ON704861225e-07
Kwal_47.166214.351ON1178941225e-07
SAKL0G18062g4.351ON1238561215e-07
TBLA0B061604.351ON1384561216e-07
Skud_4.4788.425ON1323521216e-07
KAFR0F020702.598ON370771207e-07
KAFR0A023202.598ON443641207e-07
NDAI0D032404.351ON1362631208e-07
Kwal_26.80112.531ON190511169e-07
Skud_13.1932.598ON704861199e-07
TDEL0B069102.598ON437561181e-06
KLTH0E09922g8.425ON11191071191e-06
KLTH0D18062g4.351ON1128551191e-06
CAGL0F05995g2.598ON597561181e-06
TDEL0D006704.351ON1199561181e-06
NCAS0B028408.425ON1152531181e-06
KNAG0B067104.351ON1053891182e-06
Kpol_1001.14.351ON1341911182e-06
AGR172W8.425ON1057951182e-06
Skud_13.614.351ON1253581172e-06
NCAS0C042308.117ON338501162e-06
YML081W (TDA9)4.351ON1251581172e-06
Smik_13.584.351ON1253581172e-06
TPHA0B003804.351ON1310581162e-06
Kpol_185.32.598ON647561153e-06
KAFR0B068104.351ON1155591163e-06
KNAG0M003504.351ON1076561163e-06
Kpol_1013.212.598ON494641153e-06
TBLA0E047704.351ON1655561163e-06
TBLA0H006608.425ON1311531153e-06
Suva_13.704.351ON777581153e-06
ZYRO0B07568g4.214ON616571153e-06
NDAI0B013402.598ON769581144e-06
Smik_4.4638.425ON1324621145e-06
SAKL0B11330g2.598ON499501135e-06
Kpol_541.398.116ON291501126e-06
SAKL0H12958g8.425ON1129961146e-06
CAGL0M13189g2.598ON541501136e-06
TPHA0C025802.598ON3651141126e-06
KLTH0D08734g2.598ON677571136e-06
KNAG0G012808.144ON472561127e-06
Kwal_26.83512.598ON698561137e-06
KAFR0C031408.117ON370501127e-06
NCAS0A062504.351ON1341621137e-06
TPHA0C021608.425ON1375621128e-06
Skud_16.2988.116ON317851119e-06
YKL062W (MSN4)2.598ON630501129e-06
Smik_11.1862.598ON641501129e-06
SAKL0H04070g4.214ON899621111e-05
Skud_11.1672.598ON628501111e-05
Suva_2.3838.425ON1319621121e-05
Suva_16.3358.116ON317921101e-05
KNAG0H011803.281ON254511091e-05
NDAI0C048608.425ON1350621111e-05
NCAS0H030802.598ON730561111e-05
TDEL0F011708.116ON162501061e-05
KLLA0F20636gsingletonON285501091e-05
YDR216W (ADR1)8.425ON1323601101e-05
YPR013C8.116ON317821092e-05
AGL207W3.298ON277521082e-05
Suva_11.1642.598ON639501092e-05
NCAS0F00910singletonON350791082e-05
KLTH0D06798g2.531ON111601022e-05
CAGL0J01595g8.117ON344501082e-05
KAFR0B063608.425ON627481082e-05
Kpol_529.138.425ON1410481092e-05
Smik_16.2538.116ON317501073e-05
KLLA0F13046g8.425ON1379531083e-05
KNAG0A044608.425ON1290521083e-05
TBLA0G019202.598ON523501083e-05
ZYRO0A09416g8.425ON1346531083e-05
KAFR0B020008.117ON303621063e-05
TDEL0E015904.214ON770571074e-05
TPHA0A04530singletonON501771064e-05
AFR580C4.214ON838581074e-05
TDEL0F055008.425ON1207621074e-05
KNAG0M023102.598ON660571064e-05
NDAI0C005602.598ON972561074e-05
KLTH0C04884g3.298ON342521054e-05
Ecym_26733.298ON301521055e-05
ZYRO0E02684g8.116ON133501015e-05
CAGL0H04213g4.351ON1321561065e-05
Kwal_27.104673.298ON302521055e-05
CAGL0K04631g4.214ON1013611065e-05
KAFR0B019908.116ON410591055e-05
NDAI0B019408.116ON336791055e-05
KNAG0D022908.116ON435501056e-05
Suva_16.3388.117ON247591036e-05
KLLA0B07909g4.214ON922801057e-05
NDAI0B02080singletonON273861038e-05
KLTH0E06688g8.144ON397551048e-05
CAGL0M00594g4.351ON1020751049e-05
KLTH0H08800g8.117ON168551009e-05
Suva_12.2184.351ON1270561049e-05
NCAS0C040708.144ON289631039e-05
Smik_10.4204.351ON1348561049e-05
KNAG0D022808.117ON435501039e-05
NDAI0A075403.298ON370681039e-05
Skud_10.3514.351ON1327561049e-05
Smik_6.1504.214ON806591041e-04
TBLA0F003708.144ON687531041e-04
NCAS0B046708.116ON2661071021e-04
YJR127C (RSF2)4.351ON1380561041e-04
Kwal_47.172418.144ON403551031e-04
KNAG0D041904.214ON1010571041e-04
NCAS0F009202.531ON354581021e-04
NCAS0B046608.117ON256491011e-04
TBLA0H028302.598ON746581031e-04
Skud_7.3644.214ON810591031e-04
AEL077Wna 1ON336551021e-04
SAKL0A09438g2.531ON441511021e-04
KNAG0I020702.162ON572541021e-04
YPR015C8.117ON247591002e-04
YGR067C4.214ON804591022e-04
Smik_16.2558.117ON247591002e-04
CAGL0K12078g3.281ON463651012e-04
TBLA0G032403.298ON511521012e-04
Skud_16.3008.117ON249591002e-04
KAFR0B025508.234ON890531022e-04
Suva_7.3494.214ON812571012e-04
KNAG0J022503.296ON296611002e-04
CAGL0E04884g8.425ON1489531012e-04
NCAS0B05750singletonON505511012e-04
Kpol_472.104.214ON830561003e-04
SAKL0F01980g3.518ON385521003e-04
Ecym_1383na 1ON381551003e-04
SAKL0H20394g8.117ON359147993e-04
KLLA0C17710g8.234ON821581003e-04
ADR308Cna 2ON27850983e-04
Kpol_1003.502.303ON61457993e-04
TBLA0E039308.116ON46250993e-04
KAFR0G030504.214ON74955994e-04
TPHA0F018102.162ON42548994e-04
Kpol_1052.83.298ON38657984e-04
KNAG0H019302.303ON61852994e-04
NDAI0C06260na 3ON58251994e-04
NCAS0J00640na 3ON10251934e-04
TDEL0D034303.281ON17562964e-04
Ecym_35208.234ON81993994e-04
Ecym_27604.214ON93858994e-04
Kwal_56.234538.234ON82886994e-04
ACL057W8.144ON52055984e-04
ZYRO0B11770g8.234ON86766994e-04
TPHA0G008202.303ON53259985e-04
Kpol_1065.483.298ON36452985e-04
Ecym_8011na 2ON27650975e-04
Ecym_33412.303ON56052985e-04
KAFR0A010903.281ON24959975e-04
Kwal_27.109253.281ON26451975e-04
KAFR0E042704.351ON125556985e-04
SAKL0D03146g3.281ON15749945e-04
SAKL0H24816g8.144ON41055975e-04
ADL198W2.303ON54752985e-04
NCAS0I014603.298ON33061976e-04
ZYRO0G19140g8.144ON55755976e-04
NDAI0B042902.162ON106455976e-04
TDEL0A013008.234ON83753976e-04
TBLA0B012802.162ON82377977e-04
NDAI0G007202.303ON70852977e-04
NDAI0B060203.518ON42664967e-04
Ecym_26543.281ON25749957e-04
SAKL0H20416g8.116ON31750967e-04
TBLA0B060502.303ON76252977e-04
KNAG0G018708.234ON87558978e-04
Ecym_8379na 4ON30595968e-04
Ecym_84038.144ON57355968e-04
Kwal_27.114602.303ON53153968e-04
KLTH0G10802g2.303ON52693968e-04
KLTH0G01826g3.518ON30756958e-04
KLLA0B03454g7.543ON47247968e-04
Kpol_1018.352.531ON51774968e-04
KAFR0H012903.298ON33057958e-04
Kpol_1031.428.144ON35951968e-04
KNAG0J008703.281ON28049959e-04
Kpol_1023.1004.351ON91654969e-04
KLLA0E08713g2.303ON59657969e-04
NCAS0B046008.144ON54755960.001
CAGL0L03916g2.162ON64263960.001
NCAS0B069602.162ON83955960.001
KLTH0C07172g3.281ON26551940.001
KAFR0B045802.162ON729103950.001
Smik_4.3378.234ON89472950.001
Kpol_1065.153.281ON22051930.001
Kpol_1052.183.281ON35749940.001
NCAS0G037302.303ON57158950.001
SAKL0H17842g8.234ON81457950.001
KLLA0F11682g3.298ON37456940.001
KAFR0A018402.531ON41451940.001
Suva_2.2003.281ON23251930.001
KLTH0H09196g4.80ON46092940.001
Kwal_47.190453.518ON26656930.002
Suva_5.2518.144ON44955940.002
TPHA0H018506.256ON36169930.002
SAKL0E07216g2.303ON54858940.002
YDR096W (GIS1)8.234ON89471940.002
KAFR0H032402.303ON51951940.002
TDEL0G023302.303ON50652930.002
Skud_4.2973.281ON23151920.002
SAKL0D02618g3.298ON32152930.002
TBLA0I027004.214ON73756940.002
TPHA0A039103.298ON35157930.002
NDAI0J028504.351ON153756940.002
KLTH0G14454g8.234ON83253940.002
ZYRO0E08426g3.518ON17151900.002
Smik_4.2813.281ON23156910.002
SAKL0A10648gsingletonON26151920.002
YDR043C (NRG1)3.281ON23151910.002
CAGL0K02145g8.144ON31755920.002
YMR182C (RGM1)6.256ON21179910.002
CAGL0L06072g8.144ON30049920.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0J00340
         (218 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}      457   e-166
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...   142   2e-40
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   100   1e-24
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    95   3e-23
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    97   1e-22
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    97   1e-22
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    97   2e-22
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    94   7e-22
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    92   5e-21
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    91   1e-20
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    90   2e-20
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    90   3e-20
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    86   7e-20
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    88   1e-19
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    87   3e-19
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    87   4e-19
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    87   5e-19
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    86   6e-19
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    86   8e-19
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    85   9e-19
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    86   1e-18
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    85   2e-18
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    85   2e-18
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    85   2e-18
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    84   2e-18
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    74   1e-14
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    54   7e-08
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    53   1e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    53   2e-07
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    53   2e-07
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    53   2e-07
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    52   3e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    52   3e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    52   3e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    52   3e-07
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    52   3e-07
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    52   3e-07
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    52   3e-07
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    52   4e-07
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    52   4e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    52   5e-07
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    52   5e-07
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    51   5e-07
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    51   6e-07
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    51   6e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    51   7e-07
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    51   7e-07
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    51   8e-07
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    49   9e-07
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    50   9e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    50   1e-06
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    50   1e-06
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    50   1e-06
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    50   1e-06
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    50   1e-06
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    50   1e-06
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    50   2e-06
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    50   2e-06
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    50   2e-06
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    50   2e-06
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               49   2e-06
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    50   2e-06
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    50   2e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    49   2e-06
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    49   3e-06
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    49   3e-06
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    49   3e-06
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    49   3e-06
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    49   3e-06
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    49   3e-06
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    49   3e-06
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    49   3e-06
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     49   4e-06
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    49   5e-06
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    48   5e-06
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    48   6e-06
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    49   6e-06
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    48   6e-06
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    48   6e-06
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    48   6e-06
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    48   7e-06
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    48   7e-06
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               48   7e-06
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    48   7e-06
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    48   8e-06
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    47   9e-06
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    48   9e-06
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    48   9e-06
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    47   1e-05
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    47   1e-05
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    48   1e-05
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    47   1e-05
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    47   1e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    47   1e-05
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    47   1e-05
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    45   1e-05
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    47   1e-05
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    47   1e-05
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    47   2e-05
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    46   2e-05
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    47   2e-05
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               46   2e-05
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    44   2e-05
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    46   2e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    46   2e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    47   2e-05
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    46   3e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    46   3e-05
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    46   3e-05
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    46   3e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    46   3e-05
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    45   3e-05
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    46   4e-05
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             45   4e-05
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    46   4e-05
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    46   4e-05
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    45   4e-05
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     46   4e-05
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    45   4e-05
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    45   5e-05
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    44   5e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    45   5e-05
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    45   5e-05
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    45   5e-05
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    45   5e-05
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    45   5e-05
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    45   6e-05
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    44   6e-05
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    45   7e-05
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                44   8e-05
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    45   8e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    45   9e-05
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    43   9e-05
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    45   9e-05
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      44   9e-05
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    45   9e-05
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               44   9e-05
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    44   9e-05
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    45   9e-05
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    45   1e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    45   1e-04
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                44   1e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    45   1e-04
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    44   1e-04
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    45   1e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   1e-04
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                44   1e-04
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    44   1e-04
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    44   1e-04
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    44   1e-04
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    44   1e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   1e-04
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    43   2e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    44   2e-04
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    43   2e-04
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    44   2e-04
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     44   2e-04
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    43   2e-04
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    44   2e-04
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    44   2e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               43   2e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    44   2e-04
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    44   2e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    43   3e-04
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    43   3e-04
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    43   3e-04
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    43   3e-04
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    43   3e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    42   3e-04
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    43   3e-04
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    43   3e-04
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    43   4e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    43   4e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    42   4e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    43   4e-04
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             43   4e-04
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       40   4e-04
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    42   4e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    43   4e-04
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    43   4e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    43   4e-04
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    42   4e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    43   4e-04
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   5e-04
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   5e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    42   5e-04
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   5e-04
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    42   5e-04
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    42   5e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    42   5e-04
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    41   5e-04
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    42   5e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    42   5e-04
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    42   6e-04
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    42   6e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    42   6e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    42   6e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    42   7e-04
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   7e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    42   7e-04
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    41   7e-04
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    42   7e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    42   7e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    42   8e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    42   8e-04
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    42   8e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    42   8e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    42   8e-04
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    41   8e-04
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    42   8e-04
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    42   8e-04
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    41   8e-04
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    42   8e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    41   9e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    42   9e-04
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    42   9e-04
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    42   0.001
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    42   0.001
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    42   0.001
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    41   0.001
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    41   0.001
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    41   0.001
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    40   0.001
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    41   0.001
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     41   0.001
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    41   0.001
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    41   0.001
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    41   0.001
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    40   0.001
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    41   0.001
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    40   0.002
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    41   0.002
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    40   0.002
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    41   0.002
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    41   0.002
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    41   0.002
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    40   0.002
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    40   0.002
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    40   0.002
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    41   0.002
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    40   0.002
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    41   0.002
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    41   0.002
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    39   0.002
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    40   0.002
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    40   0.002
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    40   0.002
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    40   0.002
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    40   0.002
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    40   0.002
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    40   0.002
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    40   0.002
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    40   0.002
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    40   0.003
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    40   0.003
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    40   0.003
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    40   0.003
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    39   0.003
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    40   0.003
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    40   0.003
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    40   0.003
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     40   0.003
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    39   0.003
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    40   0.003
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    40   0.003
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               40   0.003
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    40   0.003
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    40   0.004
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    40   0.004
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    40   0.004
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    40   0.004
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    40   0.004
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    40   0.004
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      39   0.004
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    40   0.004
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    40   0.004
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    40   0.004
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    40   0.004
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    39   0.004
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    40   0.005
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    39   0.005
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    39   0.005
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             39   0.005
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    39   0.005
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    39   0.005
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    39   0.005
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    39   0.006
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    39   0.006
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  39   0.006
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    39   0.006
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    39   0.006
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    39   0.006
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    39   0.006
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    39   0.006
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    39   0.007
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    38   0.007
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    39   0.007
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    39   0.007
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    39   0.007
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    39   0.007
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    39   0.007
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    38   0.007
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    39   0.007
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    39   0.008
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    39   0.008
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    39   0.008
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    39   0.008
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    38   0.008
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    39   0.008
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    38   0.008
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    39   0.009
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    38   0.009
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    37   0.009
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    38   0.009
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    37   0.009
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    38   0.009
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    38   0.010
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    39   0.010
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    38   0.010
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    38   0.010
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    39   0.011
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    39   0.011
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    38   0.011
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    38   0.011
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    38   0.012
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    38   0.012
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    38   0.012
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    38   0.012
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    38   0.012
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    38   0.012
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    38   0.013
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    38   0.013
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    38   0.014
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    38   0.014
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    37   0.014
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    38   0.015
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    38   0.016
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    37   0.016
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     38   0.016
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    37   0.017
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    37   0.017
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    37   0.017
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    38   0.017
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    37   0.017
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    37   0.017
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    37   0.018
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    38   0.019
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    37   0.019
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    37   0.020
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    37   0.021
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    37   0.021
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    37   0.021
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    37   0.021
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    37   0.021
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    37   0.021
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    37   0.022
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    37   0.023
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    37   0.023
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    37   0.024
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    36   0.024
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    37   0.024
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    37   0.026
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    36   0.027
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    37   0.027
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    37   0.027
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    37   0.028
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    37   0.029
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    37   0.029
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    36   0.031
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    37   0.032
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    37   0.033
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    37   0.033
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     37   0.033
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    36   0.033
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    37   0.034
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    37   0.034
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    37   0.035
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    36   0.036
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                36   0.037
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    37   0.037
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    37   0.038
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    36   0.039
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    36   0.041
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    36   0.041
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    36   0.041
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    36   0.042
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    36   0.042
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    37   0.043
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    36   0.044
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      36   0.045
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    37   0.046
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    35   0.046
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    36   0.047
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    36   0.048
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    36   0.049
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      36   0.049
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    36   0.050
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    36   0.051
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    36   0.052
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    35   0.054
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    36   0.054
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    36   0.057
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     36   0.060
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    36   0.061
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    36   0.062
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    36   0.063
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    36   0.064
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    36   0.064
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    36   0.065
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    36   0.065
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    36   0.066
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    35   0.067
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    36   0.068
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    36   0.068
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    36   0.069
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    35   0.071
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    36   0.074
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    35   0.075
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    35   0.079
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    35   0.079
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    35   0.083
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    35   0.098
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    35   0.099
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    35   0.10 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    34   0.10 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    35   0.10 
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    35   0.10 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    35   0.10 
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    35   0.11 
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    34   0.11 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    35   0.12 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    35   0.12 
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    35   0.12 
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    35   0.12 
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    34   0.12 
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    35   0.12 
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     35   0.12 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    34   0.12 
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    35   0.12 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    35   0.13 
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    35   0.13 
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    35   0.13 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    35   0.13 
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     35   0.14 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    35   0.14 
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    35   0.14 
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    35   0.15 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    35   0.15 
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      35   0.15 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    35   0.15 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    34   0.15 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    35   0.16 
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    34   0.16 
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    35   0.17 
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      35   0.17 
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    34   0.19 
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                34   0.19 
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    34   0.20 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    33   0.20 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    34   0.20 
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    33   0.20 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    35   0.20 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    34   0.21 
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    34   0.21 
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    34   0.24 
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    34   0.25 
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    34   0.25 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    34   0.25 
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    34   0.26 
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    34   0.27 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    34   0.28 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    33   0.28 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  33   0.29 
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    33   0.29 
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    33   0.29 
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    33   0.32 
NCAS0B08080 Chr2 complement(1532527..1544853) [12327 bp, 4108 aa...    34   0.33 
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    33   0.34 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    33   0.34 
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    33   0.35 
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     33   0.35 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    33   0.36 
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    33   0.37 
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    33   0.37 
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    33   0.38 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    33   0.39 
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    33   0.41 
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    33   0.41 
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    33   0.41 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    33   0.43 
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    33   0.43 
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    33   0.43 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    33   0.43 
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      33   0.45 
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    33   0.47 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     33   0.48 
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    32   0.50 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    33   0.50 
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                33   0.50 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    33   0.52 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    33   0.54 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    33   0.54 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     33   0.55 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    33   0.55 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    33   0.60 
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    33   0.62 
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    33   0.66 
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    32   0.66 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    33   0.74 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    32   0.80 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    32   0.88 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    32   0.92 
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    32   1.0  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    32   1.1  
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    32   1.1  
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    32   1.1  
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      32   1.1  
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    32   1.1  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    32   1.1  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    32   1.1  
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    32   1.2  
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    32   1.2  
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    32   1.2  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    32   1.2  
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    32   1.2  
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    32   1.3  
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    32   1.3  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    32   1.3  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    32   1.4  
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    32   1.4  
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    32   1.4  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    31   1.4  
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    31   1.4  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   1.5  
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    32   1.5  
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    32   1.6  
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    32   1.6  
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    32   1.7  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    32   1.7  
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    31   2.0  
TBLA0F02620 Chr6 complement(634992..636440) [1449 bp, 482 aa] {O...    31   2.0  
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    31   2.2  
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    31   2.4  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    31   2.4  
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    31   2.5  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    31   2.5  
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    31   2.6  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    31   2.7  
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    31   2.7  
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    31   2.7  
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    31   2.8  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    30   3.0  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    31   3.0  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    31   3.1  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    31   3.1  
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    30   3.3  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      30   3.5  
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    30   3.5  
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    30   3.9  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    30   3.9  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    30   4.0  
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    30   4.4  
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    30   4.4  
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    30   4.4  
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     30   4.6  
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    30   4.9  
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    30   4.9  
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    30   5.1  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      30   5.1  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    30   5.1  
KAFR0C00960 Chr3 (195663..196892) [1230 bp, 409 aa] {ON} Anc_3.1...    30   5.2  
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    30   5.5  
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    30   5.9  
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    30   6.1  
SAKL0H04488g Chr8 (418323..420158) [1836 bp, 611 aa] {ON} simila...    30   6.2  
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    30   6.4  
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    30   6.5  
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    30   6.7  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    30   6.7  
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    27   6.9  
NDAI0G03000 Chr7 complement(695595..697139) [1545 bp, 514 aa] {O...    30   7.0  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    30   7.0  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    30   7.1  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    30   7.3  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    30   7.4  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    29   7.4  
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    29   7.8  
NCAS0E03780 Chr5 (743530..744375) [846 bp, 281 aa] {ON} Anc_7.31...    29   7.9  
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    29   8.5  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    29   9.1  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    29   9.6  
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    29   9.6  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    29   9.8  

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score =  457 bits (1175), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 218/218 (100%), Positives = 218/218 (100%)

Query: 1   MNKIMNGNNQQPVIRPHVQGFLERKRLESPRLVYVPNVPSADTMNYTERMGDIVTVPQYI 60
           MNKIMNGNNQQPVIRPHVQGFLERKRLESPRLVYVPNVPSADTMNYTERMGDIVTVPQYI
Sbjct: 1   MNKIMNGNNQQPVIRPHVQGFLERKRLESPRLVYVPNVPSADTMNYTERMGDIVTVPQYI 60

Query: 61  PNPVPQYVIAGQPMQGYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYR 120
           PNPVPQYVIAGQPMQGYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYR
Sbjct: 61  PNPVPQYVIAGQPMQGYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYR 120

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180
           CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE
Sbjct: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180

Query: 181 YYPLTDFEDKDLNELMRSGYLHREDIKRVFLHLIGLER 218
           YYPLTDFEDKDLNELMRSGYLHREDIKRVFLHLIGLER
Sbjct: 181 YYPLTDFEDKDLNELMRSGYLHREDIKRVFLHLIGLER 218

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score =  142 bits (359), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 70/149 (46%), Positives = 88/149 (59%), Gaps = 1/149 (0%)

Query: 70  AGQPMQGYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQ 129
             QP+Q         + P++   R     R   A  K        +TS Y C  C K FQ
Sbjct: 202 TSQPVQLPTEEEEGKSTPMLTLTRNPKPKRKASARGKGRTPKPPTMTS-YPCPQCPKSFQ 260

Query: 130 REAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIREYYPLTDFED 189
           R AWL+RH ++HTN   F C WCKS+HKRRDN+FKH+KLKHM LLMK IR YYPL +FE 
Sbjct: 261 RSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKVIRNYYPLAEFEG 320

Query: 190 KDLNELMRSGYLHREDIKRVFLHLIGLER 218
           KDL  L+  G LH+ED+KRV + ++   R
Sbjct: 321 KDLKGLLADGRLHKEDVKRVLVDIVNPTR 349

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 99.8 bits (247), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 2/96 (2%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180
           C +C+K F+R++WLRRH LSH+ +R+F CPWC SKHKR+DNL +H+KLKH E +++ +R 
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253

Query: 181 YYPLTDFE--DKDLNELMRSGYLHREDIKRVFLHLI 214
                D E  + ++  L+  G L++ED+K+V   LI
Sbjct: 254 QNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLI 289

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score = 95.1 bits (235), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 72/100 (72%), Gaps = 3/100 (3%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           V++C++CNK F+R++WL+RH LSH+  R+F CPWC SKHKR+DNL +H+KLKH + +++ 
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192

Query: 178 IR--EYYPLTDFEDK-DLNELMRSGYLHREDIKRVFLHLI 214
           +R    Y  T+   K ++  L+  G L+++++K+V   LI
Sbjct: 193 LRLNNVYVSTEGSCKNNIRTLLYEGRLNKDEVKKVLNSLI 232

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score = 97.1 bits (240), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 72/116 (62%), Gaps = 19/116 (16%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C++C K F+R +WL+RH LSH+ +R++LCPWC S+HKR+DNL +H+KLKH   L+  
Sbjct: 435 IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDE 494

Query: 178 IR-----------------EYYP--LTDFEDKDLNELMRSGYLHREDIKRVFLHLI 214
           ++                 +  P  L+ + D  + +L+  G L+++D+KRV   +I
Sbjct: 495 LKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKII 550

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 97.1 bits (240), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 76/118 (64%), Gaps = 17/118 (14%)

Query: 114 EVTSV---YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           EV+S+   +RC++C K+F+R++WL+RH LSH+  R+FLCPWC S+HKRRDNL +H+KLKH
Sbjct: 526 EVSSLAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKH 585

Query: 171 MELLMKAI-----REYYPLTD---------FEDKDLNELMRSGYLHREDIKRVFLHLI 214
           +  L++ I     R  +P+ +          E  D   L+  G L+++++K +   +I
Sbjct: 586 VPNLLQEINSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTVI 643

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 96.7 bits (239), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 11/109 (10%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
            + C++C K F+R++WL+RH LSH+++RNF CPWC SKHKR+DNL +H+KLKH E +++ 
Sbjct: 476 AHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQ 535

Query: 178 IR----EYYPLTDFE-------DKDLNELMRSGYLHREDIKRVFLHLIG 215
           +R       P  + E       D ++  LM  G L+++++K++   L+ 
Sbjct: 536 LRINLKANNPNDNSEPTLEGNGDHNIRTLMGEGILNKDEVKKLLNSLVA 584

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score = 94.4 bits (233), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 10/110 (9%)

Query: 115 VTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           +T ++ C++C K F+R++WL+RH LSH+ +R FLCPWC S+HKR+DNL +H+KLKH   L
Sbjct: 349 LTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408

Query: 175 MKAIREYYPLTDF----------EDKDLNELMRSGYLHREDIKRVFLHLI 214
           +  +++   +             +  D+  L+  G ++++D+K+V   LI
Sbjct: 409 VIELKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 92.0 bits (227), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 12/115 (10%)

Query: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHM 171
           E +  SVY+C++C K F+R +WL+RH L+H++ R++ CP C SKHKR+DNL +H+KLKH 
Sbjct: 380 ERDTPSVYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHT 439

Query: 172 ELLMKAIRE----YYPLTDFEDKD--------LNELMRSGYLHREDIKRVFLHLI 214
             +++ +R+         D  ++D        +  L+  G L++ED+K+V   LI
Sbjct: 440 AFVLEQLRQDNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLI 494

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 51/61 (83%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           ++RCNVC K F+R++WL+RH LSH+++R + CPWC SKHKR+DNL +H+KLKH + +++ 
Sbjct: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312

Query: 178 I 178
           +
Sbjct: 313 M 313

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 51/67 (76%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHME 172
           D  +  YRC +C K F+R +WL+RH LSH+++R++LCPWC S+HKRRDNL +H+KLKH  
Sbjct: 394 DIESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPN 453

Query: 173 LLMKAIR 179
            L+  ++
Sbjct: 454 NLINELK 460

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHME 172
           D   +VY C++C+K F+R +WL+RH LSH+++R++ CPWC S+HKRRDNL +H+KLKH +
Sbjct: 382 DSENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSK 441

Query: 173 LLMKAIR 179
            L+  ++
Sbjct: 442 NLINELK 448

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score = 85.5 bits (210), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 68/104 (65%), Gaps = 6/104 (5%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + ++C  C K F+R++WL+RH LSH+ +R + CPWC S+HKR+DNL +H+KLKH + ++K
Sbjct: 111 AYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLK 170

Query: 177 AIRE--YYPLTDFED----KDLNELMRSGYLHREDIKRVFLHLI 214
            ++   Y    D E+     ++  ++  G L ++++K+V   L+
Sbjct: 171 KLKMTCYLEGDDGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELL 214

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 68/109 (62%), Gaps = 1/109 (0%)

Query: 73  PMQGYFVSSNNITGPI-IDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQRE 131
           P+  Y V S   + P  I      S  R   A    +G+N  +  + ++C++C+K F+R+
Sbjct: 211 PLSVYPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPENPHQCHLCDKSFKRK 270

Query: 132 AWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180
           +WL+RH LSH++ + F CPWC+S+HKR+DNL +H+KLKH   +++ ++ 
Sbjct: 271 SWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQELQS 319

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score = 87.4 bits (215), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 57/79 (72%), Gaps = 4/79 (5%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           V++C+ C K F+R +WL+RH L+H+ +R++ CPWC SKHKR+DNL +H+KLKH E++++ 
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 178 IREYYPLTDFEDKDLNELM 196
           +R    L + E   + E M
Sbjct: 619 LR----LENIEISTIEETM 633

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score = 86.7 bits (213), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 35/132 (26%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 396

Query: 178 IREYYPLTDFE-----------------------------------DKDLNELMRSGYLH 202
           +++   + ++                                    D ++  L+  G L+
Sbjct: 397 LKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLN 456

Query: 203 REDIKRVFLHLI 214
           ++D+KRV  +LI
Sbjct: 457 KDDVKRVLNNLI 468

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 86.7 bits (213), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (66%), Gaps = 5/90 (5%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C++C K F+R++WL+RH LSH+  RNF CP C SKHKR+DNL +H+KLKH++ ++K 
Sbjct: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKK 398

Query: 178 IRE-----YYPLTDFEDKDLNELMRSGYLH 202
           + +      Y L+       N  + +G LH
Sbjct: 399 LNKDDLIIKYNLSSNSTTLHNNNLTNGILH 428

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 86.3 bits (212), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 57/78 (73%), Gaps = 3/78 (3%)

Query: 106 KEEGKNEDEVTS---VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNL 162
            + G  +D  +S   +YRC++C K F+R++W +RH LSH++ + + CPWC+S+HKRRDNL
Sbjct: 372 SDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNL 431

Query: 163 FKHIKLKHMELLMKAIRE 180
           F+H+K KH+  +++ + E
Sbjct: 432 FQHMKTKHVHQVLQELME 449

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 67/114 (58%), Gaps = 19/114 (16%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
            YRC++C+K F+R +W +RH LSH++ + + CPWC+S+HKRRDNLF+H+K KH+  +++ 
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447

Query: 178 IREYYPLTDFE----------------DKDLNELMRSGYLHREDIKRVFLHLIG 215
           + E   + D +                +  +  L++ G + +E +K V   +I 
Sbjct: 448 LLE---VGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIA 498

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 85.1 bits (209), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 48/59 (81%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           +++C+ C K F+R++WL+RH LSH+  + + CPWC S+HKR+DNL +H+KLKH E+L++
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 242

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           Y+C++C K F+R++WL+RH LSH+N + F CPWC S HKR+DNL +H+KLKH + L+
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 49/63 (77%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C+ C K F+R++WL+RH LSH+  + + CPWC S+HKR+DNL +H+KLKH E+L++ 
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 178 IRE 180
           +  
Sbjct: 345 LSS 347

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 404

Query: 178 IRE 180
           +++
Sbjct: 405 LKK 407

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 84.7 bits (208), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386

Query: 178 IRE 180
           +++
Sbjct: 387 LKK 389

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385

Query: 178 IRE 180
           +++
Sbjct: 386 LKK 388

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           Y C VC+K F+R +WL+RH  SH+  +NF C WC  K+KR+DNL +HI+ KH +   K  
Sbjct: 324 YECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKTNKEP 383

Query: 179 RE 180
            E
Sbjct: 384 NE 385

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 91  YNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLC 149
           Y R+   P    + V E  K  +E    + C++C+K F+R   L+RH  S H+N+R F C
Sbjct: 626 YRRKSMTPSRRSSVVMESAKELEE--KPFHCHICSKSFKRSEHLKRHVRSVHSNERPFAC 683

Query: 150 PWCKSKHKRRDNLFKHIKL--KHMEL 173
             C  K  R DNL +HIK   KH ++
Sbjct: 684 HICDKKFSRSDNLSQHIKTHKKHGDI 709

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C++C + F R+  L+RH  SHTN++ FLC +C     RRD + +H    H  L+ K +
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALVSKTL 134

Query: 179 RE 180
            E
Sbjct: 135 EE 136

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+NDR F C  C+ K  R DNL +H+K
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKL--K 169
           DE    ++C+ CNK F+R   L+RH  S H+ +R F C +C  K  R DNL +H+K   K
Sbjct: 615 DEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKK 674

Query: 170 HMEL 173
           H ++
Sbjct: 675 HGDI 678

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL--MK 176
           + C VC + F R+  L+RH  SHTN++ FLC +C     RRD + +H +  H  L+   K
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLMDQDK 139

Query: 177 AIREYYPLTDFEDKDLNE 194
            +RE   +T  E + +NE
Sbjct: 140 DLRE-SAVTKDEKQQINE 156

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C +C + F R+  LRRH  SHTN++ FLC +C     RRD + +H +  H  L+
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 138

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           DE    ++C  C K F+R   L+RH  S H+ DR F C +C  K  R DNL +H+K
Sbjct: 692 DEEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKL--KHMEL 173
           ++C  C K F+R   L+RH  S H++DR F C +C  K  R DNL +H+K   KH ++
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDI 561

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 111 NEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           N D +   ++CN C K F+R   L+RH  S H+++R F C +C+ K  R DNL +H+K
Sbjct: 454 NNDPLLKTFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 113 DEVTSVYR-CNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLK 169
           DE++ + + C VC K+  R + L+ H+L HT D  F CPW  CK     + N+ +H+K  
Sbjct: 278 DELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337

Query: 170 HMELLMKA 177
             +   KA
Sbjct: 338 ERKKQAKA 345

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 91  YNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLC 149
           Y R+   P    + V E  K  +E    + C++C K F+R   L+RH  S H+N+R F C
Sbjct: 620 YRRKSMTPSRRSSVVMESTKELEE--KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC 677

Query: 150 PWCKSKHKRRDNLFKHIKL--KHMEL 173
             C+ K  R DNL +HIK   KH ++
Sbjct: 678 HICEKKFSRSDNLSQHIKTHKKHGDI 703

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
            DE    ++C  C+K F+R   L+RH  S H+++R F C +C+ K  R DNL +H+K
Sbjct: 520 SDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 576

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 38/144 (26%), Positives = 60/144 (41%), Gaps = 31/144 (21%)

Query: 54  VTVPQYIPNPVPQYVIAGQPMQGY---------FVSSNNITGPIIDYNRRES-------- 96
           V++ + + +P   Y +   P+Q Y            +NN+T P  + NRR+S        
Sbjct: 672 VSLERNLSSPTSSY-LNTIPIQNYQQMYNNNTKITQNNNVTAPPKNKNRRKSAIVTSSQL 730

Query: 97  ------------EPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTN 143
                       +        +    N  +    ++C  C K F+R   L+RH  S H++
Sbjct: 731 KGNSQSPPLLNGQKATTTTAKRSVSYNFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSS 790

Query: 144 DRNFLCPWCKSKHKRRDNLFKHIK 167
           +R F CP C  K  R DNL +HIK
Sbjct: 791 ERPFACPTCDKKFSRSDNLAQHIK 814

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMKA 177
           +C VC KI  R + L+ H++ HT D  F CPW  C      + N+F+H+K    +L  + 
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKSHKRKLEQRQ 515

Query: 178 IRE 180
           +++
Sbjct: 516 LQK 518

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 91  YNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLC 149
           Y R+   P    + V E  K  +E    + C++C K F+R   L+RH  S H+N+R F C
Sbjct: 621 YRRKSMTPSRRSSVVIESTKELEE--KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC 678

Query: 150 PWCKSKHKRRDNLFKHIKL--KHMEL 173
             C  K  R DNL +HIK   KH ++
Sbjct: 679 HICDKKFSRSDNLSQHIKTHKKHGDI 704

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 80  SSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHL 139
           SS  I+ P+I   ++ S P  M    K      D     + C++C + F R+  L+RH  
Sbjct: 42  SSPTISPPVI--GQKASTPATMPIPKKSRTIKTDR-PRPFLCSICTRGFARQEHLKRHQR 98

Query: 140 SHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           +HTN++ FLC +C     RRD + +H +  H  L
Sbjct: 99  AHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSTL 132

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C +C + F R+  L+RH  SHTN++ FLC +C     RRD + +H +  H  L+
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 128

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           Y C  C + F R+  L+RH  SHTN++ FLC +C     RRD + +H +  H  L+
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLM 160

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           + C VC + F R+  L+RHH SHTN++ + C  C     RRD L +H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 92  NRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCP 150
           NRR+S    +     + G +ED +   ++C+ C K F+R   L+RH  S H+N+R F C 
Sbjct: 290 NRRQS---TIGTSTSDIGNDED-LDKQFKCSECEKGFKRSEHLKRHFRSVHSNERPFPCM 345

Query: 151 WCKSKHKRRDNLFKHIK 167
            C+ K  R DNL +H+K
Sbjct: 346 LCEKKFSRSDNLSQHLK 362

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKL--K 169
           DE    ++C+ C K F+R   L+RH  S H+ +R F C  C  K  R DNL +H+K   K
Sbjct: 380 DENEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKTHKK 439

Query: 170 HMEL 173
           H EL
Sbjct: 440 HGEL 443

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C+ C + F R+  L+RH  SHTN++ FLC +C     RRD + +H    H  L+  ++
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGTSM 130

Query: 179 REY 181
             Y
Sbjct: 131 DSY 133

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           Y+C +C KIF R + L+ H L+HT  R F CP+  C      + N+ +H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 91  YNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLC 149
           Y R+   P    + V E   + +E    + C++C K F+R   L+RH  S H+N+R F C
Sbjct: 621 YRRKSMTPSRRSSVVMESTNDLEE--KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC 678

Query: 150 PWCKSKHKRRDNLFKHIKL--KHMEL 173
             C  K  R DNL +HIK   KH ++
Sbjct: 679 HICDKKFSRSDNLSQHIKTHKKHGDI 704

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           DE    ++C  C K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 374 DEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 429

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 65  PQYVIAGQPMQGYFVSSNNITGPIIDYNRR-ESEPRCMYAYVKEEGKNEDEVTSVYRCNV 123
           P+ + A     G   SSNN+   +   N++ E  P+ +    +  G+       ++ C V
Sbjct: 5   PEALKAAAKNGGIITSSNNMNSKV---NKKFEQLPQNL----QYRGQTPSGKPRLFVCEV 57

Query: 124 CNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           C + F R   L RH   HT ++ + C  C+ K+ RRD L +H+   H
Sbjct: 58  CTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH 104

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           + C++C + F R+  L+RH  +HTN++ FLC +C     RRD + +H +  H  L
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSSL 86

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           +++   + C++C+K F+R   L+RH  S H+ DR F C  C+ K  R DNL +HIK
Sbjct: 529 NDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           Y C +C + F R+  L+RH  SHTN++ FLC +C     RRD + +H    H  L+
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHGSLV 112

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           ++ C+VC++ F R+  L RH  SHTN++ + C  C  K  RRD L +H +  H
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180
           C VC++ F R   L+RH  SHT ++ +LC +C     R+D + +H    H E+L      
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL----SA 79

Query: 181 YYPLTDFEDKDLNELMRSGYLHREDIKRV 209
             P  D +   L EL   G++   ++ R+
Sbjct: 80  LGPTADIKPVSLEELYAPGFVAESNVVRI 108

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 10/91 (10%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C++C + F R   L+RH +SHTN++ FLC +C     R+D + +H    H  L+ +  
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQK- 94

Query: 179 REYYPLTDFEDKDLNELMRSGYLHREDIKRV 209
                    + KD N    SG    E+I +V
Sbjct: 95  ---------DSKDSNSNTNSGSATNENIVKV 116

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 76  GYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLR 135
           G   +SNN+   I   N+R ++   +   ++  G        ++ C+ C + F R+  L 
Sbjct: 12  GIITASNNMNSKI---NKRFAQ---LPENLRLNGVTPSGKPRLFVCHTCTRAFARQEHLI 65

Query: 136 RHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           RH  SHTN++ ++C  C  +  RRD L +H    H
Sbjct: 66  RHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLH 100

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C++C + F R+  L+RH  +HTN++ FLC +C     RRD + +H    H  L+ K
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSK 118

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H+L HT D  F CPW  C      + N+ +H+K
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C++C + F R+  L+RH  +HTN++ FLC +C     RRD + +H    H  L+ K
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSK 118

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C++C + F R+  L+RH  +HTN++ FLC +C     RRD + +H    H  L+ K
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSK 118

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C++C + F R+  L+RH +SHTN++ FLC +C     R+D + +H    H  L+ K
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPSLISK 91

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           D+ +  ++C  C K F+R   L+RH  S H+++R F C +C+ K  R DNL +H+K
Sbjct: 584 DDESKPFKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLK 639

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 35/59 (59%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           + C++C + F R+  L+RH  +HT+++ FLC +C     RRD + +H    H  L+ K+
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLISKS 112

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C+VC + F R+  L+RH  SHTN++ F+C +C     RRD + +H    H  L+
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALI 107

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKL--K 169
           DE+   ++C  C K F+R   L+RH  S H+ +R F C +C  K  R DNL +H+K   K
Sbjct: 431 DEIEKPFKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKK 490

Query: 170 HMEL 173
           H + 
Sbjct: 491 HGDF 494

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           Y C +C + F R+  LRRH  +HTN++ FLC +C     RRD + +H    H  L+
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHPTLI 142

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           ++ C+ C + F R+  L RH  SHTN++ FLC  C     RRD L +H +  H
Sbjct: 151 LFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C++C + F R+  L+RH  +HTN++ FLC +C     RRD + +H    H  L+ K
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSK 118

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           Y C+ C+K F R     RH  SHT  + F C  C+    RRD L +HI+  H ELL+
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLL 64

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKL--KHMEL 173
           ++C+ C K F+R   L+RH  S H+ +R F C  C+ K  R DNL +H+K   KH +L
Sbjct: 712 FQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKTHKKHGDL 769

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C VC + F R+  L+RH+ SHTN++ + C  C     RRD L +H +  H   L + I
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETI 169

Query: 179 RE 180
            +
Sbjct: 170 SQ 171

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+++R F C +C  K  R DNL +H+K
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 491

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C++C KI  R A L+ H L HT D  F CPW  C      + N+ +H+K
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 76  GYFVSSNNITGPIIDYNRR-ESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWL 134
           G   S+NN+   +   N++ +  P+ +  Y    GK       ++ C +C + F R+  L
Sbjct: 22  GIVTSNNNMNSKV---NKKFDKLPQNLGLY----GKTPSGKPRLFVCKICTRAFARQEHL 74

Query: 135 RRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
            RH  SHT ++ + C  C  +  RRD L +H    H
Sbjct: 75  TRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLH 110

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C+K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 57  PQYIPNPVPQYVIAGQPMQGYFVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVT 116
           P  + N  P    +  P Q +    N+I   I    ++ +  +    +VK    +   + 
Sbjct: 248 PSTLINATPVLAKSIDPSQNFIAKRNSIHTSI----KQSASSKDKLPFVKRNSISPQIIY 303

Query: 117 SV--YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           S   ++CN C K F+R   L+RH  S H+ +R + C +C+    R DNL +H+K
Sbjct: 304 SDKPFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           EDE    ++C  C K F+R   L+RH  S H+ +R F C +C  K  R DNL +H+K
Sbjct: 615 EDE--KPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           D+ +  + C  C + F+R+  L+RH LS H  ++ F CP C     R DNL +HIK
Sbjct: 394 DDPSKQFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           +E    ++C  C K F+R   L+RH  S H+++R F C +C  K  R DNL +H+K
Sbjct: 635 EEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H+L HT D  F CPW  C      + N+ +H K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 34/62 (54%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C  C + F R+  L+RH  SHTN++ FLC +C     RRD + +H    H  L+   +
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNEL 131

Query: 179 RE 180
           ++
Sbjct: 132 QQ 133

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%)

Query: 109 GKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           GK       ++ C++C + F R+  L RH  SHT ++ + C  C+ K  RRD L +H + 
Sbjct: 34  GKTPSGKVRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQK 93

Query: 169 KH 170
            H
Sbjct: 94  IH 95

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 90  DYNRRESEP--RCMYAYVKEEGKNEDEVTSVY---RCNVCNKIFQREAWLRRHHLSHTND 144
           D  R +SEP      +    + KN + ++S     +C VC KI  R + L+ H+L HT D
Sbjct: 220 DNGRTKSEPGSSLSSSAAFSDWKNGNRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGD 279

Query: 145 RNFLCPW--CKSKHKRRDNLFKHIK 167
             F C W  C      + N+ +H+K
Sbjct: 280 TPFKCTWEGCSKSFNVKSNMLRHLK 304

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 633

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           Y C+ C K F R     RH  SHT  + F C  C     RRD L +HI+  H   L++  
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQCT 67

Query: 179 RE 180
           +E
Sbjct: 68  KE 69

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 620

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C VC + F R+  L+RH+ SHTN++ + C  C     RRD L +H +  H   L + I
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETI 163

Query: 179 RE 180
            +
Sbjct: 164 SQ 165

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 84  ITGPIIDYNRR-ESEPRCMY--AYVKEEGKNEDEVTSVY---RCNVCNKIFQREAWLRRH 137
           I+G   D N R +SEP      +    + KN   ++S     +C VC KI  R + L+ H
Sbjct: 213 ISGVHEDANSRTKSEPGTTSNSSAAFSDWKNGSRISSAKLRKQCPVCGKICSRPSTLKTH 272

Query: 138 HLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +L HT D  F C W  C      + N+ +H+K
Sbjct: 273 YLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           Y C  C K F     L RH   HT ++N LCP+  CK +  R+DN  +H +
Sbjct: 185 YLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYR 235

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 109 GKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           GK       ++ C +C + F R+  L RH  SHT ++ + C  C  K  RRD L +H + 
Sbjct: 106 GKTPSGKVRLFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQK 165

Query: 169 KH 170
            H
Sbjct: 166 VH 167

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           D+    ++C+ C K F+R   L+RH  S H+++R F C +C+ K  R DNL +H+K
Sbjct: 667 DDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC K+  R + L+ H+L HT D  F C W  C      + N+ +H+K
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           C  C K F R + LR H L H+ D+ F C W  C  K   + NL +H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C VC + F R+  L+RH+ SHTN++ + C  C     RRD L +H +  H   L + I
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETI 163

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 93  RRESEPRCMY--AYVKEEGKNEDEVTSVY---RCNVCNKIFQREAWLRRHHLSHTNDRNF 147
           R +SEP  +   +    + K +  ++S     +C VC KI  R + L+ H+L HT D  F
Sbjct: 223 RTKSEPGAVLNGSATFSDWKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPF 282

Query: 148 LCPW--CKSKHKRRDNLFKHIK 167
            C W  C      + N+ +H+K
Sbjct: 283 KCTWEGCTKSFNVKSNMLRHLK 304

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C  C K F R + LR H   HT DR F CP+  C      R N+ +H KL
Sbjct: 183 YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 234

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + C  C+K F+R   L+RH  S H+ +R F C +C+ K  R DNL +H+K
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLK 631

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 94  RESEPRCMYAYVKEEGKNEDEVTSVYR---CNVCNKIFQREAWLRRHHLSHTNDRNFLCP 150
           R+S   C+ +     GK   +    ++   C VC K   R   LR H L HT  R F C 
Sbjct: 257 RQSSNNCLISKKSSNGKGNVKKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCS 316

Query: 151 W--CKSKHKRRDNLFKHIK 167
           W  CK+    + N+ +H K
Sbjct: 317 WPNCKASSSVKSNITRHFK 335

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKHIKLKHMELLMK 176
           Y+C+ C K+F R + L+ H L HT DR F+CP   C      + N+ +H K  H +L ++
Sbjct: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFK-THKQLGLR 107

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H L HT D  F C W  C+     + NL +H+K
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKH 165
            + C VC K F R+  L RH  SHTN++ F C  C     RRD L +H
Sbjct: 48  TFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRH 95

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKH 165
           ++ C++C + F R+  L RH  SHT ++ + C  C+ K  RRD L +H
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H+L HT D  F C W  C      + N+ +H+K
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           ++ C VC + F R+  L RH  SHT ++ ++C  C+ +  RRD L +H +  H
Sbjct: 124 LFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLH 176

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           + C VC + F R   L RH  SHTN++ + C  C     RRD L +H    H
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++C  C K F+R   L+RH  S H+++R F C +C  +  R DNL +H+K
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           ++ C VC + F R+  L RH  SHT ++ + C  C  K  RRD L +H    H
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIH 137

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMKA 177
           +C VC K+  R + L+ H+L HT D  F C W  C      + N+ +H+K  H + L K 
Sbjct: 232 KCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVK-SHEKKLSKK 290

Query: 178 IR 179
           ++
Sbjct: 291 LQ 292

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           Y C+ C K F R     RH  SHT  + F C  C+    RRD L +HI+  H ELL+
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVHRELLL 68

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELL 174
           ++++C +CN++  R   L  H L HT D+ F C W  C      + NL +H+K+ H+   
Sbjct: 424 AIHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI-HIHKQ 482

Query: 175 MKAIREYYPLTDFEDKD 191
            K  +E     D  + D
Sbjct: 483 KKLNKETRETNDTTNND 499

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           Y C+ C + F R     RH  SHT  + F C  C     RRD L +HI+  H  +L++
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHRSMLLE 65

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 109 GKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           GK       ++ C +C + F R+  L RH  SHT ++ + C  C     RRD L +H   
Sbjct: 49  GKTPSGKPRLFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHK 108

Query: 169 KH 170
            H
Sbjct: 109 VH 110

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ED++   + C  C K F+R   L+RH  S H+ +R + C  C  K  R DNL +H+K
Sbjct: 596 EDDMEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           D+    ++C+ C K F+R   L+RH  S H+ +R F C +C  +  R DNL +H+K
Sbjct: 909 DDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C  C K F R + L  H+ +HT D+ F CP+  C  +   R N+ +H KL
Sbjct: 238 YVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKL 289

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C+ C K F R + LR H   HT DR F CP+  C      R N+ +H KL
Sbjct: 207 YICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 258

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H L HT D  F C W  C+     + N+ +H+K
Sbjct: 67  QCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLK 116

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           C +C + F R   L+RH  +HTN++ FLC +C     RRD + +H    H  L+ K
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHPTLVSK 90

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C  C K+F R + L  H+ +HT D+ + CP+  C  +   R N+ +H KL
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKL 249

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 30/61 (49%)

Query: 116 TSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           T  + C+ CNK F R     RH  SH   + F C  C     RRD L +HI+  H  LL+
Sbjct: 9   TKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVHRILLL 68

Query: 176 K 176
           +
Sbjct: 69  R 69

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           +C VC KI  R + L+ H+L HT D  F C W  C      + N+ +H+K     L+ K
Sbjct: 341 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLKSHERRLIKK 399

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 18/79 (22%)

Query: 100 CMYAYVKEEGKNEDEVTSVYR---------CNVCNKIFQREAWLRRHHLSHTNDRNFLCP 150
           CMY        +  ++ ++YR         C++C KI  R + L+ H+L H+ D  F C 
Sbjct: 234 CMYG-------DSSKLANIYRDPKIKNKKQCDICGKICSRPSTLKTHYLIHSGDTPFKCA 286

Query: 151 W--CKSKHKRRDNLFKHIK 167
           W  C      + N+ +H K
Sbjct: 287 WKGCTKAFNVKSNMLRHFK 305

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC K+  R + L+ H+L HT D  F C W  C      + NL +H+K
Sbjct: 371 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLK 420

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           +C +C K+  R + LR H+L HT D  F C W  C      + N+ +H++    ++  K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQKKIAKK 244

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           Y C+ C K F R     RH  SHT  + F C  C     RRD L +HI+  H   L   +
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVHKSSLNSML 67

Query: 179 REYYPLTDFEDKDLNELMRS 198
           +         +K++ E+M S
Sbjct: 68  KT-------GNKNMEEVMNS 80

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 87  PIIDYN-RRESEPRCMYAYVKEEGKN--EDEVTSVYRCNVCNKIFQREAWLRRHHLSHTN 143
           PI+D N +  + P    + +   GK   + +V    +C+VC K+  R + L+ H L HT 
Sbjct: 174 PIMDLNGQSNTSPHRNSSKINSPGKAILKAKVRLRKQCSVCGKVCSRPSTLKTHFLIHTG 233

Query: 144 DRNFLCPW--CKSKHKRRDNLFKHIK 167
           D  F C W  C      + N+ +H+K
Sbjct: 234 DTPFKCSWEGCHKAFNVKSNMLRHMK 259

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + +  + C+ C++ F+R+  L+RH  S H  ++ F C  C  K  R DNL +H+K
Sbjct: 335 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 42/75 (56%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C +C++ F R+  L+RH  SHT+++ FLC  C     R+D + +H++  H +   + +
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQL 86

Query: 179 REYYPLTDFEDKDLN 193
            +      +++K LN
Sbjct: 87  DKTIGRGKWDEKILN 101

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 116 TSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKL 168
            +++ C+VC K F R + L  H L HT  + F+C  P C  +   + NL +H K+
Sbjct: 108 ATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKI 162

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R+  L+RH  SHT ++ +LC +C     RRD + +H +  H  L+
Sbjct: 36  FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 91

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 119 YRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           Y C++C K F+R   L+RH  + H   R F C  C  +  R DNL +H+++   + +M+ 
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 178 IRE 180
           IR+
Sbjct: 283 IRK 285

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R+  L+RH  SHT ++ +LC +C     RRD + +H +  H  L+
Sbjct: 125 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 180

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC KI  R + L+ H+  HT D  F C W  C      + N+ +H+K
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMK 402

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 108 EGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKH 165
            G +  E  + Y C  CNK F+R + L  H   HT ++ ++CP+  C+     + N+ +H
Sbjct: 247 SGPSISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRH 306

Query: 166 IKLKHMEL 173
            KL H +L
Sbjct: 307 YKL-HFKL 313

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R+  L+RH  SHT ++ +LC +C     RRD + +H +  H  L+
Sbjct: 104 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 159

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           Y C+ C K F R     RH  SH   + F C  CK    RRD L +HI+  H   L+ +
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRTFLLSS 66

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 116 TSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + ++ C  CN+ F+R+  L+RH+ S H  ++ F C  C  K  R DNL +HIK
Sbjct: 631 SKIFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 147 FLCPWCKSKHKRRDNLFKHIKLKHM 171
           F+CP+C  + KR+++L +H +  HM
Sbjct: 634 FICPYCNRRFKRQEHLKRHNRSLHM 658

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 17/107 (15%)

Query: 84  ITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYR------------CNVCNKIFQRE 131
           +TG ++  + R S  + +   +    KN  +V S  R            C  C KI  R 
Sbjct: 156 VTGSLLPTSSRSSSLQDVKPII---NKNSSKVPSKKRANRTLLSKLRKQCPACGKICSRP 212

Query: 132 AWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           + L+ H+L HT D  F C W  C      + N+ +H+K    +++ K
Sbjct: 213 STLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIKK 259

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R+  L+RH  SHT ++ +LC +C     RRD + +H +  H  L+
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 206

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + +  + C+ C++ F+R+  L+RH  S H  ++ F C  C  K  R DNL +HIK
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           Y C+ C K F R     RH  SHT  + F C  C+    RRD + +HIK  H  L++
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKICQHCFVRRDLVQRHIKTVHRLLIL 64

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 112 EDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           E +   +++C +C+KI  R   LR H L HT ++ + C W  C +    + N+ +H K
Sbjct: 289 EKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           C VC K+  R + L+ H L HT D  F C +  CK     + N+F+H+K
Sbjct: 197 CPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLK 245

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 111 NEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           N   +   ++C+ C K F+R   L+RH  S H+ +R F C  C  K  R DNL +H+K
Sbjct: 681 NVSAINKPFKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           Y C+ C K F R     RH  SH   + F C  CK    RRD L +HI+  H   L+ +
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRSFLLSS 66

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHME 172
           +C VC K+  R + LR H   HT  R FLC W  C+ +   + N+ +H +L  ++
Sbjct: 275 QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQ 329

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           +C  C K+F R + L+ H L HT DR F C W  C+     + N+ +H +L
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRL 432

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHME 172
           + CN+C+K+F +   L  H  SH  D+ + C WC     +  NL  H++L   E
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRLHTGE 441

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHI 166
           Y+C  C K F +   L+ H   HT ++ F C +C  +  R+ NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 30/78 (38%), Gaps = 2/78 (2%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKHIKLKHMELLMK 176
           + C  C+K F R+  L  H ++H   R F+C    C     +  N+  H    H   L +
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTE 503

Query: 177 AIREYYPLTDFEDKDLNE 194
             R    L   E+    E
Sbjct: 504 LTRRLANLDPAENISAEE 521

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           +C +C K+  R + LR H+L HT D  F C W  C      + N+ +H++    ++  K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177
           Y C+ C K F R     RH  SH   + F C  CK    RRD L +HI+  H   L+ +
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRTFLLSS 66

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           +C +C K+  R + LR H+L HT D  F C W  C      + N+ +H++    ++  K
Sbjct: 186 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAKK 244

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           Y C VC K F     L RH+  HT ++  +CP+  C  +  R DN  +H K       +K
Sbjct: 402 YLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTH-----LK 456

Query: 177 AIREY 181
            ++EY
Sbjct: 457 RLKEY 461

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C++C+K F+R + L+ H   HT  + +LCP+  C      + N+ +H KL
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           +C +C K+  R + LR H+L HT D  F C W  C      + N+ +H++    ++  K
Sbjct: 188 QCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKVAKK 246

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           VY C +C + F     L RH  S H+ ++ F CP C  + KRRD++ +H+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 27/57 (47%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLM 175
           Y C+ C K F R     RH  SH   + F C  CK    RRD L +HI+  H   L+
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRSFLL 64

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           ++C VC K F+R + L  H   HT  + ++CP+  C      + N+F+H KL H +L   
Sbjct: 208 FKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKL-HFKLPSG 266

Query: 177 A 177
           A
Sbjct: 267 A 267

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKH 170
           ++ C  C + F R+  L RH  SHT ++ + C  C  +  RRD L +H    H
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVH 81

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           +C +C K+  R + L+ H L HT  R F C W  CK     + N+ +H+KL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           C+ CN+ F R     RH  SHT  + + C  C  +  RRD L +HI+  H  LL+ 
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKSLLLS 66

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKL 168
           Y+C +CNK F R    RRH  +HT ++   C  P C  +  R D L +H+++
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHME 172
           +C VC K+  R + LR H   HT  R FLC W  C+ +   + N+ +H +L  ++
Sbjct: 297 QCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQVQ 351

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 36  PNVPSADTMNYTERMGDIVTVPQY-------IPNPVPQYVIAGQPMQGYFVSSNNITGPI 88
           PN  S + +++ + +G    +P+        IP    +    G       V   ++    
Sbjct: 190 PNTTSVNALSFPQSVGSTTNIPRAKSMEKLAIPTMASEKASIGDVFASDIVPKASVRNLP 249

Query: 89  IDYNRRESEPRCMYAYVKEEGKNEDEVT------SVYRCNVCNKIFQREAWLRRHHLSHT 142
           ++  R    P  + +Y+    K +   T      +  +C++C K+  R + LR H L HT
Sbjct: 250 LNSKRLSFSP-VIQSYISPTPKTQSSATPNEKNLARNQCHICGKVCSRPSTLRTHVLVHT 308

Query: 143 NDRNFLCPW--CKSKHKRRDNLFKHIK 167
             + + C W  C      + N+ +H K
Sbjct: 309 GVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           D+ + VY C  C + F     L RH  S H+ ++   CP C  K KRRD++ +H+  K
Sbjct: 749 DDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 806

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKL 168
           C VC +  +R + L+ H L+HT  R F C  P C      R N+ +H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           S+Y C VC+K F R   L+ H  +HTN+R F C  C     R     +H + +H +L
Sbjct: 491 SIYACPVCDKKFTRPYNLKSHKRTHTNERPFSCSQCGKTFAR-----EHDRKRHEDL 542

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 37/89 (41%), Gaps = 14/89 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C+ C K F RE   +RH   HT  + ++C         W C  +  R D L +H K +
Sbjct: 521 FSCSQCGKTFAREHDRKRHEDLHTGKKRYVCGGKLKSGESWGCGKRFARSDALGRHFKTE 580

Query: 170 H-----MELLMKAIREYYPLTDFEDKDLN 193
                   L  +A RE   + D  D  LN
Sbjct: 581 SGRKCITPLYEEASRERGAVQDTTDLLLN 609

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C VC K+  R + L+ H+L HT D  + C W  C      + N+ +H+K
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLK 405

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 27/55 (49%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           Y C+ C K F R     RH  SHT  + F C  C     RRD + +HIK  H ++
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNICNHAFVRRDLVQRHIKTVHKDI 62

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHI 166
           ++C  CN  F +   L+ H   HT++++F C  C  K  R+ NL  HI
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHI 326

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           + C +CNK F R+  L  H  +H   R  +C +  CK    +  N+  H    H E + +
Sbjct: 307 FECEICNKKFSRKGNLASHIATHNRLRLHICKFDHCKKSFTQLGNMKAHHNKFHRETMAR 366

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMEL 173
           Y C++C K F+R + L  H   HT ++ F CP+  C      + N+ +H KL H +L
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL-HFKL 360

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++Y C++C+K F R   L+ H  +HTN+R F+C  C     R+ +  +H  L
Sbjct: 497 AIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C++C K F R+   +RH   H+  + ++C         W C  K  R D L +H K +
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

Query: 170 HMELLMKAIREYYPLTDFED 189
             +  +  + E     +F+D
Sbjct: 587 AGKRCISLLYEEAGPGNFDD 606

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           +C++C K   R + L+ H L HT DR F C W  C  +   + N+ +H KL
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKL 542

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           +C +C KI  R + L+ H L HT DR F C W  C      + N+ +H KL
Sbjct: 41  QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKL 91

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 106 KEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLF 163
           +E G ++ E    + C VC+K F     L RH+  HT ++N  CP   C  +  R DN  
Sbjct: 106 QEAGVSKVEQRRRHVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSRHDNCI 165

Query: 164 KH 165
           +H
Sbjct: 166 QH 167

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 78  FVSSNNITGPIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRH 137
            +++++IT  ++    +   P    + +  E     E    Y C  C + F     L RH
Sbjct: 711 LLATDSITNAVMTGTIKPDRPASPISKISAEEIIISEKGKAYICQECQRQFSSGHHLTRH 770

Query: 138 HLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
             S H+ ++   CP C  K KRRD++ +H+  K
Sbjct: 771 KKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           Y C  C + F R     RH  SHT  + F C  C     RRD L +HI+  H  +L++
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLLE 65

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 11/86 (12%)

Query: 88  IIDYNRRESEPRCMYA---YVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTN 143
           I D+++R   P  + +    V ++GK       VY C  C + F     L RH  S H+ 
Sbjct: 708 IADFSKRPIAPSKINSEEIIVSDKGK-------VYVCQECRRQFSSGHHLTRHKKSVHSG 760

Query: 144 DRNFLCPWCKSKHKRRDNLFKHIKLK 169
           ++   CP C  K KRRD++ +H+  K
Sbjct: 761 EKPHSCPKCGKKFKRRDHVLQHLNKK 786

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + T  + C  C + F+R+  L+RH  S H  ++ + C  C  K  R DNL +HIK
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 105 VKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLF 163
           + E GK       VY C  C + F     L RH  S H+ ++ + CP C  K KRRD++ 
Sbjct: 781 ISENGK-------VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVL 833

Query: 164 KHIKLK 169
           +H+  K
Sbjct: 834 QHLNKK 839

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%)

Query: 110 KNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           +N  +  S+Y C +C K F R   LR H  +HTN+R F+C  C     R  +  +H  L
Sbjct: 411 RNSKKNPSIYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C VC K F RE   +RH   HT  + ++C         W C  K  R D L +H K +
Sbjct: 448 FVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKTE 507

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C+VC K F+R + L  H   HT ++ + CP   CK     + N+ +H KL
Sbjct: 276 YSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKL 327

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKL 168
           C VC +  +R + L+ H L+HT  R F C  P C      R N+ +H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++Y C++CNK F R   L+ H  +HT++R F C  C     R+ +  +H  L
Sbjct: 436 AIYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFARQHDRKRHEDL 487

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIK 167
           + CN+C K F R+   +RH   H+  + ++C         W C  K  R D L +H K
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFK 523

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLM 175
           Y C  C+K F     L RH+  HT ++N  CP+  C+ +  R+DN  +H +  H + +M
Sbjct: 172 YICKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQRFSRQDNCLQHYRT-HFKSIM 229

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKHIK 167
           Y C +C K F     L RH+  HT ++N +CP   C  +  R DN  +H K
Sbjct: 201 YVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R+  L+RH  SHT +R FLC  C     R+D + +H +  H  ++
Sbjct: 49  FLCPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHATIV 104

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKH 165
           Y C +C++ F     L RH+  HT ++N +CP+  C  +  R DN  +H
Sbjct: 100 YVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + +  + C  C++ F+R+  L+RH  S H  ++ + C  C  K  R DNL +HIK
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++Y CN+C+K F R   L+ H  +HT++R F C  C     R+ +  +H  L
Sbjct: 424 AIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C+VC K F R+   +RH   H+  + ++C         W C  K  R D L +H K +
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           Y C+VC K F+R + LR H    + +R + CP+  C      + N+ +H KL H  L   
Sbjct: 239 YFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL-HFRLTSG 297

Query: 177 A 177
           A
Sbjct: 298 A 298

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + T  + C  C++ F+R+  L+RH  S H  ++ F C  C  K  R DNL +HIK
Sbjct: 498 DATKHFGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           ++CN C K F +   LR H   HT ++ + C  C  +  R+ NL  H KL H ++
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTHRDV 681

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELLMK 176
           YRC +C+K F R+  L  H L+H + + F+C    C     +  N+  H    H++ L++
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLE 715

Query: 177 ---AIREYYPLTDF--EDKDLNELMRSGY 200
               I E  P      ED++L E   S Y
Sbjct: 716 LTSKIAEMNPNETIPEEDRELLEYFASIY 744

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 26/55 (47%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           E +  + C  C+++F +   L  H  SH   + F C +C  +  +  NL  H +L
Sbjct: 595 EGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           VY C  C + F     L RH  S H+ ++ + CP C  K KRRD++ +H+  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           Y+CN C K F +   L+ H   HT ++ + C  C  +  R+ NL  H+      L  K +
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHV------LTHKKL 598

Query: 179 REYYPLTDFEDKDLNEL 195
           + Y+   D  +K   +L
Sbjct: 599 KPYFCKLDNCNKTFTQL 615

 Score = 30.8 bits (68), Expect = 3.4,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++C  C++ F +   L  H  SH   + + C +C  K  +  NL  H +L
Sbjct: 517 HQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKH 165
           + T  Y C +CNK F R   L+ H  +HTN++ F+C  C     R+ +  +H
Sbjct: 575 QSTGGYICELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFARQHDRKRH 626

 Score = 36.2 bits (82), Expect = 0.046,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIK 167
           C +CNK F R+   +RH   HT  + ++C         W C  K  R D L +H K
Sbjct: 610 CKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALGRHFK 665

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKLKHMELLMK 176
           +RC  C++ F R    +RH  +HT ++  +C  P CK    RRD L +HI+  H+    +
Sbjct: 21  FRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRT-HLGSSYR 79

Query: 177 AIRE 180
            IR+
Sbjct: 80  RIRK 83

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKH 165
           +RC  C+K F     L RH+  HT ++N  C  P C  +  R DN  +H
Sbjct: 193 HRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQH 241

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           +C +C K+  R + L+ H L HT    F CPW  C      + N+ +H K
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++Y C +C+K F R   L+ H  +HTN+R F+C  C     R+ +  +H  L
Sbjct: 649 AIYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C++CNK F R+   +RH   HT  + ++C         W C  K  R D L +H K +
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTE 738

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 113 DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           +E   VY C  C + F     L RH  S H+ ++ + CP C  + KRRD++ +H+  K
Sbjct: 754 NEYGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 87  PIIDYNRRESEPRCMYAYVKEEGKNEDEVTSVYR-----CNVCNKIFQREAWLRRHHLSH 141
           P+   N    + + +  +V ++     +  S YR     C +C K F+R + LR H + H
Sbjct: 212 PVAHVNHHNQQQQHLLLHVTQKTHKCPKRCSSYRKSGSICEICGKDFKRPSALRTHMVVH 271

Query: 142 TNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMELL 174
            ND+ + C    C+ +   + N+ +H++ KH E++
Sbjct: 272 NNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKEVV 305

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + T  + C  C + F+R+  L+RH  S H  ++ + C  C  K  R DNL +HIK
Sbjct: 509 DATKPFGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 116 TSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
            SVY C +C+K F R   L+ H  +HT++R F C  C     R+ +  +H  L
Sbjct: 410 ASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 9/60 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           + C +C K F R+   +RH   HT  + + C         W C  K  R D L +H K +
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 11/93 (11%)

Query: 87  PIIDYNRRESEPRCMYAYVKEEG--KNEDEVT---------SVYRCNVCNKIFQREAWLR 135
           P   +N R  E    Y + +E+    N   VT         +VY C +C+K F R   L+
Sbjct: 365 PSKSHNDRSEEQSDGYDFTEEDSLPMNVSGVTRRKSIQKNPAVYACELCDKKFTRPYNLK 424

Query: 136 RHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
            H  +HT++R F C  C     R+ +  +H  L
Sbjct: 425 SHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 9/60 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--------W-CKSKHKRRDNLFKHIKLK 169
           + C +C K F R+   +RH   HT  + + C         W C  K  R D L +H K +
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKLKHME 172
           ++C++C K F R    RRH  +HT ++   C  P C  +  R D L +H++  HM 
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR-THMS 67

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKH 165
           ++C+ C K F +++ L RH  SHT+D+ F C  C      R  L +H
Sbjct: 137 FKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRH 183

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 116 TSVYRCNV--CNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHI 166
           + VY C+   CNK F R + L  H L+ H   + F C  C  +  ++ +L +H+
Sbjct: 103 SKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 97  EPRCMYAYVKEEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKS 154
           + + M+ Y  +E K   +V+  Y+C VC K   R + L  H   HTN R + C W  C  
Sbjct: 441 DQKNMFQYPNKEKK---QVS--YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNK 495

Query: 155 KHKRRDNLFKHIKL 168
               + NL +H KL
Sbjct: 496 TFNVKSNLNRHTKL 509

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKLKHMEL 173
           Y CNVC K F+R + L  H   HT  + F CP   C      R N+ +H K  H +L
Sbjct: 233 YCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYK-AHFKL 288

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           ++ C  C++ F+R+  L+RH  S H  ++ F C  C+ K  R DNL +HIK
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKH 165
           ++C  C+  F     L RH+  HT ++N++CP   C  +  R DN  +H
Sbjct: 212 FQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQH 260

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           C  C++ F R   L+RH  +HT ++ F+C +C     RRD + +H    H ++L
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLHFDIL 96

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           +VY C++C+K F R   L+ H  SHT++R ++C  C     R      H K +H +L
Sbjct: 467 AVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARM-----HDKNRHEDL 518

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 33/81 (40%), Gaps = 12/81 (14%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLK 169
           Y C+VC K F R     RH   HT  R ++C         W C  K  R D L +H K  
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFK-- 554

Query: 170 HMELLMKAIREYYPLTDFEDK 190
             EL  K I   Y   + E K
Sbjct: 555 -TELGKKCILPLYEEAELEKK 574

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + T  + C+ C + F+R+  L+RH  S H  ++ + C  C     R DNL +HIK
Sbjct: 490 DATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 6/63 (9%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           + C  C K F +   LR H   HT +R F C  C     RR NL  H      E   ++I
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAH------EFTHESI 561

Query: 179 REY 181
           + Y
Sbjct: 562 KPY 564

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           Y+C  C+K+F +   L  H  +H   + F C +C  +  +  NL  H +L   E   K
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEFCGKRFTQAGNLRTHRRLHTGERPFK 537

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           ++C+ C+K F R   L  H  +H + + ++C        R DN FK  +   +  +    
Sbjct: 536 FKCDKCDKTFARRGNLTAHEFTHESIKPYIC--------RLDNCFK--RFSQLGNMKSHQ 585

Query: 179 REYYPLT 185
            +Y+P T
Sbjct: 586 NKYHPQT 592

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMEL 173
           Y+C  C K F +   LR H   HT ++ + C  C  K  R+ NL  H+ L H ++
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL-LTHQKV 596

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKH---IKLKHMEL 173
           Y C +C+K F R+  L  H L+H   + F+C    C     +  N+  H     L  +++
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHLDTLKM 630

Query: 174 LMKAIREYYPLTDFEDKD 191
           L   + E  P  +   KD
Sbjct: 631 LTTKLAEMNPNDNIPQKD 648

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 31/66 (46%)

Query: 107 EEGKNEDEVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHI 166
           E+ K   E +  ++C  C+++F +   L  H  SH   + + C +C  +  +  NL  H 
Sbjct: 503 EKPKTLHEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQ 562

Query: 167 KLKHME 172
           +L   E
Sbjct: 563 RLHTGE 568

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIK 167
           Y C  C K F     L RH+  HT ++N +C  P C  +  R DN  +H K
Sbjct: 202 YVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYK 252

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 42/103 (40%), Gaps = 10/103 (9%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178
           Y+C  C K F +   LR H   HT ++ + C  C  +  R+ NL  H+      L  K I
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHV------LTHKKI 574

Query: 179 REYYPLTDFEDKDLNELMR----SGYLHREDIKRVFLHLIGLE 217
           + +    D  +K   +L          H E + R+   L  L+
Sbjct: 575 KPFICKLDNCNKSFTQLGNMKGHQNKFHLETLTRLTARLAQLD 617

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           + C  C++ F +   L  H  SH   + + C +C  K  +  NL  H +L
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 102 YAYVKEEGKNE---DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHK 157
           +A+  + G+NE    +   +Y C  CN+ F     L RH  S H+ ++   CP C  + K
Sbjct: 808 HAHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFK 867

Query: 158 RRDNLFKHIKLK 169
           RRD++ +H+  K
Sbjct: 868 RRDHVLQHLNKK 879

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           + C  C + F     L RH+  HT ++N +CP+  C  +  R DN  +H K
Sbjct: 161 FECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYK 211

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKH 165
           Y C VC+K       L RH+  HT ++N  CP+  C  +  R DN  +H
Sbjct: 301 YICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQH 349

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 9/58 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIK 167
           + CN+C K F R+   +RH   HT  + ++C        PW C  K  R D L +H K
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFK 537

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 116 TSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           +  Y C +C+K F R   L+ H  +HTN++ F+C  C     R+ +  +H  L
Sbjct: 449 SGAYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDL 501

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           E   VY C  C + F     L RH  S H+ ++   CP C  K KRRD++ +H+  K
Sbjct: 713 EKGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 115 VTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKL 168
             S YRC  C K F R + L  H   HT D+ + C  P C  +   + N+ +H KL
Sbjct: 300 ANSKYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKL 355

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 120 RCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           +C +C K   R + L  H   HT DR +LC W  C      + N+ +H KL
Sbjct: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKL 386

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           Y C +C + F     L RH+  HT ++N  CP+  C  +  R DN  +H +
Sbjct: 175 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 225

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKLKHMELLMK 176
           Y C +C++ F R     RH  +HT ++   C  P C  K  R D L +H ++ H     K
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRI-HTNPHPK 84

Query: 177 AIREYYPLTDFEDKDLNELMRSGYLHREDIKR 208
             R     T+ +    +  ++ G L RE   R
Sbjct: 85  GKRGRKKKTETQSSGADTAVQQGNLPRERATR 116

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIKLKHME 172
           ++C++C K F R    RRH  +HT ++   C  P C  +  R D L +H++  HM 
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR-THMS 68

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           + T  + C  C++ F+R+  L+RH  S H  ++ F C  C     R DNL +H+K
Sbjct: 390 DATKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {ON}
           Anc_6.256 YPL230W
          Length = 361

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 3/69 (4%)

Query: 105 VKEEGKNEDEVTSVYRCNV---CNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDN 161
           V  +  N+      Y C     CN +F R   L RH   HT ++ F C  C     R DN
Sbjct: 20  VTSKPTNQKRAKKKYVCTGFEGCNMVFTRSENLTRHRRKHTGEKPFKCHVCLKFFSRIDN 79

Query: 162 LFKHIKLKH 170
           L +HI+  H
Sbjct: 80  LKQHIESVH 88

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIK 167
           + CNVC K F R+   +RH   HT  + ++C         W C  K  R D L +H K
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFK 509

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           ++Y C +C+K F R   L+ H  +HT++R F C  C     R+ +  +H  L
Sbjct: 422 AIYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 103 AYVKEEGKNE---DEVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKR 158
           A+  + G+NE    +   +Y C  CN+ F     L RH  S H+ ++   CP C  + KR
Sbjct: 809 AHSSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKR 868

Query: 159 RDNLFKHIKLK 169
           RD++ +H+  K
Sbjct: 869 RDHVLQHLNKK 879

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           +Y C VC+K F R   L+ H  +HTN+R F C  C     R+ +  +H  L
Sbjct: 396 LYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 9/58 (15%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIK 167
           + C +C K F R+   +RH   H+  + + C        PW C  K  R D L +H K
Sbjct: 425 FACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRHFK 482

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 117 SVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKL 168
           +++ C +C+K F R   L+ H  +HTN+R F+C  C     R+ +  +H  L
Sbjct: 390 AMFACELCDKRFTRPYNLKSHLRTHTNERPFICSSCGKAFARQHDRKRHEDL 441

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 17/88 (19%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLC--------PW-CKSKHKRRDNLFKHIKLKH- 170
           C+ C K F R+   +RH   HT  + ++C         W C  K  R D L +H K +  
Sbjct: 422 CSSCGKAFARQHDRKRHEDLHTGKKRYVCGGHLKDGTAWGCGKKFARSDALGRHFKTESG 481

Query: 171 ----MELLMKAIREYYPLTDFEDKDLNE 194
               + L  +A RE  PL   + KDL E
Sbjct: 482 RKCILPLYEEASREKRPL---DLKDLTE 506

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           Y C +C + F     L RH+  HT ++N  CP+  C  +  R DN  +H +
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168
           Y C  C K F R + L  H   HT D+ F+CP+  C      + N+ +H KL
Sbjct: 235 YECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKL 286

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 40.8 bits (94), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 26/56 (46%)

Query: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMK 176
           C  C + F R    +RH  SH   + F C  C     RRD L +HIK  H   L++
Sbjct: 7   CAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLE 62

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKHIKLKHMEL 173
           Y CN+C K F+R + L  H   HT  + + CP   C      + N+ +H KL H +L
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL-HFKL 325

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174
           + C  C + F R   L+RH  SHT ++ +LC +C     RRD + +H    H  +L
Sbjct: 45  FLCPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSIL 100

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIKLK 169
           VY C  C + F     L RH  S H+ ++   CP C  K KRRD++ +H+  K
Sbjct: 738 VYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIK 167
           +RC +CN+ F R    +RH  +HT ++   C  P C     R D L +H++
Sbjct: 14  FRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLR 64

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           E+   Y C +C + F     L RH+  HT ++N  CP+  C  +  R DN  +H +
Sbjct: 169 ELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLC--PWCKSKHKRRDNLFKHIK 167
           Y C  C K+F R + LR H + H     ++C  P C  +   + NL +H+K
Sbjct: 199 YSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVK 249

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIK 167
           Y C +C + F     L RH+  HT ++N  CP+  C  +  R DN  +H +
Sbjct: 174 YICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 114 EVTSVYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKHIK 167
           +++  + C  C++ F+R+  L+RH  S H  ++ + C  C  K  R DNL +HIK
Sbjct: 259 DLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 106 KEEGKNED--EVTSVYRC---NVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRD 160
           K+  +N+D   V   YRC     CN  F R   L RH   HT ++ F C  C     R D
Sbjct: 4   KQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRID 63

Query: 161 NLFKHIKLKHMELLMKAIR 179
           NL +H    H ++ + ++R
Sbjct: 64  NLRQHQSSVHSDVDLMSLR 82

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 118 VYRCNVCNKIFQREAWLRRHHLS-HTNDRNFLCPWCKSKHKRRDNLFKH 165
           +++C++C + F+R+  L+RH  S H  +R + C  C     R DNL +H
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,349,764
Number of extensions: 1233810
Number of successful extensions: 4634
Number of sequences better than 10.0: 637
Number of HSP's gapped: 4487
Number of HSP's successfully gapped: 781
Length of query: 218
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 113
Effective length of database: 41,441,469
Effective search space: 4682885997
Effective search space used: 4682885997
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)