Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H033402.283ON36736718760.0
ZYRO0A01804g2.283ON37634412721e-175
Suva_14.3112.283ON38934212501e-172
KLTH0G10296g2.283ON42634212511e-171
Smik_14.2962.283ON38934112381e-170
YNL035C2.283ON38934112371e-170
TDEL0G021402.283ON39234312151e-167
Skud_14.2982.283ON38934312111e-166
SAKL0E07766g2.283ON39834512001e-164
Kpol_1003.342.283ON38834411981e-164
TBLA0B059202.283ON40334811941e-163
NDAI0G006302.283ON39733811921e-163
Kwal_27.115502.283ON40735011841e-162
TPHA0C033702.283ON41334911781e-161
KLLA0E08449g2.283ON42234511761e-160
NCAS0G038702.283ON38934611591e-158
KNAG0H020402.283ON39933611531e-157
Ecym_33212.283ON40934211101e-150
ADL218C2.283ON40334310721e-145
CAGL0G01628g2.283ON37634010491e-142
KAFR0L003206.9ON3912071504e-10
KLLA0D00814g6.9ON4082101372e-08
SAKL0E00814g6.9ON3982071344e-08
Skud_5.336.9ON4012021301e-07
ACR017W6.9ON4231331273e-07
KNAG0E009806.9ON4141751273e-07
Suva_5.126.9ON4011971257e-07
TBLA0A071206.9ON4071731249e-07
Smik_5.316.9ON4272041193e-06
KLLA0E23541g8.548ON4171691169e-06
CAGL0B03575g6.9ON4192031141e-05
KLTH0C11550g6.9ON398931141e-05
ZYRO0F00462g6.9ON3931891132e-05
Suva_10.645.201ON4901591142e-05
Kpol_1041.202.401ON5151881123e-05
KLTH0E12694g8.548ON4181781114e-05
YEL056W (HAT2)6.9ON4012051104e-05
Kpol_2002.995.201ON4871601105e-05
Kpol_1045.786.9ON3921211096e-05
NDAI0K029006.9ON4382021071e-04
Smik_12.525.201ON4891581061e-04
YLL011W (SOF1)5.201ON4891581052e-04
Ecym_30126.9ON3971971033e-04
Skud_11.2711.247ON6461621034e-04
Skud_12.565.201ON4891581024e-04
Suva_11.2681.247ON6451721025e-04
KLLA0F15598g5.201ON4781601016e-04
YKR036C (CAF4)1.247ON6431571017e-04
TPHA0G026502.401ON5162061007e-04
Kwal_26.77362.469ON5071261008e-04
TDEL0E042805.201ON481158990.001
AEL250C8.548ON417175990.001
TBLA0B092502.401ON526183980.001
KLTH0B03410g5.201ON477146980.001
Smik_11.2981.247ON662154980.002
KLTH0D05346g2.469ON507126980.002
Ecym_70428.548ON414171970.002
NDAI0I021805.201ON479174970.002
NCAS0B078401.247ON589177970.002
TPHA0E030805.201ON488145960.002
Kwal_33.151365.201ON473144950.003
Suva_13.3112.401ON510189950.003
Kwal_27.120708.548ON41869940.003
KLLA0E04819g7.534ON459144940.004
KAFR0J009805.201ON480158940.005
TDEL0G033402.401ON514189930.005
ADR242C2.401ON521209930.006
SAKL0C13266g3.25ON459118920.007
Ecym_28087.534ON465108920.007
NDAI0E015008.631ON42856920.008
Smik_13.3292.401ON509189920.009
TBLA0H020005.201ON473141910.010
Ecym_41348.435ON810170910.011
TDEL0H003707.534ON465108910.011
Skud_13.2912.401ON509189900.012
ZYRO0A09636g8.435ON808103910.012
YMR131C (RRB1)2.401ON511189900.013
KLTH0G12276g8.324ON93732900.016
Kpol_1013.377.534ON468151890.018
KLTH0F16192g5.429ON462165890.018
TBLA0H030601.247ON73068890.019
NCAS0F019702.401ON511189880.021
KNAG0F038707.534ON465109880.024
ZYRO0A08690g2.401ON516189880.025
Smik_12.2798.435ON817103880.026
NDAI0J003307.534ON472143870.028
NCAS0D027305.201ON475162870.028
KNAG0H016901.399ON303165860.029
Kwal_55.220673.25ON451118870.029
ACR097W8.631ON46794870.032
KLTH0F19294g3.25ON451118870.033
AAL157C5.201ON479163870.034
Ecym_20243.22ON131759870.035
NDAI0E034408.435ON857166870.037
SAKL0G12892g5.201ON476210860.037
Suva_16.606.276ON52674860.038
TPHA0G018408.631ON43168860.043
Suva_7.519na 1ON20562840.043
NDAI0H027502.401ON512185860.046
KNAG0A036708.548ON426174850.047
Kwal_47.178272.401ON523189850.048
TDEL0F022304.122ON556153850.048
ZYRO0B10450g5.201ON482159850.049
KAFR0H022608.324ON938101860.050
KAFR0B003707.534ON461107850.052
NCAS0G036001.399ON327145840.054
Suva_14.3421.399ON303165840.056
Kwal_27.115858.435ON823131850.057
Skud_14.3211.399ON303165840.058
TBLA0D055601.247ON589142850.060
Smik_14.3221.399ON303165840.061
YNL006W (LST8)1.399ON303165840.061
Suva_1.744.123ON428180840.061
AEL269C7.534ON455111840.064
NCAS0F001906.9ON411136840.068
ACR137W8.672ON425138840.073
Sklu_YGOB_Anc_2.4012.401ON520189840.073
TPHA0L016908.544ON832165840.079
SAKL0H22396g4.122ON555124840.080
ZYRO0E04620g1.399ON303165830.083
SAKL0H07656g8.631ON42675830.088
CAGL0K03861g2.401ON513189830.091
Suva_7.5185.104ON59362830.091
KLTH0D15840g4.309ON69782830.095
KLLA0F09427gna 2ON54792830.095
Kpol_1060.246.276ON486123830.11
CAGL0H03729g1.399ON303165820.11
Kwal_0.2121.399ON303160810.12
Ecym_24018.672ON42692820.12
Ecym_42558.324ON93732830.12
TPHA0M001906.9ON39176820.12
NDAI0C026001.399ON303164810.13
Kwal_56.236858.288ON110245820.13
Ecym_55285.429ON471166820.13
Kpol_487.71.399ON303165810.15
Skud_7.5615.104ON59362810.15
TBLA0G014904.122ON73296820.16
KLTH0G13068g8.288ON110167820.16
KLTH0E09394g2.401ON522189810.16
KAFR0A064804.122ON568125810.16
KAFR0H031401.399ON303164800.17
Kwal_23.53517.534ON474118810.17
Kwal_55.220763.22ON128659810.17
KNAG0I010508.288ON115957810.18
Kpol_1072.418.631ON42056800.18
SAKL0F15972g7.534ON470111800.19
TDEL0B05810na 3ON1222117810.21
CAGL0A00561g4.119ON41274800.21
SAKL0C13332g3.22ON135359810.22
ZYRO0D07744g5.49ON1525171810.22
NCAS0G011206.276ON49454800.22
KNAG0M017505.201ON485159800.23
KLLA0F19734g8.288ON113357800.24
KLTH0E08162g4.122ON556131800.25
KAFR0G019708.631ON42556790.27
TBLA0I025708.435ON848106800.27
KLLA0E07085g3.25ON452122790.28
ABL024W2.450ON73453790.29
KAFR0A006902.469ON508122790.32
TDEL0B020108.435ON805103790.33
KNAG0H001802.663ON389317780.34
KLLA0F13244g8.435ON814102790.34
Kwal_56.239208.324ON93732790.34
KNAG0C062405.631ON355370780.35
AGL196C8.324ON93532790.35
TBLA0A023106.276ON53149780.36
KAFR0A003802.401ON516189780.36
TDEL0A057708.631ON43376780.36
Skud_16.326.276ON522128780.37
SAKL0D08756g1.399ON303164770.37
TDEL0A068906.276ON44753780.38
Smik_6.4516.276ON52352780.39
ZYRO0A12980g8.544ON824179780.39
KAFR0B055808.288ON1120121780.42
CAGL0G04345g1.247ON71172780.42
ZYRO0G03146g2.469ON510110780.42
CAGL0M04279g8.324ON940101780.43
KLTH0H12122g1.399ON303160770.45
KLLA0D04840g1.399ON303164770.45
TPHA0P014903.25ON459116770.46
TDEL0B059701.399ON303164770.47
NCAS0C044503.25ON461116770.47
CAGL0J01265g2.469ON517109770.49
Skud_12.1988.324ON943118770.52
NCAS0J011004.123ON437220770.53
Smik_16.795.104ON59362770.53
NDAI0F012406.276ON52452770.55
Kpol_1016.111.247ON669184770.55
ZYRO0F10406g8.324ON938116770.56
SAKL0A02970g6.276ON415198760.57
Ecym_60672.401ON522128770.58
YGR225W (AMA1)5.104ON59362770.59
KNAG0E021802.401ON517196760.63
KLLA0A08822g4.122ON582119760.65
SAKL0E05368g2.380ON349145760.66
KLLA0E21187g5.429ON429168760.69
NCAS0A151707.534ON474161760.71
NCAS0D046106.340ON515161760.71
CAGL0M02563g8.651ON45755750.74
NDAI0J018504.122ON575132760.75
KNAG0G024508.324ON94297760.76
TPHA0D044807.310ON134092760.77
Ecym_21396.276ON435145750.80
ADL186C3.22ON136159760.83
AGL301C7.405ON361157750.89
NCAS0B016608.631ON42456750.92
Skud_14.851.107ON42284750.93
Ecym_12931.399ON303164740.93
ZYRO0F09372g8.721ON44899750.93
NDAI0J011808.288ON113458750.94
Kwal_56.245267.322ON121065750.98
Suva_7.2794.122ON56699750.99
KLLA0D12760g6.276ON49375751.00
NCAS0E037507.310ON1276182751.0
KLLA0D06787g8.631ON43672741.1
NCAS0C032608.324ON983121751.1
ZYRO0E08184g6.276ON50669741.1
ZYRO0D01122g7.534ON46671741.1
KNAG0E024702.469ON509139741.1
CAGL0H08932g6.239ON902161741.1
Smik_12.1928.324ON943267741.2
SAKL0F10648g7.322ON120365741.2
Ecym_42808.288ON113245741.2
KLTH0F19338g3.22ON129059741.2
KLLA0F17237g2.401ON523130741.2
NDAI0B051901.247ON668161741.3
SAKL0H15532g8.324ON94132741.3
TDEL0D013101.247ON709114741.3
AGL190W8.316ON370107731.3
ZYRO0D03828g1.247ON726114741.3
YOR272W (YTM1)8.721ON460139731.3
KAFR0F010606.276ON553118741.4
KNAG0D007406.276ON50452731.4
YPL247C6.276ON52352731.4
Kpol_2001.687.338ON295101731.4
KLLA0E20967g3.22ON132159741.5
KLTH0H01892g7.322ON120965741.5
TDEL0A052908.585ON31954721.5
KLTH0D10186g8.631ON42156731.5
SAKL0H16390g8.288ON114045731.6
NDAI0K014102.450ON97791731.6
Suva_14.891.107ON42292731.6
NDAI0G025808.324ON95832731.6
SAKL0G01628gna 4ON959113731.6
NCAS0F014502.450ON90836731.6
Suva_10.3168.435ON818209731.6
KAFR0A006002.450ON89436731.8
TDEL0F045008.324ON93832731.8
TDEL0A024502.469ON510110721.8
NCAS0I024903.95ON62634731.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03340
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   727   0.0  
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   494   e-175
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   486   e-172
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   486   e-171
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   481   e-170
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   481   e-170
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   472   e-167
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   471   e-166
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   466   e-164
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   466   e-164
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   464   e-163
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   463   e-163
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   460   e-162
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   458   e-161
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   457   e-160
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    451   e-158
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   448   e-157
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   432   e-150
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   417   e-145
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   408   e-142
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    62   4e-10
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    57   2e-08
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    56   4e-08
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    55   1e-07
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    54   3e-07
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    54   3e-07
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    53   7e-07
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    52   9e-07
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    50   3e-06
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    49   9e-06
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    49   1e-05
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    49   1e-05
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    48   2e-05
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    49   2e-05
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    48   3e-05
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    47   4e-05
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    47   4e-05
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    47   5e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    47   6e-05
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      46   1e-04
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    45   1e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   2e-04
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    44   3e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    44   4e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    44   4e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   5e-04
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    44   6e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    44   7e-04
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    43   7e-04
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    43   8e-04
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    43   0.001
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    43   0.001
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    42   0.001
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    42   0.001
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    42   0.002
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    42   0.002
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    42   0.002
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    42   0.002
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    42   0.002
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    42   0.002
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    41   0.003
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    41   0.003
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    41   0.003
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    41   0.004
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    41   0.005
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    40   0.005
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    40   0.006
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    40   0.007
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    40   0.007
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    40   0.008
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    40   0.009
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    40   0.010
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    40   0.011
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    40   0.011
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    39   0.012
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    40   0.012
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    39   0.013
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    39   0.016
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    39   0.018
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    39   0.018
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    39   0.019
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    39   0.021
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    39   0.024
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    39   0.025
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    39   0.026
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      38   0.028
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     38   0.028
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    38   0.029
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    38   0.029
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    38   0.032
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    38   0.033
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    38   0.034
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    38   0.035
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    38   0.037
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    38   0.037
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    38   0.038
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    38   0.043
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    37   0.043
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    38   0.046
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.047
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    37   0.048
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    37   0.048
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.049
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    38   0.050
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    37   0.052
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    37   0.054
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    37   0.056
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    37   0.057
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    37   0.058
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    37   0.060
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    37   0.061
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    37   0.061
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.061
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    37   0.064
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    37   0.068
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    37   0.073
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    37   0.073
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    37   0.079
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    37   0.080
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    37   0.083
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    37   0.088
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    37   0.091
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    37   0.091
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    37   0.095
KLLA0F09427g Chr6 complement(869664..871307) [1644 bp, 547 aa] {...    37   0.095
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.11 
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    36   0.11 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    36   0.12 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    36   0.12 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    37   0.12 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    36   0.12 
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      36   0.13 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    36   0.13 
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    36   0.13 
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    36   0.15 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    36   0.15 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    36   0.16 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    36   0.16 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    36   0.16 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    36   0.16 
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    35   0.17 
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    36   0.17 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.17 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    36   0.18 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.18 
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    35   0.19 
TDEL0B05810 Chr2 complement(1025990..1029658) [3669 bp, 1222 aa]...    36   0.21 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    35   0.21 
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    36   0.22 
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    36   0.22 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    35   0.22 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    35   0.23 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    35   0.24 
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    35   0.25 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    35   0.27 
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    35   0.27 
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    35   0.28 
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    35   0.29 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    35   0.32 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    35   0.33 
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    35   0.34 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    35   0.34 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    35   0.34 
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    35   0.35 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    35   0.35 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    35   0.36 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    35   0.36 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   0.36 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    35   0.37 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    34   0.37 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    35   0.38 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    35   0.39 
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    35   0.39 
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    35   0.42 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    35   0.42 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    35   0.42 
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    35   0.43 
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    34   0.45 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    34   0.45 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    34   0.46 
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    34   0.47 
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      34   0.47 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    34   0.49 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    34   0.52 
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    34   0.53 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    34   0.53 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    34   0.55 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    34   0.55 
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    34   0.56 
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    34   0.57 
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    34   0.58 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    34   0.59 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    34   0.63 
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    34   0.65 
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    34   0.66 
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    34   0.69 
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    34   0.71 
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     34   0.71 
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    33   0.74 
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    34   0.75 
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    34   0.76 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    34   0.77 
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    33   0.80 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    34   0.83 
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    33   0.89 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    33   0.92 
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    33   0.93 
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    33   0.93 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    33   0.93 
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    33   0.94 
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    33   0.98 
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    33   0.99 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    33   1.00 
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    33   1.0  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    33   1.1  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    33   1.1  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    33   1.1  
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    33   1.1  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    33   1.1  
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    33   1.1  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    33   1.2  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    33   1.2  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    33   1.2  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    33   1.2  
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    33   1.2  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   1.3  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    33   1.3  
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    33   1.3  
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    33   1.3  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    33   1.3  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    33   1.3  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    33   1.4  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    33   1.4  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    33   1.4  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    33   1.4  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   1.5  
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    33   1.5  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    32   1.5  
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    33   1.5  
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    33   1.6  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    33   1.6  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    33   1.6  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    33   1.6  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    33   1.6  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    33   1.6  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    33   1.6  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    33   1.8  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    33   1.8  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    32   1.8  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   1.8  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    32   1.8  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    33   1.9  
ZYRO0G21802g Chr7 (1794478..1795557) [1080 bp, 359 aa] {ON} simi...    32   1.9  
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    32   1.9  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    32   2.0  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    32   2.0  
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    32   2.1  
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    32   2.2  
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    32   2.2  
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    32   2.2  
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    32   2.2  
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    32   2.3  
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    32   2.3  
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    32   2.3  
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    32   2.4  
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    32   2.5  
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    32   2.5  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    32   2.6  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    32   2.6  
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    32   2.7  
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    32   2.7  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   2.8  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    32   2.8  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    32   2.9  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    32   2.9  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    32   2.9  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    32   3.3  
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    32   3.3  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    32   3.4  
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    32   3.4  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    32   3.5  
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    32   3.5  
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    32   3.6  
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    32   3.6  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    31   3.7  
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    32   3.7  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   3.7  
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    32   3.7  
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    32   3.8  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    32   4.0  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    31   4.0  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    32   4.0  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    31   4.0  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    32   4.0  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    31   4.1  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    32   4.1  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    32   4.1  
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    31   4.2  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    31   4.3  
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    31   4.5  
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    31   4.5  
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    31   4.7  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    31   4.9  
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    31   4.9  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    31   4.9  
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    31   5.0  
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    31   5.0  
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    31   5.2  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    31   5.2  
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    31   5.2  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    31   5.2  
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    31   5.3  
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    31   5.3  
Smik_9.159 Chr9 (266861..270004) [3144 bp, 1047 aa] {ON} YIL031W...    31   5.3  
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    31   5.4  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   5.4  
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    31   5.4  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    31   5.6  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    31   5.6  
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    31   5.6  
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    31   5.7  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    31   5.8  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    31   5.9  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    31   5.9  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    31   6.0  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    31   6.0  
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    31   6.4  
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    31   6.4  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    31   6.4  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    31   6.5  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    31   6.6  
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    31   6.6  
Ecym_7423 Chr7 (866887..866947,867633..868798) [1227 bp, 408 aa]...    31   6.6  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    31   6.6  
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    30   7.0  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    31   7.0  
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    30   7.0  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    30   7.0  
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    31   7.1  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    31   7.1  
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    30   7.3  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    31   7.3  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    30   7.4  
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    30   7.7  
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    30   7.9  
TBLA0B02980 Chr2 complement(688324..690663) [2340 bp, 779 aa] {O...    30   7.9  
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    31   7.9  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    30   8.1  
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       30   8.1  
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    30   8.1  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    30   8.4  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    30   8.4  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    30   8.5  
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    30   8.5  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    30   8.7  
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    30   8.7  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    30   8.9  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    30   9.0  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    30   9.0  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    30   9.1  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    30   9.2  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    30   9.4  

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/367 (95%), Positives = 352/367 (95%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
           QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
           QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQSQXXXXXXXXXXXXXX 360
           RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQSQ              
Sbjct: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQSQSPAPKKKHSKKKKH 360

Query: 361 XIRYKPY 367
            IRYKPY
Sbjct: 361 AIRYKPY 367

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  494 bits (1272), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 220/344 (63%), Positives = 280/344 (81%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSYSLV  +SFG++NWCL  QP Y H LL SLSNG+V  LDW+T   + + K  +V++N 
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           +KLINND+ N S +ATAT+ +VKI+DI+SN+C+ATI+NDK +PFLSLDSRH+MLACGTEL
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            G DAEL+IYDVR W SP++S VDSHHDDITDI FHPSD N L+SGSTDGYTN+YDL Q 
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EE+DAL+QVIN+ASIHSCGWL+PRRI+TLSHMETFSI ELND++DE +EP+P++F D+R+
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
            W CDYV+DI+PGY+A G SQEG G L+I+P  GE V+++ AI I+ AH DEV+RDVF+P
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQ 344
             +  +LYSCGEDG+VK+W++        +EFWDYSQ  NV ++
Sbjct: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  486 bits (1250), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 273/342 (79%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYSLV   SFGS+NWCLK QP Y HGLLT LSNGE+ LLDW T  P++  +  + +IN M
Sbjct: 3   SYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDM 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           K+I++D+   +L ++A+++SVK++DI+SNDC+A I N+  SPFLSLDSRH +LACGTELQ
Sbjct: 63  KIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           G+DA ++IYDVR W +P++S VDSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q +
Sbjct: 123 GIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDD 182

Query: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241
           E+DAL+QVINYASIHSCGWLSP+RIYTLSHMETFSI ELND++DEL+EPQPLDFGDIR  
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKA 242

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           WNCDYV+D+YPG+IATG++QEG G L+++P   E +++   I I  AH DEV+RDVF+  
Sbjct: 243 WNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVSE 302

Query: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFE 343
            + +VLYSCGEDG VK WK+          FWDYS+R +V E
Sbjct: 303 QNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLE 344

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  486 bits (1251), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 218/342 (63%), Positives = 269/342 (78%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSYS ++   FG +NWCLK QP+YN GLLTSLSNG V+L+DW T   +   +    S+N 
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           M +INND  N SL ATA  ++VKIYD+KSNDC+AT+ N K +PFLSLDSRH +L CGTEL
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            GVDAEL++YD+R+W  P++S VDSHHDDIT IKFHPSD N LLSGSTDGY N+YDLTQQ
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EEDDAL+QVIN+ASIHSCGWLSP+RIYTLSHMET+ I ELND+ DE  EP+P+DFGD+R 
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
            W+C+YVID+YPG+IATG+S+EG G L++IP+D E  E   AITI  AH DEV+RDV +P
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVP 319

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342
             H ++LYSCGEDG++K WKS        +EFW YS++ +VF
Sbjct: 320 FQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVF 361

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  481 bits (1238), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 271/341 (79%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYSLV+   FGS+NWCLK QP Y HGLLT LSNGE++LLDW T   ++N K  + +IN +
Sbjct: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           K+I++D++   L ++A++++VK++DI++N CIATI N+  SPFLSLDSRH +LACGTELQ
Sbjct: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           G+DA ++IYD+R W +P++S +DSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q E
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241
           E+DAL+QVINYASIHSCGWLSP+RIYTLSHMETF+I ELND++DELREPQPLDFGD+R  
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           W+CDYV+DIYPG IATG++QE  G L++IP   E + + K   I  AH DEV+RD+FI  
Sbjct: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302

Query: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342
           +  ++LYSCGEDG VK WKS        E FWDYS++ NV 
Sbjct: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVL 343

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  481 bits (1237), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 214/341 (62%), Positives = 271/341 (79%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYSLV+  SFGS+NWCLK QP Y HGLLT LSNGE++LLDW T   V+  K  + +IN M
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDM 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           K+I +D++   L ++A++++VK++DI++ND IA I N+  SPF+SLDSRH +LACGTELQ
Sbjct: 63  KVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           G+DA +YIYD+R W +P++S +DSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q E
Sbjct: 123 GIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241
           E+DAL+QVINYASIHSCGWLSP+RI+TLSHMETF+I ELND++DEL+EPQPLDFGD+R+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVREI 242

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           WNCDYV+DIYPG IATG++QE  G L ++P   E V++   I I  AH DEV+RD+FIP 
Sbjct: 243 WNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFIPA 302

Query: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342
            H N+LYSCGEDG VK W++        E FWDYS++ NV 
Sbjct: 303 QHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVL 343

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  472 bits (1215), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 217/343 (63%), Positives = 273/343 (79%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYS +  Q FGSDNWCL  QP YNH LLTSLSNGEV  +DW T   VR  +    SIN +
Sbjct: 3   SYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKL 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           K+I++++N  S +A A+ +SV I D++S D +A++ NDK +PFLSLDSRH MLACGTEL 
Sbjct: 63  KIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTELS 122

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           GVDAEL+IYDVRNWS+P++SFVDSHHDD+TDI+FHPSD N LLSGSTDGYTNVYDL QQE
Sbjct: 123 GVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQE 182

Query: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241
           EDDAL+QVINYASIHSCGWLSP+RI+TLSHMET ++ ELND++DELREPQPLDFGDIR++
Sbjct: 183 EDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREK 242

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           W C YV+D+YPGY+A G SQE +  L+++ ++ E +E+ K++ I  AH +EV+RDV IP 
Sbjct: 243 WGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLIPP 302

Query: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQ 344
            + N+LYSCGEDGTVK WK+  +       FWDYS++ +VF +
Sbjct: 303 QNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSE 345

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  471 bits (1211), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 271/343 (79%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYSLV+  SFGS+NWCLK QP Y +GLLT LSNGE++LLDW +   ++  K  + SIN +
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           K+I++D+    L ++A++++VK++DI++N C+A I N+  SPF+SLDSRH +LACGTELQ
Sbjct: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           G+DA +YIYD+R W +P++S +DSHHDD+T IKFHPSD N LLSGSTDGYTN+YDL Q E
Sbjct: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182

Query: 182 EDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQ 241
           E+DAL+QVINYASIHSCGWLS +RIYTLSHMETF+I ELND++DE +EP+P DFGDIR+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           WNCDYV+D+YPG IATG++QEG G L+++P   E V++   I I RAH DEV+RDVFI  
Sbjct: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302

Query: 302 NHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQ 344
              ++LYSCGEDG VK WK+        E FWDYS++ NV ++
Sbjct: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  466 bits (1200), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 272/345 (78%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSYS +   SFG +NWCL+ QPLYN GLLTSLSNG + L+DW T   +  F     SI++
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           +K++NN++ N+ LFA+A+ +SVKI+D++++ C+AT+ NDK +PFLSLDSRHDMLACGTEL
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            GVDAEL+IYD++  S P++SFVDSHHDDITD KFHP D   L+SGSTDGY N+YDLT  
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           +E+DAL+QVIN+AS+HSCGWL+PRRIYTLSHMETF+I ELND++D+LREP+P++FGD+R 
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
            W CDY+I+I PG+IA GRSQE  G L++I  + E V+++  +TI +AH DE+IRDV IP
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIP 300

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
               ++LYSCGEDG +  WKS         +FWDYS+RFNVFE +
Sbjct: 301 DQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDT 345

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  466 bits (1198), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 213/344 (61%), Positives = 270/344 (78%), Gaps = 2/344 (0%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           SYSL+   S G  +WCL+ QPLY HGLL+SLSNG+V LLDW T N +R  K    SIN M
Sbjct: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62

Query: 62  KLINNDYNNASLFATATLNSVKIYDIK--SNDCIATITNDKKSPFLSLDSRHDMLACGTE 119
           +++++DY+N S+F+ A  ++VK+ D++   N  +A + N+KK+PFLSLDSRH MLACGTE
Sbjct: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           L GVDAE++IYD+RN+  PV+  VDSHHDD+TDIKFHPSD N LLSGSTDGYTNVYDLTQ
Sbjct: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182

Query: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239
            EE+DAL+QVINY S+HSCGWLSP+RIYTLSHMETF+I ELN+++DEL EP+PLDFGDIR
Sbjct: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242

Query: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299
             W+CDYV+D+YPGYIA G+S+E NGNL+IIP   E +  + +I+I  AH DEV+RDVFI
Sbjct: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302

Query: 300 PRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFE 343
                N++YSCGEDG+VK+WK  ++       FWDYS + NV +
Sbjct: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLD 346

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  464 bits (1194), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/348 (62%), Positives = 279/348 (80%), Gaps = 4/348 (1%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MS   +   SFGS+NWCLKF+PLYN+GLLTSLSNGE+ +LDW+T       KI + SIN 
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
            +++NN+YN  SL  TAT  SVKIYD+KSNDCI TITN+K SPFLSLDS H+M+ACGTEL
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            GVDAELYIYD+R+W +P++SFVDSHHDDITDIKFHP+DS  L+SGSTDGYTN+YDLT+ 
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EE+D+L+QVINY+SIHSCGWLS RRI+TLSHMETF+I +LND+++ L+EP+P++FGDIR+
Sbjct: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSK--AITIDRAHSDEVIRDVF 298
            W C+YVID+YPGYIATG+++E  G L+I P + E ++ ++   I I +AH DEVIRDVF
Sbjct: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300

Query: 299 IPRNHHNVLYSCGEDGTVKSWK-SPHSQSTAL-EEFWDYSQRFNVFEQ 344
           I  N  + +YSCGEDG VK WK    ++S  + E F+DYS R NV ++
Sbjct: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDE 348

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  463 bits (1192), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 271/338 (80%), Gaps = 2/338 (0%)

Query: 3   YSLVQEQSFGSDNWCLKFQPL-YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61
           YSL+   SFGS+NWC KFQPL   +GLL SLSNGE+  LD+ T    ++ ++  +SIN +
Sbjct: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDC-IATITNDKKSPFLSLDSRHDMLACGTEL 120
           K++N+D++  SLF+TAT  SVKI+DI SN+  IAT+ NDK  PFLSLDSRH +LA GTEL
Sbjct: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
           QGVDA++ IYD+R W +P++S +DSHHDD+T +KFHPSD   LLSGSTDGYTNVYDLTQQ
Sbjct: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           +EDDAL+QV+NYASIHSCGWLSP RI+TLSHMETF+I ELND+++EL+EPQPLDFGD+R+
Sbjct: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
           +W CDYVID+YPGYIA G+SQEGNG L++IP +GE +    ++ I  AH DEVIRDVFIP
Sbjct: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQR 338
            +H  ++YSCGEDG V  WK+ +      E+FWDYS+R
Sbjct: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  460 bits (1184), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 213/350 (60%), Positives = 267/350 (76%), Gaps = 10/350 (2%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQV---- 56
           MSYS V   +FG+DNWCLK QPLYN GLL SLSNG V+L+DW     V+N +I Q+    
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDW-----VKNKQISQIQAHG 55

Query: 57  -SINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLA 115
            +I+ M ++NND NN  L ATA  +SVKI+D++S+D +AT+ N+K +PFLSLDSRH MLA
Sbjct: 56  TTISDMVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLA 115

Query: 116 CGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
           CGTEL GVDAEL+IYD++ W  P++S VDSHHDDIT+IKFHP+D N LLSGSTDGY N+Y
Sbjct: 116 CGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIY 175

Query: 176 DLTQQEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDF 235
           DLTQ EEDDAL+QVIN+ASIHS GW +P+RIYTLSHMETF I ELND+ +E  EP P DF
Sbjct: 176 DLTQPEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDF 235

Query: 236 GDIRDQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIR 295
           GDIR  W CDYV+D+YPG+IATG+SQEG G +++IP  GE ++   A+TI  AH DEV+R
Sbjct: 236 GDIRQSWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVR 295

Query: 296 DVFIPRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
           DV +P  H ++LY+CGEDG V +WKS        +EFW Y+ + +VF  S
Sbjct: 296 DVLVPFQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGS 345

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  458 bits (1178), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 272/349 (77%), Gaps = 7/349 (2%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MS  LV + +FG+DNWCL+ +PLY+ GLL S SNG V L+DW + + ++ F++ + +INS
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDC-IATITNDKKSPFLSLDSRHDMLACGTE 119
           +++INND+ N  +FA  +L SVKIYD+++ D  +ATI NDK S FLSL+SRHDML CGTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           L GVDAE++IYDVR +S PV++FVDSHHDDITDIKFHPSD N LLSGSTDGYTN+YDL Q
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239
           ++ED+AL+QVINYASIHSCGWLSP+RIYTLSHMETF+I ELND++DEL EP+PLDFGDIR
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299
            QW+CDYV+D+YPGY+A G+S E  G L+I   + E + +   I I  AH DEVIRDVFI
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 300 P----RNHHNVLYSCGEDGTVKSWKSPHSQS--TALEEFWDYSQRFNVF 342
           P     NH +++YSCGEDG V  W +P   S     ++FW+ +++ +V 
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVL 349

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  457 bits (1176), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 206/345 (59%), Positives = 266/345 (77%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MS++  + + F  +NWCLK QPLY HGL+TS+S+G V LLDW  L  + + +    SIN 
Sbjct: 1   MSFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSIND 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           MK+IN+D++  ++FATA  + VK++DI++ + +A++ NDK SPF SLDSRH+MLACGTEL
Sbjct: 61  MKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
           +  DAEL+IYD+RNW+ PV+SFVDSHHDDITDIKFHP DSN L+SGSTDGY N+YDLTQ 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQD 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           +E+DAL+QVIN+ASIHSCGWL P+RI++LSHMETF I ELND++DE+ EP+PL+FGD+RD
Sbjct: 181 DEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRD 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
           +W CDYVIDIYP +IATG++ E  G L+IIP   E V+ S A+ I  AH +EVIRDV IP
Sbjct: 241 KWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIP 300

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
           +N  ++LYSCGEDG V  WK   +       FWDY+  F  FE S
Sbjct: 301 KNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENS 345

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  451 bits (1159), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 209/346 (60%), Positives = 271/346 (78%), Gaps = 2/346 (0%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLY--NHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN 59
           SYSLV  +SFGS+NW LK QPL   N+GLLTSLSNGEV  LD  TL  ++ + I + SIN
Sbjct: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63

Query: 60  SMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTE 119
            ++LIN++  ++ LF TAT NSVKI+DI S   +ATI +    PF SLDSRH +LACGTE
Sbjct: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           L+GVDA +YIYD+R W  PV+S VDSHHDD+T +K+HP+D N LLSGSTDGYTNVYDL++
Sbjct: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183

Query: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239
            EE+D+L+QVIN+ASIHSCGWLSPRRI+TLSHMETF+I ELND++D L+EPQP+D GD+R
Sbjct: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243

Query: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299
           ++W CDYV+D+YPG+IATG+SQE  G L++IP+  ET++ + +I I  AH DEVIRDV+I
Sbjct: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303

Query: 300 PRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
           P +   ++Y+CGEDG VK WK+ +      E+ WDYS+R N+ E +
Sbjct: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDT 349

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  448 bits (1153), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 267/336 (79%), Gaps = 1/336 (0%)

Query: 11  FGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNN 70
           FGS+NWC + QPLY  G+LTSLSNGEV L+DW++   +  FK D+ +IN+++++N D++N
Sbjct: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71

Query: 71  ASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIY 130
            + F TA++++VK++D++SN CI TI N+  +PFLSLDSR+D +ACGTEL+GVDA+L+I+
Sbjct: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131

Query: 131 DVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVI 190
           D+R   +P KS VDSHHDDIT IKFHPSD N LLSGSTDGYTN+YDL+Q+EEDD+L+QVI
Sbjct: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191

Query: 191 NYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQWNCDYVIDI 250
           N+ SIHSCGW++P+RIYTLSHMETF+I ELN+++DEL EPQPLDFGDIR  W CDYV+DI
Sbjct: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251

Query: 251 YPGYIATGRS-QEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRNHHNVLYS 309
           YPGY+ATG+S +EG G L++IP+ GE V     I+I  AH DEVIRDVFIP  +  V+YS
Sbjct: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVYS 311

Query: 310 CGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
           CGEDG +  W++        E+FW+Y    NV ++S
Sbjct: 312 CGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDES 347

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 197/342 (57%), Positives = 259/342 (75%), Gaps = 1/342 (0%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSY+     SFGSDNWCLK QPLY+ GLL++LSNG V L+DW +L  +++  +   SI++
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           +K+++ND ++ + F TA+ +SVKI+D++ N C+AT+ N K SPF+SLDSRH MLACGTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            G DAE+++YD++   +P++SF DSHHDDITDIKFH SD + LLSGSTDGY NVYDL QQ
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EE++AL+QVIN+ASIHSCGWLSP+RI+ LSHMETFSI ELND++DEL EP+PL+FGDIR 
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
            WNCDYV+DI+PG I TG +QE    LQ++P   E V+++ +I I RAH DEV+RD  I 
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342
           +    + YS GEDG +  WKS         EFW+Y ++ NV 
Sbjct: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  417 bits (1072), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 184/343 (53%), Positives = 256/343 (74%)

Query: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60
           MSY L Q+ SFG+DNWCL+ +PLY  G+L +LSNG V L+DW T   V +    + SIN 
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120
           ++++++ ++  ++FATA  + VK++DI++  C+AT+T+   +P LSLDSRH MLA GTEL
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            GVDA + ++ +  W  P+++FVDSHHDD+TD+KFHP+DSN LLSGSTDGY NVYDL Q 
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240
           EED+AL+QVIN+ASIHSCGWLSP+RI++LSHMETF+I ELND+++   EPQP  FGD+R+
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
            W CDYV+D+YPG+IA G ++E  G L+++P+  E V+++ AI + +AH DEV+RDV +P
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300

Query: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFE 343
            +   +LYS GEDG +  WKS         +FWDYS++  V E
Sbjct: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLE 343

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  408 bits (1049), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 257/340 (75%), Gaps = 6/340 (1%)

Query: 3   YSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMK 62
           YSL    +FGS+NWCLK QP++N G+LTS+S+GEV LL  + L+   +FK+ + SIN++ 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLD-LSKQDSFKVGETSINALS 59

Query: 63  LINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQG 122
            ++   N   LFA +  N VK++D++ N  +AT+  +  +  LSL S H MLA G+E QG
Sbjct: 60  RVDGQEN---LFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQG 116

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           VDA L+++D+RNWS PV+SFVDSH DDIT I FHP+D+N LLSGSTDGYTNVYDL + EE
Sbjct: 117 VDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEE 176

Query: 183 DDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQW 242
           +DAL+QVINYASIHSCGWL+PRRI+TLSHMETF+I ELND+++ELREPQPLDFGDIR  W
Sbjct: 177 EDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPW 236

Query: 243 NCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRN 302
           +C+YV+DIYPGYI+ G S+EG G L+IIP   E V++   ITI +AH DE++RD +I  +
Sbjct: 237 DCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 303 HHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342
             ++LYSCGEDG VK+W++        E FWDYS + ++ 
Sbjct: 297 QSDMLYSCGEDGQVKAWRNDIKLDIP-ETFWDYSTKMSLL 335

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 106/207 (51%), Gaps = 23/207 (11%)

Query: 4   SLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLD--WETLNPVRNFK-IDQVSIN 59
           S V+  S+  DN + L F P+    LL++  +G + + D   E+ +PV  ++  D   IN
Sbjct: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIIN 201

Query: 60  SMKLINNDYNNASLFATAT--LNSVKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DML 114
            +K  + D   A+LF T +   N++ IYD+++ D + +I  + + PF SL  S+H  ++ 
Sbjct: 202 DIKWHHFD---ATLFGTVSEEKNTLSIYDLRTKDKVTSI--EMEQPFNSLAFSKHSKNLF 256

Query: 115 ACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNV 174
           +      G D  +Y+YD+RN    + S +  H   +T+++FH S    L+S S D    +
Sbjct: 257 SAA----GTDQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311

Query: 175 YDL----TQQEEDDALYQVINYASIHS 197
           +DL    ++Q  +DA         IH+
Sbjct: 312 WDLMEIGSEQVNEDAQDATPELMMIHA 338

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183
           I+D  +  SPVK++   H D+   + F+P     LLS + DGY  +YD+  + ED
Sbjct: 134 IFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 21/210 (10%)

Query: 2   SYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETL---NPVRNFKIDQVSI 58
           S+S  +E  +G     L F P  +  LL++  +G V L D  +    +P + F +    +
Sbjct: 164 SFSYHKENGYG-----LAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIV 218

Query: 59  NSMKLINNDYNNASLFATATL-NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACG 117
           N  K   +++  +SLF T +  N++ I+D  S+  I  ++       L+   R + L   
Sbjct: 219 NDCKW--HEFQ-SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA 275

Query: 118 TELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               G D+ +Y+YD+R    P+ S    H D +T ++F P     L S  +D    ++DL
Sbjct: 276 A---GTDSNVYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331

Query: 178 ----TQQEEDDALYQVINYASIHSCGWLSP 203
                +Q+ DDA   V     +H  G  SP
Sbjct: 332 FNIGAEQQPDDAYDGVPELFMMHG-GHRSP 360

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 101/207 (48%), Gaps = 25/207 (12%)

Query: 4   SLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMK 62
           +LV E +F  DN + L F P     LL+   +G + L  W  +    +      ++ + +
Sbjct: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTS---PSKAVTTHE 206

Query: 63  LINNDYN----NASLFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DML 114
            I ND      N +LF + + + +++I+D ++N  +  +T    SPF +LD S+H  ++ 
Sbjct: 207 DIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLF 264

Query: 115 ACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNV 174
           A      G D+ +Y+YD+RN +  + + +  H D +T ++F P     L S  +D    +
Sbjct: 265 AAA----GTDSLVYLYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319

Query: 175 YDLTQ----QEEDDALYQVINYASIHS 197
           +DL Q    Q ++DA   V     +H+
Sbjct: 320 WDLMQIGSEQAQEDAADGVPELMMMHA 346

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 95/202 (47%), Gaps = 25/202 (12%)

Query: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDW----ETLNPVRNFK-IDQVSINSMKLI 64
           F  DN + L F PL    LL+   +  V L D     ++  P+R +  +    +N  K  
Sbjct: 158 FHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWH 217

Query: 65  NNDYNNASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLACGTE 119
           N    N  LF T + +S+ KI DI++ +   TI   K   PF +L   H   ++LA    
Sbjct: 218 NF---NKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAAA-- 270

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             G+D+ +Y+YD+RN   P+   +  H D +T+++F P     ++S  +D    ++DL Q
Sbjct: 271 --GMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQ 327

Query: 180 ----QEEDDALYQVINYASIHS 197
               Q  DDA   V     +H+
Sbjct: 328 IGAEQTPDDAEDGVPELIMVHA 349

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 32/133 (24%)

Query: 79  LNSVKIYDIKSNDCIATITNDK-------------------KSPFLSLD-SRH--DMLAC 116
           +N VK ++ +SN    T++ DK                    SPF +L  S+H  ++LA 
Sbjct: 233 VNDVKWHEFESN-VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAA 291

Query: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
                GVD+++Y+YD+R+ SSP+   +  H D +T ++F P     + S  +D    ++D
Sbjct: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346

Query: 177 LTQ----QEEDDA 185
           LTQ    Q +DDA
Sbjct: 347 LTQIGAEQSQDDA 359

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 124 DAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           D  + ++D+     P KS + SH D + D+K+H  +SN   + S D    V+D
Sbjct: 208 DTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 18/175 (10%)

Query: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINN-DY 68
           + +DN + L F PL    LL+   +  V L D   +   RN  + +       ++N+  +
Sbjct: 174 YHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD---VTSDRNEPVQKWENIHSDIVNDCQW 230

Query: 69  NN--ASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRH---DMLACGTELQG 122
           +N   SLF T + +S ++I+D + +  +ATI   K  PF +L   H   ++LA G    G
Sbjct: 231 HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----G 284

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           V++E+Y+YD R    P+   +  H D +T + F   D   +LS   D    ++D+
Sbjct: 285 VNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDI 338

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ-QEEDDA 185
           +YIYD  N        +  H D+   + F+P     LLSGS D    ++D+T  + E   
Sbjct: 156 VYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQ 215

Query: 186 LYQVINYASIHSCGW 200
            ++ I+   ++ C W
Sbjct: 216 KWENIHSDIVNDCQW 230

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 90/197 (45%), Gaps = 22/197 (11%)

Query: 14  DNWCLKFQPLYNHGLLTSLSNGEVKLLDW----ETLNPVRNFK-IDQVSINSMKLINNDY 68
           + + L F PL    LL+   +  V L D     ++  P+R +  +    +N  K  N   
Sbjct: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF-- 219

Query: 69  NNASLFATATLNSV-KIYDIKSNDCIATITNDKKSPFLSLDSRH---DMLACGTELQGVD 124
            N  LF T + +S+ KI D++  +   T T     PF +L   H   ++LA      G D
Sbjct: 220 -NKDLFGTVSEDSLLKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSNLLAAA----GTD 273

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ----Q 180
           + +Y+YD+RN   P+   +  H D +T+++F P     ++S  +D    ++DL Q    Q
Sbjct: 274 SHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQ 332

Query: 181 EEDDALYQVINYASIHS 197
             DDA   V     +H+
Sbjct: 333 TPDDAEDGVPELIMVHA 349

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 19/173 (10%)

Query: 16  WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFA 75
           + L F PL    LL+S  +G V   + +   P+   +   + IN ++   N +N  +LF 
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI-INDVRW--NQFN-QNLFG 228

Query: 76  TATLNS-VKIYDIKSN--DCIATITNDKKSP------FLSLDSRHDMLACGTELQGVDAE 126
             T +S + + D+++N  D      +D K+P        S  S + M A G      D+ 
Sbjct: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283

Query: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           +Y+YD RN + P+  ++  H D +T + FH  +   ++SG +D    V+DL Q
Sbjct: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 124 DAELYIYDV---RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDG 170
           D  ++IYD     N S+P+ S +  H ++   + F+P D   LLS S DG
Sbjct: 143 DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 97/204 (47%), Gaps = 29/204 (14%)

Query: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWE------TLNPVRNFK-IDQVSINSMK 62
           F  DN + L F  L    LL+   +  V L  WE      +++PVR +  +    +N +K
Sbjct: 184 FHKDNGYALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRTWNDLHSDIVNDIK 241

Query: 63  LINNDYNNASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLACG 117
             N    N  LF T + +S+ KI D+++++   TI   K   PF +L   H   ++LA  
Sbjct: 242 WHNF---NEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAAA 296

Query: 118 TELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               G+D+ +Y+YD+RN   P+   +  H D +T+I+F       ++S  +D    ++DL
Sbjct: 297 ----GMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDL 351

Query: 178 TQ----QEEDDALYQVINYASIHS 197
            Q    Q  DDA   V     +H+
Sbjct: 352 KQIGAEQTPDDAEDGVPELIMVHA 375

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 79/169 (46%), Gaps = 19/169 (11%)

Query: 28  LLTSLSNGEVKLLDWETLN--------PVRNFKIDQVSINSMKLINNDYNNASLFAT-AT 78
           L T  SNG+VK+ D    +        P R   +D   +N +  +    N+ S+ A+   
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWM---VNHTSILASCGE 257

Query: 79  LNSVKIYDIKSN---DCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNW 135
            N + + DI+ +   D +   T+      +  + ++DM+ C  + QG   +L I+D+R++
Sbjct: 258 SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDF 314

Query: 136 SSPVKSFVDSHHDDITDIKFHPSDSNFLLSG-STDGYTNVYDLTQQEED 183
             P+K +     D I+ I+++P     L +     G   ++D + ++ED
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDASGEQED 363

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 30/203 (14%)

Query: 14  DNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDY----N 69
           + + L F     + LL+   +  + L  W+  N  +N K      ++   I ND     +
Sbjct: 181 NGYGLAFNANEKYSLLSGSDDSNIAL--WDISNFEKNIKPTITFEDAHTDIINDVKWHSS 238

Query: 70  NASLFATATLNS-VKIYDIKSNDCIATITNDKK------SPFLSLDSRHDMLACGTELQG 122
            A +F + + +S +K++D +S+  I  I   K       SPF S     ++ A      G
Sbjct: 239 EAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS-----NLFAAA----G 289

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL----- 177
            D  +Y+YD+R+ S+P+ +    H D +T I+F P++   L S  +D  T V+DL     
Sbjct: 290 TDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGA 348

Query: 178 --TQQEEDDALYQVINYASIHSC 198
             TQ E +D   +V+   + H  
Sbjct: 349 EQTQDEIEDGPPEVLMIHAGHKT 371

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 6/93 (6%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ-- 179
           G D+++ +YD+R   +P+ S +  HHD +T ++F P     L SGS+D    ++DL Q  
Sbjct: 268 GTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326

Query: 180 --QEEDDALYQVINYASIHSCGWLSPRRIYTLS 210
             Q+++DA   V     +H+ G  SP   ++ S
Sbjct: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 89/189 (47%), Gaps = 22/189 (11%)

Query: 9   QSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLD--WETLNPVRNFKIDQVS--INSMKLI 64
           Q    + + L F P     LL+   +  + L D   ++  P+  F  D+ S  +N  K  
Sbjct: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTF-TDRHSDIVNDCKWH 209

Query: 65  NNDYNNASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DMLACGTEL 120
           N D N   +F + + +S ++++D +  D        KK P+ +L  S H  ++ A     
Sbjct: 210 NFDQN---IFGSVSEDSTLQLHDQRIRDAAVEKVQAKK-PYNTLAFSAHSTNLFAAA--- 262

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL--- 177
            G D+ +Y+YD R  S P+   +  H D +T ++FHP +   L+S  +D  T ++DL   
Sbjct: 263 -GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI 320

Query: 178 -TQQEEDDA 185
             +Q  DDA
Sbjct: 321 GAEQVPDDA 329

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 9/159 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H + ++ + G  K+  W+   + PV N      +I S+K   N+ +   L +T 
Sbjct: 182 FQGIDSHRVNSTFATGGAKIQLWDVNRVKPVSNLSWGADNITSVKFNQNETD--ILASTG 239

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A    +   D   Y YD+RN S 
Sbjct: 240 SDNSIVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNLSR 296

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
            +  F D H   + D+ F P+  + +++GS D    +Y+
Sbjct: 297 SLNVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKSIRIYN 333

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G+V      T   V + +   VS N S++ I      A
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 72  SLFATATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHD-MLACGTELQGVDAE 126
           ++FATA  +  ++++D +S      I+T  ++     +S + +   +LA G +    +  
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDD----NGT 395

Query: 127 LYIYDVRNWS------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
             ++D+R +S       PV  + D H   IT I FHP+D + +   S D    ++DL+ +
Sbjct: 396 WGVWDLRQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVE 454

Query: 181 EEDDALYQ 188
            +D+ + Q
Sbjct: 455 ADDEEIKQ 462

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 91/178 (51%), Gaps = 25/178 (14%)

Query: 26  HGLL-TSLSNGEVKLLDWET--------LNPVRNFKIDQVSINSMK-LINNDYNNASLFA 75
            GLL TS S+G+V + D E         +NP+    +D    N +  ++ +D    SL A
Sbjct: 206 QGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHD----SLLA 261

Query: 76  TATL-NSVKIYDIKSND-CIATITNDKKSPFLS---LDSRHDMLACGTELQGVDAELYIY 130
             +  N V I DI++ +   ++ +N   S  ++    +   DML C  +  G    + ++
Sbjct: 262 YCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAG---RINLW 318

Query: 131 DVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD-GYTNVYDLTQQEEDDALY 187
           D+RN++ P+K+ +  H+D I+ ++++P +   L +G  D G   ++DL+Q E  + ++
Sbjct: 319 DIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELIF 374

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 95/205 (46%), Gaps = 31/205 (15%)

Query: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWET------LNPVRNFKIDQVSINSMKL 63
           F  DN + L F  L    LL+   +  V L  WE         PVR +      ++S  +
Sbjct: 158 FHKDNGYALSFSTLVKGRLLSGSDDHTVAL--WEVGSGGDPTKPVRTWN----DLHSDII 211

Query: 64  INNDYNN--ASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLAC 116
            +N ++N    LF T + +S+ KI D+++N+   TI   K   PF +L   H   ++LA 
Sbjct: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANNT--TIDTVKCPQPFNTLAFSHHSSNLLAA 269

Query: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
                G+D+ +Y+YD+RN   P+   +  H D + +++F       ++S  +D    ++D
Sbjct: 270 A----GMDSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWD 324

Query: 177 LTQ----QEEDDALYQVINYASIHS 197
           L Q    Q  DDA   V     +H+
Sbjct: 325 LKQIGAEQTPDDAEDGVPELIMVHA 349

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 73/160 (45%), Gaps = 9/160 (5%)

Query: 20  FQPLYNHGLLTSLSNG--EVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ L +H   ++   G  +++L D     P+ N      ++ ++K   N      L +T 
Sbjct: 176 FQGLDHHRNNSTFVTGGAQIQLWDSSRSKPISNLTWGADNVTNVKF--NQTETDILASTG 233

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    +S  +  +    M A    +   D   Y YD+RN S 
Sbjct: 234 SDNSIVLYDLRTNSPTQKIVQSMRSNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSR 290

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
            +  F D H   + D+ F P+ +  L++GS D    +YD+
Sbjct: 291 ALNVFKD-HVSAVMDVDFSPTGTE-LVTGSYDKTIRIYDI 328

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 73  LFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DMLACGTELQGVDAELY 128
           LF + + +S +K++D +S   +   T   K+ F +L  S+H  ++ A      G+D  +Y
Sbjct: 214 LFGSVSEDSTLKLHDKRSTSKVIN-TIQAKAAFNTLAFSKHSANLFAAA----GLDTNIY 268

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL----TQQEEDD 184
           +YD R  + P+      H D IT ++FHP +   L+SG  D    ++DL     +Q+ D+
Sbjct: 269 LYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDE 327

Query: 185 A 185
           A
Sbjct: 328 A 328

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 99/202 (49%), Gaps = 34/202 (16%)

Query: 4   SLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMK 62
           +L+    F  +N + L F P     LL+   +G + L D +      N  + +  +    
Sbjct: 187 ALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQ-----ENSTLAKKPLKIWD 241

Query: 63  LINND------YN--NASLFATATLNS-VKIYDIKSNDCIATITNDKKS--PFLSLD-SR 110
            ++ND      +N  N+++FA+ + +S ++++D +  +   TI N  K+  PF +L  S+
Sbjct: 242 SVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQN---TIINSIKTTDPFNTLAFSK 298

Query: 111 HD---MLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGS 167
           H    M A GT     D+ +Y+YD RN S P+ S ++ H D IT+++F P     L+S  
Sbjct: 299 HSQYLMAAAGT-----DSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSG 352

Query: 168 TDGYTNVYDL----TQQEEDDA 185
            D    ++D+     +Q  DDA
Sbjct: 353 NDRRVIMWDINDIGAEQIPDDA 374

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 9/158 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++ + G  K+  W+   L PV N      +I S+K   N      L +T 
Sbjct: 182 FQGIDSHRENSTFATGGAKIHLWDVNRLKPVSNLSWGADNITSVKF--NQSETDILASTG 239

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A        D   Y YD+RN S 
Sbjct: 240 SDNSIVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVTANEDHNAYYYDMRNLSR 296

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            +  F D H   + D+ F P+  + +++GS D    +Y
Sbjct: 297 SLNVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKSIRIY 332

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 97  TNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
           T D +S F  +DS  +     T      A+++++DV N   PV S +    D+IT +KF+
Sbjct: 175 TFDGESAFQGIDSHRENSTFATG----GAKIHLWDV-NRLKPV-SNLSWGADNITSVKFN 228

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASI 195
            S+++ L S  +D    +YDL        + Q +   +I
Sbjct: 229 QSETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAI 267

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 9/158 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++ + G  K+  W+   L PV +      +I S+K   N+ +   L +T 
Sbjct: 182 FQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETD--ILASTG 239

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A        D   Y YD+RN S 
Sbjct: 240 SDNSIVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVTANEDHNAYYYDMRNLSR 296

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            +  F D H   + D+ F P+  + +++GS D    +Y
Sbjct: 297 SLNVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKSIRIY 332

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 94/197 (47%), Gaps = 25/197 (12%)

Query: 2   SYSLVQEQSFGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWETLN-PVRNFKIDQVSIN 59
           S  L +  S+  DN + L F P     LL++  +  V L D  + + PV       + +N
Sbjct: 149 SEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPV------SIVMN 202

Query: 60  SMKLINNDY---NNASLFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLD-SRH--D 112
              ++N+      + ++F T + + +++++D +S    A +   +K P  +L  S+H  +
Sbjct: 203 HTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK-PLNALAFSKHSKN 261

Query: 113 MLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYT 172
           ++A      G D  +Y+YD+R  S P+ +    H D +T I+F       L S  +D   
Sbjct: 262 LIAAA----GTDTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRL 316

Query: 173 NVYDLTQ----QEEDDA 185
            ++DLTQ    Q ++DA
Sbjct: 317 FIWDLTQIGAEQAQEDA 333

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 77/162 (47%), Gaps = 24/162 (14%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           YN  L T   +G V+L D     PVR+ +     I S+K     +++  L   +  NSV+
Sbjct: 501 YNSALATGTKDGVVRLWDLRIGKPVRSLEGHTDGITSLK-----FDSEKLVTGSMDNSVR 555

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDV---RNWSSP-- 138
           I+D++++  +  I  D   P  SLD    ++  G   +GV+    I+++    +W +P  
Sbjct: 556 IWDLRTSSIVDVIAYD--LPVTSLDFDDKLITVGANERGVN----IFNMERDEHWMTPEP 609

Query: 139 ---VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
              +K   D   + I  +K+    + FL++G  +G  NV+ +
Sbjct: 610 PNSLKR--DELSERIAIVKYK---NGFLVNGHNNGDINVWTI 646

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 73/158 (46%), Gaps = 9/158 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++ + G  K+  W+   L P+ N      +I S++   N+ +   L +T 
Sbjct: 182 FQGIDSHRENSTFATGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETD--ILASTG 239

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A        D   Y YD+RN S 
Sbjct: 240 SDNSIVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVTANEDHNAYYYDMRNLSR 296

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            +  F D H   + D+ F P+  + +++GS D    +Y
Sbjct: 297 SLTVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKSIRMY 332

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 18/172 (10%)

Query: 11  FGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNN 70
            GS+   +     YN  L +   +G V+L D     PVR  +     I S+K     +++
Sbjct: 487 LGSEAPMIGALQCYNSALASGTKDGVVRLWDLRIGKPVRALEGHTDGITSLK-----FDS 541

Query: 71  ASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIY 130
             L   +  NSV+I+D++++  I  I  D   P  SLD    ++  G    GV+      
Sbjct: 542 EKLVTGSMDNSVRIWDLRTSSIIDVIAYD--LPITSLDFDDKLITVGANETGVNVFNMER 599

Query: 131 DVRNWSSP-----VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           D  +W +P     +K   D   + I  +K+      FL++G  +G  NV+ +
Sbjct: 600 D-EHWMTPEPPNSLKG--DEASERIAIVKYK---DGFLINGHNNGDINVWSI 645

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 9/160 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ L +H   ++   G  ++  W+T    P+ N      +IN ++   N+ +   L +T 
Sbjct: 175 FQSLDHHRQKSNFVTGGAQIELWDTNRSKPISNLSWGADNINHVRFNQNEVD--ILASTG 232

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NSV +YD+++N     I    ++  +  +    + A    +   D   Y YD+RN S 
Sbjct: 233 SDNSVVLYDLRTNSPTQKIVQTMRTNSICWNP---VEAFNFVIANEDHNAYYYDMRNMSK 289

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
            +  F D H   + D+ F P+  + +++GS D    +Y +
Sbjct: 290 ALHVFKD-HVSAVMDVDFSPT-GDEVVTGSYDKTIRIYQV 327

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 14/157 (8%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           YN  L T   +G V+L D     PVR  +     I S+K     +++  L   +  NSV+
Sbjct: 498 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLK-----FDSEKLVTGSMDNSVR 552

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFV 143
           I+D++++  +  I  D   P  SLD    ++  G    GV+      D  +W +P     
Sbjct: 553 IWDLRTSSILDVIAYD--LPVSSLDFDGKLITVGANEGGVNVFNMERD-EHWMTPEPPHS 609

Query: 144 ---DSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
              D     I  +K+      FL++G  DG  NV+ L
Sbjct: 610 LDGDELSRRIAIVKYK---DGFLINGHNDGDINVWTL 643

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 93/206 (45%), Gaps = 18/206 (8%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G V L    T   V +     V  N S++ I      +
Sbjct: 281 EGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTES 340

Query: 72  SLFATATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHDMLACGTELQGVDAEL 127
           ++FATA  +  ++I+D +S      I+T+ ++     +S + +   L    + +G     
Sbjct: 341 TVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT---W 397

Query: 128 YIYDVRNWSS------PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
            I+D+R +S       PV  + D H   IT I F+P D + +   S D    ++DL+ + 
Sbjct: 398 GIWDLRQFSPNSEKALPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEA 456

Query: 182 EDDALYQVINYASIHSCGWLSPRRIY 207
           +D+ + Q    A I     + P+ ++
Sbjct: 457 DDEEIKQ--QKAEIKELEQIPPQLLF 480

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 59  NSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHD--MLAC 116
           NS+  I  + N+ + FA  +   V+++  ++   I T +  K   + S   R D  +LA 
Sbjct: 40  NSVTSIAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVY-SASFRQDGKLLAM 98

Query: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           G         + +YD  N  + + S   S H      KFHP+DS  L++ S D    V+D
Sbjct: 99  G----DATGRVSVYDSYNPRAQLVSIAASSHPTHV-AKFHPADSRTLVTASDDRVVRVWD 153

Query: 177 LTQQEE 182
           +TQ +E
Sbjct: 154 ITQAQE 159

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 9/158 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWETL--NPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H + T+   G   +  W+T    P+ N      +I S+K   N      L +T 
Sbjct: 176 FQGIDHHKVKTTFVTGGPTIQLWDTARSKPLSNLSWGADNITSVKF--NQTETDILASTG 233

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A        D   Y YD+RN S 
Sbjct: 234 SDNSIVLYDVRTNSPTQKIVQRLRTNAICWNP---MEAFNFVTANEDHNAYYYDMRNMSR 290

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            +  F D H   + D+ F P+  + +++GS D    ++
Sbjct: 291 ALNVFKD-HVSAVMDVDFAPT-GDEIVTGSYDKTIRIF 326

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 79/175 (45%), Gaps = 25/175 (14%)

Query: 28  LLTSLSNGEVKLLDWETL--------NPVRNFKIDQVSINSMKLINNDYNNASLFATATL 79
           + +S SNG +K+ D            NP      D+   N +  +   ++++ L A    
Sbjct: 209 IASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWM--VHHSSILAACGES 266

Query: 80  NSVKIYDIKSNDCIATITNDKKSPF------LSLDSRHDMLACGTELQGVDAELYIYDVR 133
           N++ + D ++ D        K SP       L  +  +DML C  +  G    + ++D R
Sbjct: 267 NTIGLLDTRAPDAFKPT---KASPHTGGINALQFNYANDMLLCAADSNG---GIALWDCR 320

Query: 134 NWSSPVKSFVDSHHDDITDIKFHPSDSNFLL-SGSTDGYTNVYDLTQQEEDDALY 187
            +S P+  F  +H D ++ ++++P+    +  +G  DG   ++D +++ ED  L+
Sbjct: 321 AFSKPLSVF--NHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSREPEDSLLF 373

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 86/183 (46%), Gaps = 16/183 (8%)

Query: 18  LKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNASLFA 75
           L + PL   G LLT   +GE+ L    T   +   +   V  N S++ I       ++FA
Sbjct: 295 LDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFA 354

Query: 76  TATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYD 131
           TA  +  ++I+D +S      I+T  ++     +S + + + L    + +GV     ++D
Sbjct: 355 TAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGV---WGVWD 411

Query: 132 VRNWS------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDA 185
           +R +S      SPV  + D H   IT I F+P D + +   S D    ++DL+ + +D+ 
Sbjct: 412 LRQFSPSQENASPVAQY-DFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEE 470

Query: 186 LYQ 188
           + Q
Sbjct: 471 IKQ 473

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 74/192 (38%), Gaps = 40/192 (20%)

Query: 18  LKFQPLY---NHGLLTSL--SNGEVKLLDWETLNPVRNFKID--QVSINSMKLINN--DY 68
           LK  P     N  +LT+    NGEV + D   +N V++F+I   QVS  S + I+    +
Sbjct: 230 LKVTPFATNNNQEILTATMSENGEVYIFD--IINQVKSFQIPGYQVSKQSKRPIHTIRSH 287

Query: 69  NNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELY 128
            N   F       +K   + + DC   I       FL+  SRH                 
Sbjct: 288 GNVEGFGLDWSPLIKSGALLTGDCSGEI-------FLT--SRH----------------- 321

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQ 188
                 W +  +SF   ++  I DI++  ++     +   DGY  ++D   ++   A+  
Sbjct: 322 ---TSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAIST 378

Query: 189 VINYASIHSCGW 200
             +   ++   W
Sbjct: 379 RASNVDVNVISW 390

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 9/146 (6%)

Query: 33  SNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATA-TLNSVKIYDIKSND 91
           +  E+ L D     P  N      +++++K    + N   +FA+A + NSV +YD+++N 
Sbjct: 191 AGAEINLWDSSRSRPTANLSWGADNVSTVKF---NQNETDIFASAGSDNSVVLYDLRTNS 247

Query: 92  CIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDIT 151
                T   ++  L  +    M A    +   D   Y YD+RN S  +  F D H   + 
Sbjct: 248 PTQKFTQRMRTNALCWNP---MEAYNFVVASEDHNAYYYDMRNLSRALHVFKD-HVSAVM 303

Query: 152 DIKFHPSDSNFLLSGSTDGYTNVYDL 177
           D+ F P+  + +++GS D    +Y +
Sbjct: 304 DVDFSPT-GDEIVTGSYDKTIRIYQV 328

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 8/154 (5%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           Y   L T   +G V+L D     PVR  +     I S+K     +++  L   +  NSV+
Sbjct: 517 YKSALATGTKDGIVRLWDLRVGKPVRLLRGHTDGITSLK-----FDSEKLVTGSMDNSVR 571

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFV 143
           I+D++++  +  I  D   P  SLD    ++A G   +GV+      D  +W +P     
Sbjct: 572 IWDLRTSSVVDVIAYD--LPVTSLDFDDKLIAVGANERGVNVFNMELD-EHWMTPEPPQS 628

Query: 144 DSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
            +  +    I        FL +G  +G  NV+ +
Sbjct: 629 LNGDERSRRIAIVKYKDGFLTNGHNNGDINVWTI 662

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 99  DKKSPFL-SLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHP 157
           D  +P + +L      LA GT+    D  + ++D+R    PV+  +  H D IT +KF  
Sbjct: 505 DTDAPMIGALQCYKSALATGTK----DGIVRLWDLR-VGKPVR-LLRGHTDGITSLKF-- 556

Query: 158 SDSNFLLSGSTDGYTNVYDL 177
            DS  L++GS D    ++DL
Sbjct: 557 -DSEKLVTGSMDNSVRIWDL 575

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 59  NSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHD--MLAC 116
           NS+  I+ +  + + FA  +   V+++  ++   I T +  K   + S   R D  +LA 
Sbjct: 40  NSVTSISFNPTHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVY-SASFRQDGKLLAM 98

Query: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           G         + IYD  N  + + S   S H      KFHP+DS  L++ S D    V+D
Sbjct: 99  G----DATGRVSIYDSYNPRTQLVSIAASSHPTHV-AKFHPADSRTLVTASDDRVVRVWD 153

Query: 177 LTQQEE 182
           +TQ +E
Sbjct: 154 ITQAQE 159

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 79/171 (46%), Gaps = 21/171 (12%)

Query: 28  LLTSLSNGEVKLLDWETLN--------PVRNFKIDQVSINSMKLINNDYNNASLFATATL 79
           L  S S+G+VK+ D    N        P   +++D+   N +  +   ++++ L      
Sbjct: 205 LAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWM--VHHSSILAVCGEG 262

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLS---LDSRHDMLACGTELQGVDAELYIYDVRNWS 136
           N + I D ++    +T  +   +  ++    +  +D L C  + +G    L I D+R   
Sbjct: 263 NGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGT---LNICDIRQLE 319

Query: 137 SPVKSFVDSHHDDITDIKFHPSDSNFLLS-GSTDGYTNVYDLTQQEEDDAL 186
            PVK++  SH D ++ I+++P     + S G  DG   ++DL Q  EDD L
Sbjct: 320 HPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ--EDDPL 366

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 9   QSFGSDNWCLKFQPLYNHGLLTSLSNG--EVKLLDWETLNPVRNFKIDQVSINSMKLINN 66
           ++F SD   + FQ + +H   ++   G  +++L D     P+ N      +I ++K    
Sbjct: 168 KTFYSD---IAFQGIDHHRSNSNFVTGGAQIQLWDSNRSTPLSNLSWGADNITTVKF--- 221

Query: 67  DYNNASLFATA-TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDA 125
           + N   +FA+A + NS+ +YD+++N     I    ++  +  +    M A    +   D 
Sbjct: 222 NQNETDIFASAGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVIGNEDH 278

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             Y YD+RN S  +  F D H   + D+ F P+  + +++GS D    ++   Q
Sbjct: 279 NAYYYDMRNMSRAINVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKTIRIFKTNQ 330

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 83/177 (46%), Gaps = 26/177 (14%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDW-----ETLNPVRNFK--IDQVSINSMKLINNDYN 69
           C++  P  +  L+T   +  +KL D       +L+   N    I+    ++ ++ +  Y+
Sbjct: 342 CMQLHP-DSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYD 400

Query: 70  NASLFATATLNSVKIYDIKSNDCIATI---------TNDKKSPFLSLDSRHDMLACGTEL 120
           N  L + +   S++ +D+ + +C+ T+         TN K S   +L S    LA G++ 
Sbjct: 401 NEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSK- 459

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
              D  + ++D+R  S  V   +  H   IT ++F   DS  +++GSTD   +V DL
Sbjct: 460 ---DGIIRLWDLR--SGKVVRTLLKHQGPITSLQF---DSTKIITGSTDANISVSDL 508

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 7/145 (4%)

Query: 35  GEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIA 94
            +++L D     P+ N      ++ S+K   N      L +T + NS+ +YD+++N    
Sbjct: 193 AQIQLWDANRSKPISNLTWGADNVTSVKF--NQTETDILASTGSDNSIVLYDLRTNSPTQ 250

Query: 95  TITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIK 154
            I    ++  +  +    M A    +   D   Y YD+RN S  +  F D H   + D+ 
Sbjct: 251 KIRQSMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSRALNVFKD-HVSAVMDVD 306

Query: 155 FHPSDSNFLLSGSTDGYTNVYDLTQ 179
           F P+  + +++GS D    +Y   Q
Sbjct: 307 FSPT-GDEIVTGSYDKTIRIYKTNQ 330

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 35  GEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATA-TLNSVKIYDIKSNDCI 93
            E+ L D     P+ N      +++++K    + N   +FA+A + NSV +YD+++N   
Sbjct: 194 AEINLWDSTRSRPITNLSWGADNVSTVKF---NQNETDIFASAGSDNSVVLYDLRTNSPT 250

Query: 94  ATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDI 153
                  ++  L  +    M A    +   D   Y YD+RN S  +  F D H   + D+
Sbjct: 251 QKFVQKMRTNALCWNP---MEAYNFVVANEDHNAYYYDMRNLSRALHVFKD-HVSAVMDV 306

Query: 154 KFHPSDSNFLLSGSTDGYTNVYDL 177
            F P+  + +++GS D    +Y +
Sbjct: 307 DFSPT-GDEIVTGSYDKTIRIYQV 329

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 90/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LL+   +G++ L    T   V + +   VS N S++ I      +
Sbjct: 274 EGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTES 333

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FATA  +  ++I+D +S      I+    +  +++ S  D    +LA G +    +  
Sbjct: 334 TVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGT 389

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + D H   IT I F+P D + +  GS D    ++DL+ 
Sbjct: 390 WGVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 448

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 449 EADDEEIKQ 457

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/91 (19%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query: 113 MLACGTELQG-VDAELYIYD--VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD 169
           ++  G  L G    ++Y+       W +  +SF  S+++ I DI++  ++S    + + D
Sbjct: 283 LIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACD 342

Query: 170 GYTNVYDLTQQEEDDALYQVINYASIHSCGW 200
           GY  ++D   ++   A+    +   ++   W
Sbjct: 343 GYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 112 DMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL-SGSTDG 170
           D+L C  +  G    + ++D+R++SSP++S    HH  ++ ++++P     L  +G  DG
Sbjct: 303 DLLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDG 357

Query: 171 YTNVYDLTQ 179
              ++DL+Q
Sbjct: 358 LVKIWDLSQ 366

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 75/144 (52%), Gaps = 18/144 (12%)

Query: 68  YNNASLFATATLNSVK-IYDIKSNDCIATITNDKKSPFLSLDSRHD--MLACGTELQGVD 124
           +N+ SL +TA L+++  I+DI+S   I ++    K P  S+D   +   LA G+     D
Sbjct: 314 HNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK-PIYSVDWSQNGYQLASGSG----D 368

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD----LTQQ 180
             + ++D+R     V++ + +H+  ++ +KF+  +  +L+S   D   N+++    + ++
Sbjct: 369 GTIKVWDIRK-KGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKER 426

Query: 181 EEDDALYQVINY----ASIHSCGW 200
             +  L +V++       I+S GW
Sbjct: 427 SLEGHLDKVMSIDIVGPDIYSAGW 450

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 73/158 (46%), Gaps = 9/158 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++   G  ++  W++    P+ N      +I S+K   N+ +   L +T 
Sbjct: 175 FQGIDHHREASTFVTGGAQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVD--ILASTG 232

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + N++ +YD+++N     I    ++  +  +    M A    +   D   Y YD+RN S 
Sbjct: 233 SDNAIVLYDLRTNSPTQKIIQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSR 289

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            +  F D H   + D+ F P+  + +++GS D    ++
Sbjct: 290 ALHVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKTIRIF 325

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 88/189 (46%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G+V L    T   V + +    S N S++ I      +
Sbjct: 278 EGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTES 337

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FAT+  +  ++I+D +S      I+    +  +++ S ++    +LA G +    D  
Sbjct: 338 TVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDD----DGR 393

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R  S        PV  + D H   IT I F+P D + +   S D    ++DL+ 
Sbjct: 394 WGVWDLRQLSPNNSENVQPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSV 452

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 453 EADDEEIKQ 461

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 97/209 (46%), Gaps = 24/209 (11%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWET---LNPVRNFKIDQVSINSMKLINNDYN 69
           + + L + PL   G LLT   +G V L    +   +   + F +D  +  S++ I    +
Sbjct: 286 EGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVD--NNKSIEDIKWSPS 343

Query: 70  NASLFATATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHD-MLACGTELQGVD 124
             ++FAT  ++  V+I+DI+S      ++   +D     +S + +   +LA G +    +
Sbjct: 344 ENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDD----N 399

Query: 125 AELYIYDVRNWS------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
               ++D+R +S      SPV  + D H   IT I F+P D + +   S D    ++DL+
Sbjct: 400 GTWGVWDLRQFSNQQGGVSPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 458

Query: 179 QQEEDDALYQVINYASIHSCGWLSPRRIY 207
            + +D+ + Q    A +     + P+ ++
Sbjct: 459 VEADDEEIKQ--QAAEVKELQQIPPQLLF 485

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 80  NSVKIYDIKSNDCIATITNDK----KSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNW 135
           N +K++D +S  CI+TI   K    K+ F    ++ ++LA   +    D    I+D+R  
Sbjct: 229 NLIKLWDPRSGQCISTILGFKHTIIKTKFQP--TKGNLLAVVAK----DKSCKIFDIRQN 282

Query: 136 SSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYA 193
              +KSF D    D   + +HP + +    G  DG    +DL Q       +  I YA
Sbjct: 283 MKELKSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPYA 338

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 55/108 (50%), Gaps = 6/108 (5%)

Query: 70  NASLFATATLNSVK-IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELY 128
           + SL A+  L+S+  I+D++S + I  +   +K P   LD   +     T     D  + 
Sbjct: 318 DGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQK-PIYGLDWSPNGYQVAT--ASGDGSIK 374

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           I+D+R  S  + S + +H +   DIKF  ++ +FL+SG  D    +++
Sbjct: 375 IWDLRKQS--IVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFN 420

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G D   YI+D R+ S+  K FV     D+T IKF   D N +++GS DG  N++DL
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVSD--SDVTSIKFF-KDGNSIITGSDDGIINMFDL 303

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 90/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LL+   +G+V      T   V + +   VS N S++ I    + +
Sbjct: 273 EGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSES 332

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FATA  +  ++I+D +S      I+    +  +++ S  D    +LA G +    +  
Sbjct: 333 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGT 388

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + D H   IT I F+P D + +  GS D    ++DL+ 
Sbjct: 389 WGVWDLRQFTPSNADSVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 447

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 448 EADDEEIKQ 456

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 7/141 (4%)

Query: 37  VKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATI 96
           ++L D    NP+ N      ++ ++K   N+++   L +T + NS+ +YD+++N     I
Sbjct: 194 IELWDSNRSNPISNLSWGADNVTNVKFNQNEHD--ILASTGSDNSIVLYDLRTNSPTQKI 251

Query: 97  TNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
               ++  L  +    M A        D   Y YD+R  S  +  F D H   + D+ F 
Sbjct: 252 VQTMRTNSLCWNP---MEAFNFVTANEDQNSYYYDMRYMSRALNVFKD-HVSAVMDVDFS 307

Query: 157 PSDSNFLLSGSTDGYTNVYDL 177
           P+    +++GS D    +Y++
Sbjct: 308 PTGQE-IVTGSYDKTIRIYNI 327

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 28/170 (16%)

Query: 28  LLTSLSNGEVKLLDWETLNPVRNFKIDQV---------------SINSMKLINNDYNNAS 72
           LL+S ++  VK   W+   P +N   D++                IN++ +  ND    S
Sbjct: 447 LLSSSTDMTVK--KWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPND----S 500

Query: 73  LFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYD 131
           +FATA+ + + KI+D+ + + +AT+ N K+  +     +HD L         D  + I+ 
Sbjct: 501 IFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATC---SGDKTIKIWS 557

Query: 132 VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           + N++  +K+ ++ H + +  I F   +   L+S   DG   ++D +  E
Sbjct: 558 LENYN--IKATLEGHTNAVQRISFINKNKQ-LVSCGADGLVKIWDCSTGE 604

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 12/130 (9%)

Query: 54  DQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDM 113
           D+  I ++KL  +    + L   A    ++IY + S   + ++        +  D    +
Sbjct: 59  DEQEITALKLTPD---GSYLCFVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCDETSTL 115

Query: 114 LACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPS--DSNFLL-SGSTDG 170
           L  G    G D  + I+D+ N    V      H   I+ +KF+     +N+LL SG T+G
Sbjct: 116 LVIG----GTDGSVSIFDIEN--GYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNG 169

Query: 171 YTNVYDLTQQ 180
              ++DL ++
Sbjct: 170 VVKIWDLVKR 179

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 69  NNASLFATATLNSVK-IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAEL 127
           ++ SL  +A L+    I+DI+S +C   ++   K P  S+D         T     D  +
Sbjct: 317 SDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTK-PIYSVDWSPRGFEVAT--ASGDGTV 373

Query: 128 YIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
            I+D+R  + P    + +H+  ++ I+F   +  FL+S   D   NVY
Sbjct: 374 NIWDIRKTNQP--QVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LL+   +G++      T   V + +   VS N S++ I      +
Sbjct: 273 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTES 332

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FATA  +  ++I+D +S      I+    +  +++ S  D    +LA G +    +  
Sbjct: 333 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGT 388

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + D H   IT I F+P D + +  GS D    ++DL+ 
Sbjct: 389 WGVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 447

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 448 EADDEEIKQ 456

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +KI+D++    + ++     S  +  DS   +LA G    G D  + + DV N    V  
Sbjct: 84  LKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIG----GTDGSITVVDVEN--GYVTH 137

Query: 142 FVDSHHDDITDIKFHPSDSN---FLLSGSTDGYTNVYDLTQQE 181
            +  H   I+ +KF+   +     L SG T+G   ++DL +++
Sbjct: 138 SLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LL+   +G++      T   V + +   VS N S++ I      +
Sbjct: 275 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTES 334

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FATA  +  ++I+D +S      I+    +  +++ S  D    +LA G +    +  
Sbjct: 335 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGT 390

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + D H   IT I F+P D + +  GS D    ++DL+ 
Sbjct: 391 WGVWDLRQFTPSNADAVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSV 449

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 450 EADDEEIKQ 458

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AHSD +++  F+P +H+   +SCG+DG VK W
Sbjct: 607 AHSDSIMKVAFLPESHN--FFSCGKDGLVKYW 636

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 18/121 (14%)

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTEL 120
           KL+   YN+           VKI+D+ S   +      K +   L  DS    L  G++ 
Sbjct: 88  KLLAAGYNDGV---------VKIWDLLSKSVLINFNGHKSAITVLKFDSTGTRLISGSK- 137

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
              D+++ ++D+       K  + SH D IT +     D  +L+S S DG   V+DL  Q
Sbjct: 138 ---DSDIIVWDLVGEVGLFK--LRSHKDSITGLWCEGED--WLVSTSKDGLIKVWDLKTQ 190

Query: 181 E 181
           +
Sbjct: 191 Q 191

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 73/151 (48%), Gaps = 17/151 (11%)

Query: 70  NASLFATATLNSVKI-YDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELY 128
           + SL ATA  + V I +D++S   I ++    K  + S  S++      +     D  + 
Sbjct: 321 DGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSG----DGTIK 376

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL-------TQQE 181
           I+D+R     V++ + +H + +TD+KF   +S FL+S S D   NV+         T Q 
Sbjct: 377 IWDLRK-VDDVETIL-AHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQG 434

Query: 182 EDDALYQV---INYASIHSCGWLSPRRIYTL 209
            +D +  +    +Y +I S GW    +++++
Sbjct: 435 HNDKILSIDISSDYQTIVSGGWDRSVKLWSM 465

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 10/165 (6%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFAT 76
           C +F P  ++ L+  LSN EV+  D    +     ++    ++S+  +    + +   ++
Sbjct: 259 CAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFISS 318

Query: 77  ATLNSVKIYDIKSNDCIATITNDKK--SPFLSLDSRHDMLACGTELQGVDAELYIYDVRN 134
           +   S++I+D + N  I  I++  +   PF+ +   H   A     Q +D  +Y + ++ 
Sbjct: 319 SEDKSMRIWDNQVNIPIKQISDTAQYSMPFIDIHPEHHYFAT----QSMDNAIYAFSMKP 374

Query: 135 --WSSPVKSFVDSHHDDITDIKFHPS-DSNFLLSGSTDGYTNVYD 176
               +P K F + H      I F  S D  +L SG T G   ++D
Sbjct: 375 KYRRNPKKRF-EGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWD 418

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 9/68 (13%)

Query: 114 LACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTN 173
           LA GT+    D  + ++D+R  S  +   +  H D IT +KF   D+N ++SGS DG T 
Sbjct: 594 LATGTK----DGIIRLWDLR--SGEIARKLIGHQDAITSLKF---DTNNIISGSLDGSTR 644

Query: 174 VYDLTQQE 181
           ++DL Q +
Sbjct: 645 IWDLRQDQ 652

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G++      T   + + +   V+ N S++ I      +
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTES 334

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FA+A  +  ++I+D +S      I+    +  +++ S  +    +LA G +    +  
Sbjct: 335 TVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDD----NGT 390

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R +S        PV  + D H   IT I F+P D + +  GS D    ++DL+ 
Sbjct: 391 WGVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSV 449

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 450 EADDEEIKQ 458

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 70  NASLFATATLNSVK-IYDIKSNDCIATITNDKKSPFLSLD--SRHDMLACGTELQGVDAE 126
           + +L  +  L+S+  ++D++S   I T+    K P   +D  S    LA G    G D  
Sbjct: 319 DGALICSGGLDSLAMVWDLRSGKNIVTLQGHAK-PVYCVDWSSNSHQLATG----GGDGV 373

Query: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
           + ++D+R    P    + +H   ++ ++F  +  + L+SG  D   NVY
Sbjct: 374 VNVWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G++ L    T   + + +    + N S++ I      +
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTES 339

Query: 72  SLFATATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHD-MLACGTELQGVDAE 126
           ++FAT+  +  V+I+D +S      I+T  ++     +S + +   +LA G +    +  
Sbjct: 340 TVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD----NGS 395

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R +S        PV  + D H   IT I F+P D + +   S D    ++DL+ 
Sbjct: 396 WGVWDLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSV 454

Query: 180 QEEDDALYQ 188
           + +DD + Q
Sbjct: 455 EADDDEIQQ 463

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 66/189 (34%), Gaps = 35/189 (18%)

Query: 18  LKFQPLYNHG----LLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINN--DYNNA 71
           LK  P   HG      T   NGEV + D             QV   S K I+   ++ N 
Sbjct: 220 LKVSPFATHGQEVLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNV 279

Query: 72  SLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYD 131
             +       +K   + + DC   I       FL+   RH                    
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQI-------FLT--QRH-------------------- 310

Query: 132 VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVIN 191
              W +  + F  +++  + DI++ P++S    +  TDGY  ++D   ++   A+    +
Sbjct: 311 TSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRAS 370

Query: 192 YASIHSCGW 200
              ++   W
Sbjct: 371 NTDVNVISW 379

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +KI+ +K+   + ++     S  L  DS   +LA G    G D  + + D+ N    +  
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIEN--GYITH 138

Query: 142 FVDSHHDDITDIKFHPS-DSN--FLLSGSTDGYTNVYDLTQQE 181
               H   I+ +KF+   DS    L SG T+G   V+DL +++
Sbjct: 139 SFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRK 181

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 63/143 (44%), Gaps = 7/143 (4%)

Query: 42  WETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATI--TND 99
           +E +  +     + VS   +  I  + + +S         VKI + KS   IA++   +D
Sbjct: 170 YEKIKQIELVGSEVVSTRPVSKIRINSDGSSSVCGTWAGDVKILEPKSLKTIASLPSVHD 229

Query: 100 KKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSD 159
            K   L  ++ +D++  G E    DA + ++  +       + +  H   + ++KFHPS+
Sbjct: 230 GKIGGLDWNTSYDLIVSGAE----DALVKLHTYKEGRLETAAVLQGHEGRVVNVKFHPSN 285

Query: 160 SNFLLSGSTDGYTNVYDLTQQEE 182
             F+ S S D    ++D+    E
Sbjct: 286 -KFIASASFDQTWRLWDVETGAE 307

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 75/162 (46%), Gaps = 9/162 (5%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++   G  K+  W++    P+ +      +I+++K   N+ +   L +  
Sbjct: 176 FQGIDHHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETD--ILASAG 233

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NS+ +YD+++N     I    ++  +  +    M A    +   D   Y YD+RN S 
Sbjct: 234 SDNSLVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVVANEDHNAYYYDMRNMSR 290

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
            +  F D H   + D+ F P+  + +++GS D    +++ T 
Sbjct: 291 ALNVFKD-HVSAVMDVDFSPT-GDEIVTGSYDKTIRIFNTTH 330

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 77/165 (46%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L A A   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITND----KKLLAAAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             K +   LS    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHKGNVTSLSFQQDNKWMVSSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q I+ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVAS 169

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 27/165 (16%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  +++S  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPFLSLDSRHD---MLACGTELQGVDAELYIYDVRNWS- 136
           +++I+D+  N C   +T +   P  S+    D   ++A  T+        +++++ N + 
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTK-----GNCFVWEMPNHTD 193

Query: 137 ----SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
                PV  F  +H+D IT I    SD   L + S D  T V+ +
Sbjct: 194 ASNLKPVTKF-KAHNDYITRILL-SSDVKHLATCSADHTTRVWSI 236

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSL--DSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           N VK++D ++  CI+TI   K +   +    ++ +MLA  ++    D    I+D+R    
Sbjct: 231 NLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISK----DKSCRIFDIRQNMK 286

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDA--LYQVINYA 193
            +  + D    D   + +HP + +    G  DG    +DL Q+ +D +   +  I YA
Sbjct: 287 ELAVYRD--ESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYA 342

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 11/94 (11%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           G D  LYI+D R  +S V+SF  S   D++ +KF   + N + +GS DG TN+YDL    
Sbjct: 281 GSDGYLYIWDKRVPTS-VQSFFVSD-SDVSKVKFF-RNGNTIATGSDDGCTNLYDLRSD- 336

Query: 182 EDDALYQVINYASIHSCGWLSP--RRIYTLSHME 213
                 ++ NY+   S    +P  ++ Y +S+M+
Sbjct: 337 -----CRIANYSLSRSIHGATPVQQQTYIMSNMD 365

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 10/118 (8%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSL--DSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           N +K++D +S  CI+TI   K +   +    ++ +MLA  ++    D    ++D+R    
Sbjct: 231 NLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISK----DKSCRVFDIRQNMK 286

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDA--LYQVINYA 193
            +  + D    D   + +HP + +    G  DG    +DL Q+ +D +   +  I YA
Sbjct: 287 ELAVYRD--ESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSSSGCFHNIPYA 342

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 15/163 (9%)

Query: 20  FQPLYNHGLLTSLSNG--EVKLLDWETLNPVRNFK--IDQVSINSMKLINNDYNNASLFA 75
           FQ + +H    +   G  +++L D     P+ N    +D VS      +  + N   + A
Sbjct: 179 FQSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVS-----FVRFNQNEEDILA 233

Query: 76  -TATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRN 134
            T + NS+ +YD+++N     +    ++  L  +    M      +   D   Y YD+RN
Sbjct: 234 STGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNP---MEPFNFAIANEDHNAYYYDMRN 290

Query: 135 WSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
            S  +  F D H   + D+ F P+    +++GS D    +++L
Sbjct: 291 MSRALHVFKD-HVSAVMDVDFSPTGEE-IVTGSYDKTIRIFNL 331

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWS---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    L IYD+   S   SP+ +    H   I  + F+   +N ++SG  DGY  V+DL
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDL 271

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 18/166 (10%)

Query: 18  LKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           +K  PL     LT+++N + + +    L P   F I  +++ S  L    YN  ++    
Sbjct: 46  IKLSPLQER--LTTITNNDEQEITCLKLTPDGKFLI-SIALQSQAL--KIYNLTAIEGET 100

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           T+N+ +    +S   I T+     S  +  DS   ++A G    G D  + + D+ N   
Sbjct: 101 TMNTKQ----QSLQPIKTLKLSSPSYIMDCDSTSTLVAVG----GTDGSIIVVDIEN--G 150

Query: 138 PVKSFVDSHHDDITDIKFHPS-DSN--FLLSGSTDGYTNVYDLTQQ 180
            +      H   I+ +KF+ + D+N   L SG T+G   ++DL ++
Sbjct: 151 FITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKR 196

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 78/210 (37%), Gaps = 50/210 (23%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWET--LNPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++   G  ++  W+T    PV N      ++ S+K   N+ +   L +T 
Sbjct: 176 FQSIDHHRTKSTFVTGGAQIELWDTGRSKPVSNLSWGADNVTSVKFNQNETD--ILASTG 233

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           + NSV +YD+++N     I    ++  +  +    M A    +   D   Y YD+RN S 
Sbjct: 234 SDNSVVLYDLRTNSPTQKIVQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSR 290

Query: 138 PVKSFVDSHHDDITDIKFHPS--------------------------------------- 158
            +  F D H   + D+ F P+                                       
Sbjct: 291 ALNVFKD-HVSAVMDVDFSPTGDEIVTGSYDKTVRIYQVNHGHSREIYHTKRMQHVFQVK 349

Query: 159 ---DSNFLLSGSTDGYTNVYDLTQQEEDDA 185
              DS +++SGS DG   ++     E  D 
Sbjct: 350 YSMDSKYVVSGSDDGNVRLWRARAWERSDV 379

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDA 185
           ++ I D+RN  SP+ + ++ H   + +IK+HP+  N LLS S D     +DL        
Sbjct: 376 KIIILDMRNPESPILT-LEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNS----- 429

Query: 186 LYQVINYASIHSCG 199
            +  IN  S+ S G
Sbjct: 430 -FMEINGGSVKSPG 442

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 110 RHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD 169
           + +M A G    G D+ ++I+D R  SS  K ++   + D+  +KF+ +D N ++SGS D
Sbjct: 246 KTNMFATG----GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDD 298

Query: 170 GYTNVYDL 177
           G   +YDL
Sbjct: 299 GIIRLYDL 306

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL 164
           +SL+   ++LA G    G D    ++D+ N   PVK FV  H   +  I F P   + L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 165 SG 166
           +G
Sbjct: 64  TG 65

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + P    G LLT   +G++      T   V + +   VS N S++ I       
Sbjct: 276 EGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEG 335

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTE--LQGV- 123
           ++FA+A  +  ++I+D +S      I+    +  +++ S  D    +LA G +  + GV 
Sbjct: 336 TVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVW 395

Query: 124 DAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183
           D   +  D  N   PV  + D H   IT I F+P D + +   S D    ++DL+ + +D
Sbjct: 396 DLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADD 454

Query: 184 DALYQ 188
           + + Q
Sbjct: 455 EEIKQ 459

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 80/174 (45%), Gaps = 20/174 (11%)

Query: 28  LLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFAT---------AT 78
           L  + S+G VK+ D +  N V N  I +         +   N+ S  +            
Sbjct: 212 LAVAYSHGAVKVWDLQRFN-VDNTTISETEWECSNFDSRGVNDVSWMSQHDSILAACGER 270

Query: 79  LNSVKIYDIKSNDCIATITNDKKSPFLS---LDSRHDMLACGTELQGVDAELYIYDVRNW 135
            +S+ ++D ++ + +A I N  KS  ++    +  +++L   T+  G      ++DVR  
Sbjct: 271 SDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKL 327

Query: 136 SS-PVKSFVDSHHDDITDIKFHPSDSNFLL-SGSTDGYTNVYDLTQQEEDDALY 187
           S+ P+  F   H   ++ ++++P D + L  +G +DG   ++D + + ED  ++
Sbjct: 328 SAEPIVHF--DHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTIF 379

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 85/189 (44%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G V L    T   + +        N S++ I      A
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 346

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FAT   +  ++I+D +S      I+    S  +++ S ++    +LA G +    +  
Sbjct: 347 TVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDD----NGT 402

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R +S       SPV  +   H   IT I F+P D + +   S D    ++DL+ 
Sbjct: 403 WGVWDLRQFSPNNAASVSPVAQY-SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSV 461

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 462 EADDEEIKQ 470

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 70/153 (45%), Gaps = 22/153 (14%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           V+IYD+    CI T++  K      L   + +L  G+     D  +   DVR    P   
Sbjct: 316 VEIYDVVKRKCIRTLSGHKDR-VACLSWNNHILTSGSR----DRRILHRDVR---VPDSF 367

Query: 142 F--VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ------EEDDALYQVINYA 193
           F  +++H  ++  +K++P +SN L SG  D    VYD T +      EE  A  + + ++
Sbjct: 368 FERIETHSQEVCGLKWNP-ESNKLASGGNDNMVYVYDGTSRSPVLKFEEHTAAVKALAWS 426

Query: 194 S-----IHSCGWLSPRRIYTLSHMETFSISELN 221
                 + S G  + R++ T +    F ++E++
Sbjct: 427 PHKRGILASGGGTADRKLKTWNVNTGFKVNEVD 459

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 11/159 (6%)

Query: 20  FQPLYNHGLLTSLSNGEVKLLDWETL--NPVRNFKIDQVSINSMKLINNDYNNASLFATA 77
           FQ + +H   ++   G  ++  W+T       N      +I S+K   ND N   L +T 
Sbjct: 175 FQGIDHHRSNSAFVTGGAQIQLWDTSRSKSTSNLSWGADNITSVKFNQNDSN--ILASTG 232

Query: 78  TLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDM-LACGTELQGVDAELYIYDVRNWS 136
           + NS+ +YD+++N     I    ++  L  +         G E    D   Y YD+R  +
Sbjct: 233 SDNSIVLYDLRTNSPTQKIVQQMRTNSLCWNPMEPFNFVTGNE----DHNAYYYDMRKMN 288

Query: 137 SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
             +  F D H   + D+ F P+  + +++GS D    ++
Sbjct: 289 RALNVFKD-HVSAVMDVDFAPT-GDEIVTGSYDKTIRIF 325

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 148 DDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASI 195
           D+IT +KF+ +DSN L S  +D    +YDL        + Q +   S+
Sbjct: 213 DNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNSL 260

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 82  VKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           +K++D+ S   + T    K +   L+ DS    L  G+     D+++ ++D+ +     K
Sbjct: 98  IKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGSN----DSDIIVWDLVSEVGLYK 153

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
             + SH D+IT I +   D N+L+S S DG   V+DL  Q+
Sbjct: 154 --LRSHKDNITGI-WCSDDENWLISTSKDGLIKVWDLKIQQ 191

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH+D ++   F+  N HN  +SC +DGT+K W
Sbjct: 607 AHADSIMNVKFL-NNSHN-FFSCSKDGTIKYW 636

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 70  NASLFATATL-NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELY 128
           + SL  T  L N+  ++DI+    I T+ N    P   +D   +     T   G D  + 
Sbjct: 316 DGSLVCTGGLDNTALLWDIRCGKSIMTL-NGHSKPVYCVDWSCNGYNVAT--GGGDGLIN 372

Query: 129 IYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
           I+D+R   + + + + +H++ I+D++F   DS  L+S S D   N+Y
Sbjct: 373 IWDIR--KTNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIY 417

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 69/145 (47%), Gaps = 17/145 (11%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L A A   +V++YDI++   + +AT  
Sbjct: 37  WEALTGVCSRTIQHSDSQVNRLEITND----KKLLAAAGYQNVRLYDIRTTNPNAVATFE 92

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             K +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 93  GHKGNVTSVSFQQDNKWMVTSSE----DGTIKVWDVRSPSVP-RNY--KHNAPVNEVVIH 145

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE 181
           P+    L+S   DG   ++DL + +
Sbjct: 146 PNQGE-LISCDRDGTIKIWDLGENQ 169

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L ATA   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITNDK----KLLATAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 29/171 (16%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATIT--NDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T  +D     LS+ S   MLA            Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANS----KGNCYVWEMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDD 184
               PV  F  +H   IT I    SD   L + S D    V+ +    EDD
Sbjct: 195 SHLKPVTKF-RAHSTYITRILL-SSDVKHLATCSADHTARVWSI----EDD 239

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 14/131 (10%)

Query: 54  DQVSINSMKLI-NNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHD 112
           D+  I ++KL  N +Y    L   +    ++IY + S   I ++        +  DS   
Sbjct: 59  DEQEITALKLTPNGEY----LCFVSQAQLLRIYKLSSKKIIRSMKVSSPVYVMDCDSSST 114

Query: 113 MLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSN---FLLSGSTD 169
           ++A G    G D  + + D+ N    V      H   I+ +KFH   S     L SG T 
Sbjct: 115 LVALG----GTDGSVTVVDIEN--GYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTS 168

Query: 170 GYTNVYDLTQQ 180
           G   V+DL ++
Sbjct: 169 GMVKVWDLVRR 179

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L ATA   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITND----KKLLATAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATIT--NDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T  +D     LS+ S   MLA            Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANS----KGNCYVWEMPNRTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  +H   IT I    SD   L + S D    V+ +
Sbjct: 195 SHLKPVTKF-RAHSTYITRILL-SSDVKHLATCSADHTARVWSI 236

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           ++  L T   +G V+L D      VR+F+     I  +K     +NN  L +T+  NS+K
Sbjct: 403 FDAALATGSRDGIVRLWDLRIGKIVRSFEKHNDEITGLK-----FNNKQLVSTSLDNSIK 457

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYD---VRNWSSPVK 140
           I+D+ +   I     D     +S++  +D + C    Q       IYD    +NW  P  
Sbjct: 458 IWDLGTGKIIDMFGYDHS--IISMNFANDKIVCALRDQ---KSFQIYDWKLSKNWQCPPL 512

Query: 141 SFVDSHHDDITDIKFHPSDSNF 162
             ++  +  I D K   S++N 
Sbjct: 513 QQMEDSNQIINDTKDDESNNNL 534

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 80/166 (48%), Gaps = 20/166 (12%)

Query: 23  LYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATL--- 79
           L +H +++   +  VKL D ++L    N  I+   +++     ++    SLF ++ +   
Sbjct: 305 LDDHLIVSGSKDATVKLWDTKSLADTTNSNINSPLLHTFSSHKDEITAISLFQSSLITTS 364

Query: 80  --NSVKIYDIKSNDCIATI-----TNDKKSPFL-SLDSRHDMLACGTELQGVDAELYIYD 131
              +++ +D+ +N  I TI      +   SP + +L      LA G+     D  + ++D
Sbjct: 365 LDKTIRHWDLNTNKNIQTIPLPSPVSVYTSPIINTLQCFDAALATGSR----DGIVRLWD 420

Query: 132 VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           +R     V+SF + H+D+IT +KF+      L+S S D    ++DL
Sbjct: 421 LR-IGKIVRSF-EKHNDEITGLKFNNKQ---LVSTSLDNSIKIWDL 461

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L ATA   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITND----KKLLATAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATIT--NDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T  +D     LS+ S   MLA            Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA----NTKGNCYVWEMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  +H   IT I    SD   L + S D    V+ +
Sbjct: 195 SHLKPVTKF-RAHSTYITRILL-SSDVKHLATCSADHTARVWSI 236

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L ATA   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITND----KKLLATAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMAS 169

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATIT--NDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T  +D     LS+ S   MLA            Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAA----NTKGNCYVWEMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  +H   IT I    SD   L + S D    V+ +
Sbjct: 195 SHLKPVTKF-RAHSTYITRILL-SSDVKHLATCSADHTARVWSI 236

>Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W
           (REAL)
          Length = 428

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 76/180 (42%), Gaps = 24/180 (13%)

Query: 95  TITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPV---KSFVDSHHDDIT 151
           TI N  ++  L      D LA G      +  L IYD+  +  P+    + + +H   IT
Sbjct: 22  TIENPLRTECLQFSPCGDYLALGC----ANGALVIYDMDTFR-PICVPGNMLGAHVRPIT 76

Query: 152 DIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWLSPRRIYTLSH 211
            I + P D  FLL+ S D +  ++DL+   +   L ++   + I  C WL  +    ++ 
Sbjct: 77  SIAWSP-DGRFLLTSSRDWFIKLWDLSVPSK--PLKEICFDSPIWGCQWLDAKNWLCVAT 133

Query: 212 M----ETFSISELNDRTDE-LREPQPLDFGDIRDQWNCDYVIDI-----YPGYIATGRSQ 261
           +    + + I   ND     L +P+ +  G   D     YV+       +P  I TG S+
Sbjct: 134 VFEESDAYVIDFSNDPVASLLSKPEDISLGSTPDH---GYVLVCTVHTKHPDIIITGTSK 190

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 10/111 (9%)

Query: 69  NNASLFATATLNSV-KIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ--GVDA 125
           ++ +L A+A L++V  I+D++S + I  +     +      S  D    G +L   G D 
Sbjct: 308 SDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAI-----SGVDWSPNGYQLATAGADG 362

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
            + ++D+RN  +  +S + +H     D+KF  ++  FL+S   D   N+++
Sbjct: 363 TVRVWDIRNVGT--ESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFN 411

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 3/74 (4%)

Query: 139 VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ--EEDDALYQVINYASIH 196
            KS   +H   I  + +HP D N LLSG  D    ++D+T    EE       ++   +H
Sbjct: 207 AKSIDAAHEGKIGGLDWHP-DGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVH 265

Query: 197 SCGWLSPRRIYTLS 210
             G L+    + L+
Sbjct: 266 PSGRLAASASFDLT 279

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 66/136 (48%), Gaps = 17/136 (12%)

Query: 58  INSMKLINNDYNNASLFATATLNS-VKIYDIKSNDCIATITNDKK--SPFLSLD-SRHDM 113
           +N  K  N D N   +F + + +S ++++D +  D   T T+  K  +PF +L  S+H  
Sbjct: 221 VNDCKWSNFDLN---VFGSVSEDSTLQLHDQREKD---TFTSQFKVDAPFNTLAFSKHSQ 274

Query: 114 LACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTN 173
                   G D+ +Y++D R+ S P+ S    H   +T+++F P     L++   D    
Sbjct: 275 YLFAA--AGTDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAI 331

Query: 174 VYDL----TQQEEDDA 185
           ++D+     +Q  DDA
Sbjct: 332 IWDICDIGVEQIPDDA 347

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 69/138 (50%), Gaps = 19/138 (13%)

Query: 37  VKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSV-KIYDIKSNDCIAT 95
           VK  D E    VR+F      ++S+ L    + +  L  +A  +SV +++DI+S  C+ T
Sbjct: 180 VKCWDLERNTVVRDFHGTLSGVHSVDL----HPSLDLIVSAGRDSVVRVWDIRSRSCVLT 235

Query: 96  ITNDK----KSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDIT 151
           +   +    K   L +D +  +++C T     DA + ++D+     P+K+    H  ++ 
Sbjct: 236 LAGHRGPINKVRCLPVDPQ--IVSCST-----DATVKLWDLVA-GKPMKTLT-HHKRNVR 286

Query: 152 DIKFHPSDSNFLLSGSTD 169
           D+ F+P++ +F  S  TD
Sbjct: 287 DLAFNPTEFSF-ASACTD 303

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G+V L    T   + + +   V+ N S++ I      +
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTES 343

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FA+   +  ++++D +S      I+    +  +++ S  +    +LA G +    +  
Sbjct: 344 TVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----NGT 399

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R +S       SPV  + D H   IT I F+P D + +   S D    ++DL+ 
Sbjct: 400 WGVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSV 458

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 459 EADDEEIKQ 467

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 76/165 (46%), Gaps = 13/165 (7%)

Query: 16  WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFA 75
           W ++F P+  H   T+  +   +L   + + P+R F      I+ +  +    N   +F 
Sbjct: 599 WDVQFSPV-GHYFATASHDQTARLWSCDHIFPLRIF---SGHISDVDCVTFHPNGCYIFT 654

Query: 76  TATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHD--MLACGTELQGVDAELYIYDVR 133
            ++  + +++DI + + +        +P LS+    D   LA G+E    D  ++I+D+ 
Sbjct: 655 GSSDKTCRMWDITTGESVRLFIGHT-APILSVAVAPDGLRLATGSE----DGVIHIWDIG 709

Query: 134 NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
              S +K  +      +  + ++  +SN L+SG +D    ++DLT
Sbjct: 710 TGKS-LKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDLT 752

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 9/124 (7%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           V+IYDI    CI T++         L   + +L  G+     D ++   DVR    P   
Sbjct: 315 VEIYDIVKRKCIRTLSGHMDR-VACLSWNNHILTSGSR----DRKILHRDVR-MPEPYFE 368

Query: 142 FVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWL 201
            V++H  ++  +K++ +D N L SG  D    VYD T ++    L +  + A++ +  W 
Sbjct: 369 QVETHTQEVCGLKWN-TDENRLASGGNDNVVYVYDGTSRKPTLKLAE--HTAAVKAIAWS 425

Query: 202 SPRR 205
             +R
Sbjct: 426 PHKR 429

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L A A   +V++YDI++   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLEITNDK----KLLAAAGHQNVRLYDIRTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +A  +E    D  + ++DVR  S P    +++    + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNKWMATSSE----DGTIKVWDVRAPSIPRNYKLNA---PVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG+  ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLAS 169

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 17/160 (10%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKI 84
           N  + TS  +G +K+ D    +  RN+K++   +N + +     N   L +      ++I
Sbjct: 87  NKWMATSSEDGTIKVWDVRAPSIPRNYKLN-APVNEVVI---HPNQGELISCDRDGHIRI 142

Query: 85  YDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-----S 137
           +D+  N C   +T +  +P   LSL S   ML             Y++++ N +      
Sbjct: 143 WDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANN----KGNCYVWEMPNRTDASNLK 198

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           PV  F  SH+  IT I    SD   L + S D    V+ +
Sbjct: 199 PVTKF-RSHNTYITRILL-SSDVKHLATCSADHTARVWSV 236

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 103 PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNF 162
           P     S   M A G    G D  +Y++D R+ SS    FV     DI+ ++F  SD N 
Sbjct: 227 PPAGTTSYDSMFASG----GSDGYVYLWDTRSPSSVQNFFVS--DSDISTVRFF-SDGNS 279

Query: 163 LLSGSTDGYTNVYDL 177
           +++GS DG   ++DL
Sbjct: 280 IITGSDDGIARLFDL 294

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 90/189 (47%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LL+   +G++ L    T   V + +   V  N S++ I      +
Sbjct: 277 EGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTES 336

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FATA  +  ++++D +S      I+    +  +++ S ++    +LA G +    +  
Sbjct: 337 TVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDD----NGS 392

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + + H   IT I F+P + + +  GS D    ++DL+ 
Sbjct: 393 WGVWDLRQFTPDNAANIQPVAQY-NFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSV 451

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 452 EADDEEIKQ 460

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL 164
           +SL+   ++LA G    G D    ++D+ N   PVK FV  H   +  I F P   + L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
           W+ + +I + P +I+   +  G G   +IP++ E  ++   + + R H+  V+   F P 
Sbjct: 35  WDSN-LIKVNPKFISVNWNSSGGGAFAVIPLN-EVGKAPDQVPLFRGHTAHVLDTDFDPF 92

Query: 302 NHHNVLYSCGEDGTVKSWKSPH 323
           N  N++ S  +DG +  W+ P 
Sbjct: 93  N-DNIIASGSDDGKIGIWEIPE 113

>KLLA0F09427g Chr6 complement(869664..871307) [1644 bp, 547 aa] {ON}
           weakly similar to uniprot|P25568 Saccharomyces
           cerevisiae YCL038C
          Length = 547

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFV 143
           IY I  +  I    N +K   L+L   H+    G  L+GV+   +   V N    + S V
Sbjct: 207 IYQITESSYIPVFMNARK---LALQDEHNSKQGGVMLRGVNVSTWGLVVGNIGGIIASLV 263

Query: 144 DSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
                 IT    HPS+ +FLL+ +  G+   +
Sbjct: 264 GV---IITHASSHPSNKDFLLAVTVAGFVTTF 292

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 73  LFATATLN-SVKIYDIKS-------------NDCIATITNDKKSP--FLSLDSRHDMLAC 116
           LFA+   + SV+++D++S              +   T+T+++KSP   L L         
Sbjct: 281 LFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNV 340

Query: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
                     + I D+RN  SPV + ++ H   +  IK+HP  SN LLS   D     +D
Sbjct: 341 MATFALDSKSILILDMRNPGSPVLT-LEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWD 399

Query: 177 LTQ 179
           L +
Sbjct: 400 LNE 402

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 78/165 (47%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDC--IATIT 97
           WE L  V  R  +     +N +++ N+      L A A   ++++YDIK+++   +A+  
Sbjct: 17  WEALTGVCLRTIQHPDSQVNRLEITNDK----KLLAAAGHQNIRLYDIKTSNSNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   +S    +  +   +E    D  + ++D+R+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSVSFQQDNKWMVTSSE----DGTIKVWDIRSPSVP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ AS
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVAS 169

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 24/140 (17%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVD--AELYIYDVRNWSSP 138
           +++I+D+  N C   +T +   P  SL    D    G+ L   +     Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDVPLQSLSVASD----GSMLVAANNKGNCYVWEMPNHTDA 194

Query: 139 VKSFVDSHHDDITDIKFHPS 158
                 S+    T  K HPS
Sbjct: 195 ------SNLKPATKFKAHPS 208

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 17/160 (10%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKI 84
           N  +++S  +G +K+ D    +  RN+K  Q ++N + +     N   L +     +V+I
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVI---HPNQGELISCDQDGNVRI 142

Query: 85  YDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-----S 137
           +D+  N C+  +  +  +P   LS+ S   ML  G          Y++ + + +      
Sbjct: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN----KGNCYVWQMPHQTDAANPK 198

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           PV  F  SH   IT +    SD   L + S D    V+ +
Sbjct: 199 PVTKF-RSHAKYITRVLL-SSDVKHLATCSADHTARVWSI 236

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 13/92 (14%)

Query: 82  VKIYDIKSNDCIATITNDK----KSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           V+I+DI+S  C+ T+   K    K+  L++D +  +++C T     DA + ++D+     
Sbjct: 223 VRIWDIRSRTCVMTLAGHKGPINKARCLAVDPQ--VVSCST-----DATVRLWDITA-GK 274

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD 169
            +K+    H  ++ DI F+P++ +F  + + D
Sbjct: 275 TIKTLT-HHKRNVRDITFNPAEFSFTTACTDD 305

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P++H+   +SCG+DG +K W
Sbjct: 608 AHQDAIMNVKFVPQSHN--FFSCGKDGVIKYW 637

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 9/101 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           +KI+D+++   +    +   +  FL  D     L  G+     D+ + I+D+       K
Sbjct: 100 IKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSR----DSNIIIWDLVGEVGLCK 155

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
             + SH D IT I F   D  +L+S S DG   V+D+  Q+
Sbjct: 156 --LRSHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQ 192

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL---- 177
           G    +Y+YD+RN    + S    H + +T ++F       L+SGS+D    ++DL    
Sbjct: 261 GTTNNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIG 319

Query: 178 -TQQ--EEDDALYQVI 190
             QQ  E DD L +V+
Sbjct: 320 AEQQPDEADDGLPEVM 335

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 11/84 (13%)

Query: 124 DAELYIYDV-RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +  ++IYD  R+  S + S +  H D+   + F+P+    L+SGS D    ++D T    
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDAT---- 182

Query: 183 DDALYQVIN-YASIHS-----CGW 200
           +D L Q I  + + HS     C W
Sbjct: 183 NDKLKQPIQEWTTSHSDIVNDCQW 206

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   IT ++      LS+ S   MLA   +        YI+++ N +  
Sbjct: 139 NIRIWDLGENQCTHQITPEEDVSLESLSIASDGSMLAAAND----RGNCYIWEMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PVK+F  S H+         SD   L + S D    ++ +
Sbjct: 195 SNLKPVKTF--SAHETYVTRVLLSSDVKHLATCSADQSARIWSV 236

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 17/145 (11%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N +++ N+      L A A   +VK+YDI +   + + +  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLQITNDK----KLLAAAGHLNVKLYDINTTNPNPVGSFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             K +   +S    +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHKGNVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSVP-RNY--KHNAPVNEVVIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE 181
           P+    L+S   DG   ++DL + +
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQ 149

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           RN S  ++  +  H   ITDI FHP+    L + S D Y + +D+
Sbjct: 100 RNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 75/166 (45%), Gaps = 12/166 (7%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDY--NNASLF 74
           C+ F P+ N+ L+  L N E+K  D  T +  +N  I     ++  +I   +  N +   
Sbjct: 268 CVTFHPINNYELVVGLLNSEIKHYD--TRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFI 325

Query: 75  ATATLNSVKIYDIKSNDCIATITNDKKS--PFLSLDSRHDMLACGTELQGVDAELYIYDV 132
           +++   +++I+D + N  I  I++  +   P++ +   H+  A     Q +D  + +Y +
Sbjct: 326 SSSEDKTIRIWDNQINIPIKQISDTAQHSMPWIEIHPEHNYFAT----QSMDNSIGVYSM 381

Query: 133 RNWSSPVKSFV-DSHHDDITDIKFHPS-DSNFLLSGSTDGYTNVYD 176
           +         +   HH     I+F  S D  ++ SG + G   ++D
Sbjct: 382 KPKYKKHTKKIFKGHHSAGYGIRFDISPDGRYIASGDSMGRLFIWD 427

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 24/165 (14%)

Query: 42  WETLNPV--RNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSN--DCIATIT 97
           WE L  V  R  +     +N + + N+      L A A   +VK+YDI +   + +A+  
Sbjct: 17  WEALTGVCSRTIQHSDSQVNRLTITNDK----KLLAAAGHQNVKLYDINTTNPNPVASFE 72

Query: 98  NDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFH 156
             + +   LS  + +  +   +E    D  + ++DVR+ S P +++   H+  + ++  H
Sbjct: 73  GHRGNVTSLSFQNDNRWMVTSSE----DGTIKVWDVRSPSVP-RTY--KHNAPVNEVAIH 125

Query: 157 PSDSNFLLSGSTDGYTNVYDLTQQE-------EDDALYQVINYAS 194
           P+    L+S   DG   ++DL + +       EDD   Q ++ A+
Sbjct: 126 PNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLAT 169

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  R +K    +++V+I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAE--LYIYDVRNWS-- 136
           +++I+D+  N C   +T +  +P  SL    D    G+ L   +++   Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTPVQSLSLATD----GSMLVAANSKGNCYVWEMPNRTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  +H   IT I    SD  FL + S D    ++ +
Sbjct: 195 SNLKPVTKF-RAHDAYITRILL-SSDVKFLATCSADHTARIWSI 236

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL 164
           +SL+    +LA G    G D    ++D+ N   PVK FV  H   +  I F P   + L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 9/96 (9%)

Query: 82  VKIYDIKSNDCIATITNDK-KSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           ++IYD+    CI T++    ++  LS +S   +L  G+     D  +   DVR    P  
Sbjct: 492 IEIYDVTKRKCIRTLSGHTDRTACLSWNSH--ILTSGSR----DRTILHRDVR-MKDPFF 544

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
             + SH  ++  +K++ SD N L+SG  D   N+YD
Sbjct: 545 ERIKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYD 579

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINY 192
           R+ S+ V+  +  H   ITDI FHP++   L + S D Y + +D+       A Y     
Sbjct: 100 RSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRR--AFYS---- 153

Query: 193 ASIHSCG 199
           AS+ S G
Sbjct: 154 ASVWSAG 160

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 87/189 (46%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G V L    T   + +        N S++ I      A
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 345

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FA+   +  ++I+D +S      I+    +  +++ S ++    +LA G +    +  
Sbjct: 346 TVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDD----NGS 401

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R +S       SPV  + + H   IT I F+P D + +   S D   +++DL+ 
Sbjct: 402 WGVWDLRQFSPNTAASTSPVAQY-NFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSV 460

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 461 EADDEEIKQ 469

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 82  VKIYDIKSNDCIAT-ITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           V+I+D+    CI T + +  +   LS +S   +L  G+     D  +   DVR+   P  
Sbjct: 327 VEIFDVNKKKCIRTMLGHSDRVACLSWNSY--ILTSGSR----DHNILHRDVRS-PDPFF 379

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGW 200
             ++SH  ++  +K++  D N L+SG  D   NVYD T  +    + +  + A++ +  W
Sbjct: 380 EKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYDRTSTKPFMTMTE--HKAAVKALDW 436

Query: 201 LSPRR 205
            S +R
Sbjct: 437 SSHKR 441

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 73/164 (44%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  ++TS  +G +K+ D  + +  RN+K    +++V I+         N   L +     
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAE--LYIYDVRNWS-- 136
           +++I+D+  N C   +T +  +P  SL    D    G+ L   +++   Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDNTPLQSLSVASD----GSMLVAANSKGNCYVWEMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  +H + IT I    SD   L + S D     + L
Sbjct: 195 SNLKPVTKF-KAHSNYITRILL-SSDVKHLATCSADKTARTWSL 236

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 9/118 (7%)

Query: 69  NNASLFATATLNSVKIYDIKSNDCIATI--TNDKKSPFLSLDSRHDMLACGTELQGVDAE 126
           + ASL A +    VKI   +S + + ++   +D K   ++  S   +LA G    G D  
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATG----GADNL 248

Query: 127 LYIYD--VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           + I++   ++ S   +  +  H   ++ +KFHPSD  F+ S S D    ++D+ ++ E
Sbjct: 249 VKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSD-RFVASASFDMTWRLWDVERETE 305

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWSS---PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    + IYD+   ++   P+ + +  H   I  + F+ + S+ L+SGS DG   V+DL
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDL 243

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +++I+D+R+ S+P+      H+  +  I F   + N ++S S DG    +DL+++E+
Sbjct: 182 DVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G D   YI+DVR+ +S V+SF  S+ D +  +KF   D N +++GS DG   ++DL
Sbjct: 245 GSDGYTYIWDVRSAAS-VQSFFVSNSD-VNTVKFFK-DGNSIVTGSDDGTLRMFDL 297

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 69  NNASLFATATLNSVK-IYDIKSNDCIATITNDKKSPFLSLD---SRHDMLACGTELQGVD 124
            + SL  +  L+SV  ++D++S   I  +    K P   LD   + +D +A G+     D
Sbjct: 321 KDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIK-PIYGLDWSPNGYD-IATGS----AD 374

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVY 175
             + ++DVR     +   + +H+  ++++KF  ++ ++L+S S D   N+Y
Sbjct: 375 GTIRLWDVRK--VGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 64/160 (40%), Gaps = 16/160 (10%)

Query: 23  LYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSV 82
           LY   L  SL   E+      +  PV    I   S +SM    +   +  + +T TL  +
Sbjct: 160 LYRRELNKSLKKFELSGSQLVSSRPVSQVAIS--SDDSMVATCSWGGDLKILSTETLEII 217

Query: 83  KIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSF 142
           K +D   +  I  +           D   D  A  T     + E+ I+++ N S      
Sbjct: 218 KAFDTAHDSKIGGV-----------DWNPDGTALVT--GAANGEIRIWNLNNDSESPAGT 264

Query: 143 VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +  H + +  ++FHPS   ++ S S D    ++D+ +Q E
Sbjct: 265 LTGHENRVARVRFHPS-GKYVASASFDMTWRLWDVEKQIE 303

>TDEL0B05810 Chr2 complement(1025990..1029658) [3669 bp, 1222 aa] {ON}
            
          Length = 1222

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 10/117 (8%)

Query: 27   GLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYD 86
            GL+  +      LLD +T   +R+F ID+   NS+++ ++   +     +A++ S  I  
Sbjct: 950  GLIVRVIGKTADLLDAQTGTVIRSFAIDRFKPNSLRVFHDSPVHCKFCGSASVASFSI-- 1007

Query: 87   IKSNDCIATIT--------NDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNW 135
              SN+    +T          K S  L ++     + C      +D   YIYDV +W
Sbjct: 1008 AYSNEECERVTMHTYKLESKTKTSICLRVERDLREIRCLGMESAIDTVHYIYDVEDW 1064

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 104 FLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFL 163
            +S D+  D +  G        ++ +YD   W S + S V +H  D+T +K  PS++  L
Sbjct: 104 LISCDASTDKIVIGDS----GGDINVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VL 156

Query: 164 LSGSTDGYTNVYDL 177
           LSGSTD    V+ L
Sbjct: 157 LSGSTDMQLKVWSL 170

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWSS---PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    + +YD+   S+   P+ + +  H   I  + F+ S +N L+SG  DG   V+DL
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDL 259

>ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1525

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 74/171 (43%), Gaps = 16/171 (9%)

Query: 18   LKFQPLYNHGLLTSLSNGEVKLLDWE---TLNPVRNFKIDQVSINSMKLINNDYNNASLF 74
            L+F    NH L++     EV + DW+   TL+   N       +  +K +N D + A L 
Sbjct: 1186 LRFAQFENH-LVSVDERDEVTVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNED-DAALLL 1243

Query: 75   ATATLNSVKIY-DIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELY----I 129
            A ++   VKIY +I SND +  I+  +    + L  R   L   TE Q +   L     +
Sbjct: 1244 AGSSDGIVKIYKNIHSNDDLELISAWRGLTDMLLTPRSSGLL--TEWQQIRGSLLTTGDV 1301

Query: 130  YDVRNWSSPVKSF-VDSHHDD---ITDIKFHPSDSNFLLSGSTDGYTNVYD 176
              +R W +  ++  VD        IT I       N +++G  DG   VYD
Sbjct: 1302 KIIRAWDAHTETVEVDIPAKTSSLITSITSDQLAGNLVVAGFADGSLRVYD 1352

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           ++ I D+RN  SP+   ++ H   +  IK+HP   N LLSG  D     +DL +
Sbjct: 354 KILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNK 406

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 13/159 (8%)

Query: 21  QPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLN 80
           +PL+  G        +++L D     P+ N      +I S+K   N      + +  + N
Sbjct: 191 KPLFVTG------GAKIELWDNNRSTPLTNLSWGADNITSLKF--NQSETDIVASAGSDN 242

Query: 81  SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           SV +YD+++N     I    ++  +  +    M      +   D   Y YD+RN S  + 
Sbjct: 243 SVVLYDLRTNSPTQKIVQSMRTNAICWNP---MEPFNFVVANEDHNAYYYDMRNMSRSLN 299

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
            F D H   + D+ F P+  + +++GS D    ++   Q
Sbjct: 300 VFKD-HVSAVMDVDFSPT-GDEIVTGSYDKTIRIFKTNQ 336

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183
           +Y++DVR  +SP+ S ++ H   +  I F+P +   ++S   DG    +D  + E++
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           R+ S  V+  +  H   ITDI FHP     L + S D Y   +D+
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDM 144

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 14/131 (10%)

Query: 82  VKIYDIKSNDCIATITN--DKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPV 139
           VKI+D++   CI TI    D+      L   + +L  G+     D  +   DVR    P 
Sbjct: 316 VKIFDVEKKRCIRTIPGHIDR---VACLSWNNHILTSGSR----DRRILHRDVRT-PEPC 367

Query: 140 KSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCG 199
              + +H  ++  +K++  D N L SG  D    VYD T ++    L +  + A++ +  
Sbjct: 368 FEEIRTHKQEVCGLKWN-VDENQLASGGNDNVVFVYDGTSRKPILTLAE--HTAAVKAMA 424

Query: 200 WLSPRRIYTLS 210
           W SP R   L+
Sbjct: 425 W-SPHRRGVLA 434

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G D   YI+D+R   S    FV +   D+  ++F   D N + +GS DG  N+YDL
Sbjct: 247 GSDGYTYIWDIRTPGSVQNFFVSNR--DVNTLQFF-KDGNSIATGSDDGMVNLYDL 299

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 12/106 (11%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +KIY+I     + ++     S  +S+D    +LA G    G D  + + D+ N  S +  
Sbjct: 85  LKIYNIVEKKFVKSLKISSPSYVMSIDQTSTLLAVG----GTDGSVTVIDIEN--SYITH 138

Query: 142 FVDSHHDDITDIKFHPSDSN------FLLSGSTDGYTNVYDLTQQE 181
               H   I+ +KF+   S        L SG T G   V D+ ++ 
Sbjct: 139 SFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRR 184

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 20/122 (16%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLAC------GTELQGV--DAELYIYD 131
           N +K +D +S  C++T+          L  +H +++       G  L  +  D    +YD
Sbjct: 229 NLIKFWDPRSGSCVSTM----------LGFKHTIISTKFQPKQGNLLSVISKDKTCKVYD 278

Query: 132 VRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVIN 191
           +R  +  + S  D    D   +++HP D      G  DG    +DL+Q+ + +     I 
Sbjct: 279 IRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIP 336

Query: 192 YA 193
           YA
Sbjct: 337 YA 338

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 134 NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDAL 186
           N ++ +K+FV  H D +T ++FHP D  F  SG  D     + + + E  +A 
Sbjct: 243 NRTTSLKTFV--HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAF 293

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 55/122 (45%), Gaps = 10/122 (8%)

Query: 74  FATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAE--LYIYD 131
           FA  +   V+I+  K+   + T +  K   + S   R+D    G  L   DA   + +YD
Sbjct: 55  FAVTSSTRVQIFSSKTRQVVKTFSRFKDVVY-SASFRND----GKLLVAGDATGLVSVYD 109

Query: 132 VRNWSSPVKSF-VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVI 190
             N  S + S    +H   +T  KFHP D+  L++ S D  T ++D++   E   L    
Sbjct: 110 AYNPRSILLSINASTHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAYEAQELTGAS 167

Query: 191 NY 192
           +Y
Sbjct: 168 DY 169

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 9/103 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +KI+ + S     ++     S  +  DS   ++A G    G D  + + DV N    +  
Sbjct: 84  LKIFSLDSMKITRSMKISSPSYVMDSDSTSTLIAIG----GTDGSISVVDVEN--GYITH 137

Query: 142 FVDSHHDDITDIKFHP---SDSNFLLSGSTDGYTNVYDLTQQE 181
               H   I+ +KFH     D   L SG T+G   V+DL ++ 
Sbjct: 138 SFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKRR 180

>KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}
           Anc_2.663 YKL021C
          Length = 389

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 59/317 (18%), Positives = 124/317 (39%), Gaps = 52/317 (16%)

Query: 45  LNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKS-- 102
             P+ +F+   +S+  +     D +   L + +    ++IYD++    + T+   + S  
Sbjct: 32  FTPIFHFQAHALSVKCL-----DVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSIT 86

Query: 103 --PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDS 160
              F S +S    +   +E    D ++ I+ V++W +     +  H   + DI  HPS S
Sbjct: 87  ALKFSSGESNGKWMLSSSE----DNKIIIWRVKDWEN--YGVLKGHLKRVNDIAIHPS-S 139

Query: 161 NFLLSGSTDGYTNVYDLTQQEEDDALY--------QVINY---ASIHSCGWLSPRRIYTL 209
              +S S D    +++L   ++   L         Q + +       +   ++   I++ 
Sbjct: 140 RVAVSVSDDHSIRLWNLMTMKKAAVLKLRKYDQNGQFVRWTDNGDHFAVALMTKLLIFST 199

Query: 210 SHMETFSISELNDRTDELREPQPLDFGDIRDQWNCDYVIDIYPGYIATGRSQEGNGNLQI 269
           ++ +     +++ +T  +   + +  GD   +            Y+  G S   +GN+Q 
Sbjct: 200 ANAKVHFEVDISKKT--IMHLETVKLGDEDRE------------YLVVGLS---DGNVQF 242

Query: 270 IPMDGETVESSKAITIDR----AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSWKSPHSQ 325
            P+D E ++    IT        HS+ +    F P +    L + G DG +  W      
Sbjct: 243 YPVD-ELIKEEPTITEPEFSLLGHSNRIKDFKFYPNDFGTYLITIGSDGRIVVWDMKTKD 301

Query: 326 STALEEFWDYSQRFNVF 342
             A+   +D  +R N  
Sbjct: 302 QVAV---YDCGERLNCL 315

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 9/102 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +++Y +K    I ++        ++ D    +LA G    G D  + + D+ N    V  
Sbjct: 84  LRVYSLKQERIIRSMKISSPVYVMNCDQTSTLLAIG----GTDGSVSVIDIEN--GYVTH 137

Query: 142 FVDSHHDDITDIKFHP---SDSNFLLSGSTDGYTNVYDLTQQ 180
            +  H   I+ +KFH    S+   L SG T+G   V+DL ++
Sbjct: 138 SLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKR 179

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH+D +++ VF+P +H+   +SC +D  VK W
Sbjct: 607 AHNDSIMKVVFVPESHN--FFSCSKDALVKYW 636

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 73  LFATATLNSVKIYDIKSNDCIATITND--KKSPFLSLDSRHDMLACGTELQGVDAELYIY 130
           L ATA+  ++KI++IK+N CI T          FL   +   ++  GT+      +L++Y
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGA---LVVLGTK----TGDLHLY 451

Query: 131 DVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           D+ + S+ + +   +H   I  +    +D   L++GS D     +D   ++E
Sbjct: 452 DLAS-STLLNTIEGAHSGAIWSLDM-TTDGKRLVTGSADKTVCFWDFQVEQE 501

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 80  NSVKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSP 138
            ++KI+D+ S   + +    K +   L+ D     L  G+     D+++ ++D+      
Sbjct: 97  GAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSR----DSDIIVWDLVGEVGL 152

Query: 139 VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
            K  + SH D IT +     +  +L+S S DG   V+DL  Q+
Sbjct: 153 YK--LRSHKDSITGLWCEGEE--WLISTSKDGLIKVWDLKVQQ 191

>KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa]
           {ON} Anc_5.631 YDR267C
          Length = 355

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 79/370 (21%), Positives = 154/370 (41%), Gaps = 74/370 (20%)

Query: 1   MSYSLVQEQSF-GSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKI-----D 54
           M+ SL++         W L F P  N  L  +  + ++KL++ E+L   + FK+     D
Sbjct: 1   MAISLIRSLKLQNGKTWALDFTPQGNK-LAIASEDHKIKLVEIESLEK-KQFKLVNVLDD 58

Query: 55  QVSINSMKLIN-NDYNNASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRH- 111
            V   +++ +    ++N    A  + ++ V I+   +ND      +D       L++   
Sbjct: 59  TVHKKAVRTVAWRPHSNPPCLAAGSFDTTVSIWSFANNDNAIEDDDDDDDAGAGLEANEM 118

Query: 112 DMLAC----GTELQGV--------------DAELYIYDVRNWSSPVK--SFVDSHHDDIT 151
           D++A       E++G+              D  ++I++        +  S +  H  D+ 
Sbjct: 119 DLMAIIEGHENEIKGIAWSHDGMFLATCSRDKSVWIWETDEMGEDFECVSVLQEHSQDVK 178

Query: 152 DIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIH-SCGWLSPRRIYTLS 210
           D+ +HPS   +LL+ S+  Y +   +  + +DD  ++ +   + H    W S    +   
Sbjct: 179 DVTWHPS--KYLLASSS--YDDSVRIWSEFDDD--WECVAVLNGHEGTVWCSD---FAKD 229

Query: 211 HMETFSISELND----RTDELREPQPLDFGDIRDQWNCDYVI------DIYP------GY 254
           + E   +   +D    R  +  E +P    D + QW C+ V+       IY       G 
Sbjct: 230 NSEETRLCSASDDSTVRVWKCVEEEP----DGQQQWICESVLPKAHERQIYSVSWSDDGL 285

Query: 255 IATGRSQEGNGNLQI----IPMDGETVESSKAITIDRAHSDEVIRDV-FIPRNHHNVLYS 309
           IA+  S   +G++ +     P   E VE+ K      AH+   + ++ +I  N  N+L +
Sbjct: 286 IASTGS---DGSIVVYKESAPAVWEVVETRKL-----AHTVYEVNEIKWIKVNGRNILVT 337

Query: 310 CGEDGTVKSW 319
            G+DG +  W
Sbjct: 338 AGDDGCINVW 347

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DGTVK W
Sbjct: 607 AHQDSIMNVKFLPESHN--FFSCSKDGTVKYW 636

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPV 139
           N+VK++ + S     ++    K P LS+D  HD     T     D  + I+ + ++    
Sbjct: 547 NTVKVFFLDSMKFFLSLYG-HKLPVLSMDISHDSKLIIT--SSADKNIKIWGL-DFGDCH 602

Query: 140 KSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           KS   +H D I ++KF P   NF  S S DG    +D
Sbjct: 603 KSLF-AHQDSIMNVKFLPESHNF-FSCSKDGTVKYWD 637

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 122 GVDA-ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD 169
           G D+  + I D+RN  +PV + +D H   I  IK+HP+  N +LS S D
Sbjct: 385 GADSNSVLILDMRNPGTPVLT-LDGHSAPINQIKWHPTKKNTILSSSDD 432

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 88/189 (46%), Gaps = 19/189 (10%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + PL   G LLT   +G++ L    T   V + +   V  N S++ I      A
Sbjct: 280 EGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEA 339

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDAE 126
           ++FA+   +  V+I+D +S      ++    +  +++ S ++    +LA G +    +  
Sbjct: 340 TVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDD----NGS 395

Query: 127 LYIYDVRNWS-------SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             ++D+R ++        PV  + D H   IT I F+P + + +   S D    ++DL+ 
Sbjct: 396 WGVWDLRQFTPDNINNVQPVAQY-DFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSV 454

Query: 180 QEEDDALYQ 188
           + +D+ + Q
Sbjct: 455 EADDEEIKQ 463

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 102 SPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSN 161
           SP  + +  +   +CG+     D  +Y++DVR  S     FV     DI  ++F   D N
Sbjct: 241 SPSSAENGTNTFASCGS-----DGYIYLWDVRTGSVAQTFFV--SDSDINAVQFFK-DGN 292

Query: 162 FLLSGSTDGYTNVYDL 177
            L SGS DG   ++DL
Sbjct: 293 ALASGSDDGIIRLFDL 308

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 28/128 (21%)

Query: 73  LFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDA------ 125
           LFA+   + SV+++D++S      I     SP     S  +  A    L+G DA      
Sbjct: 302 LFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPA----SGPNAGATTPSLKGSDALLRLEP 357

Query: 126 ----------------ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTD 169
                           ++ I D+RN  SP+ + ++ H   + +IK+HP+  N LLS S D
Sbjct: 358 SPYDPNVLATFAADSNKIIILDMRNPESPILN-LEGHTCSVNEIKWHPTKRNVLLSCSDD 416

Query: 170 GYTNVYDL 177
                +DL
Sbjct: 417 CQALYWDL 424

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 69/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  +++S  +G +K+ D    +  RN+K    +++V I+         N   L +     
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHP--------NQGELISCDQDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T +  +P   LS+ S   ML  G          Y++ + N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNN----KGNCYVWQMPNHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  SH   IT +    SD   L + S D    V+ +
Sbjct: 195 ANLKPVTKF-RSHTKYITRVLL-SSDVKHLATCSADHTARVWSI 236

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           +++ I D+R+  SP+ + +++H   I  IK+HP+  N LLS S D     +DL
Sbjct: 335 SKVLILDMRSPGSPLLT-LEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           ++ I D+RN  SP+ + ++ H   + +IK+HP+  N LLS   D     +DL
Sbjct: 374 KIIILDMRNPESPILN-LEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 75/197 (38%), Gaps = 38/197 (19%)

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +D    ++D+++ S  VK+ + +H  ++ D++F    +    S   DG   V+DL     
Sbjct: 264 IDTTCIVWDLQS-SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAH 322

Query: 183 DDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRDQW 242
              +Y+    ++              L+   T   S+ +D    L EP P D        
Sbjct: 323 STIIYEPPASSAP------------GLNADTTTPASKGSDALLRL-EPSPYD-------- 361

Query: 243 NCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRN 302
                    P  +AT  ++      +II +D    ES   I     HS  V    + P  
Sbjct: 362 ---------PNVLATFAAESN----KIIILDMRNPES--PILNLEGHSSSVNEIKWHP-T 405

Query: 303 HHNVLYSCGEDGTVKSW 319
             NVL SCG+D  V  W
Sbjct: 406 KRNVLLSCGDDCQVLYW 422

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 4   SLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKL 63
           +LV  +      W +KF PL  H   T+  +   +L   + + P+R F      +N +  
Sbjct: 585 ALVSYKGHNHPVWDVKFSPL-GHYFATASHDHTARLWSCDHIYPLRIF---AGHLNDVDC 640

Query: 64  INNDYNNASLFATATLNSVKIYDIKSNDCIA---TITNDKKSPFLSLDSRHDMLACGTEL 120
           ++   N   LF  ++  + +++DI + DC+     +T    S  +S D R   L+ G+E 
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGR--WLSTGSE- 697

Query: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
              D  + ++D+      +K       + I  + +   + N L+SG  D    V+DL +
Sbjct: 698 ---DGIINVWDIGTGKR-LKQMRGHGKNAIYSLAYC-KEGNALISGGADHSVRVWDLKK 751

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 64  INNDYNNASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQG 122
           IN    +  + AT ++++ V  +D++S       T+  KS    +   H  +       G
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVNIMASSHG 179

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
            D  ++I+D+RN S+P+   + SH   +  I F+   S  ++S S DG    +D ++  E
Sbjct: 180 DD--VFIWDLRNGSTPLFK-LSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYSRNVE 236

Query: 183 D 183
           D
Sbjct: 237 D 237

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 106 SLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLS 165
           S+ S    LA GT+    D  + ++D+R  +  V   ++ H D IT +KF   D+  ++S
Sbjct: 569 SIQSFDAALATGTK----DGLIRLWDMR--TGEVVRVLEGHMDAITSLKF---DATTIIS 619

Query: 166 GSTDGYTNVYDL 177
           GS DG   ++DL
Sbjct: 620 GSLDGTIRLWDL 631

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           ++  L T   +G ++L D  T   VR  +    +I S+K     ++  ++ + +   +++
Sbjct: 573 FDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLK-----FDATTIISGSLDGTIR 627

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRHDMLAC 116
           ++D++SN+    I+ +K    L  D++H ++A 
Sbjct: 628 LWDLRSNNLTDIISYEKPISSLDFDAKHIVVAS 660

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 6/110 (5%)

Query: 74  FATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVR 133
           FA  +   V+++  ++   I T +  K   + +       L C  +  G+   + +YD  
Sbjct: 55  FAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSY 111

Query: 134 NWSSPVKSF-VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           N  + + S    +H   +T  KFH  DS  L++ S D  T V+D++Q  E
Sbjct: 112 NPRALLVSINASTHPTHVT--KFHSHDSKSLVTASDDRITRVWDISQSYE 159

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 50/101 (49%), Gaps = 9/101 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           +KI+D+ S   + +    K +   L+ D+    L   ++    D+++ ++D+   S   K
Sbjct: 103 IKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASK----DSDIIVWDLVGESGLYK 158

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
             + SH D IT +     D N+L+S S DG   ++DL  Q+
Sbjct: 159 --LRSHKDAITGL--WCEDENWLISTSKDGLVKIWDLKSQQ 195

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +++   +SC +D TVK W
Sbjct: 610 AHQDSIMNVKFLPESYN--FFSCSKDATVKYW 639

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 68/160 (42%), Gaps = 17/160 (10%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKI 84
           N  +++S  +G +K+ D    +  RN+K    ++N + +     N   L +     ++KI
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-HHAAVNEVVI---HPNQGELISCDQDGNIKI 142

Query: 85  YDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-----S 137
           +D+  N C+  +  +  +P   LS+ S   ML  G          Y++ + + +      
Sbjct: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNN----KGNCYVWQMPHQTDAANPR 198

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           PV  F  SH   IT +    SD   L + S D    V+ +
Sbjct: 199 PVTKF-RSHAKYITRVLL-SSDVKHLATCSADHTARVWSI 236

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  +++S  +G +K+ D  + +  RN+K    +++V+I+         N   L +     
Sbjct: 87  NRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVAIHP--------NQGELISCDQDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T +  +P   LS+ S   ML  G          Y++ + + +  
Sbjct: 139 NIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNN----KGNCYVWKMPHHTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  SH   IT +    +D   L + S D    V+++
Sbjct: 195 STLEPVTKF-KSHTKYITRVLL-SADVKHLATCSADHTARVWNI 236

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSL--DSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           N +K++D +S  C++T+ N K +   +    ++ ++LA  ++    D    ++D+R    
Sbjct: 234 NLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISK----DKSCRVFDIRYHMK 289

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYA 193
            +    D    D   + +HP++ +     S DG    +D+ Q  E+    QVI YA
Sbjct: 290 ELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQ--QVIPYA 341

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  +++S  +G +K+ D    +  RN+K    +++V I+         N   L +     
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHP--------NQGELISCDRDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           +++I+D+  N C   +T +  +P   LSL S   ML             Y++++ N +  
Sbjct: 139 NIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANS----KGNCYVWEMPNRTDA 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  SH   IT I    SD   L + S D    V+ +
Sbjct: 195 SNLKPVTKF-RSHATYITRILL-SSDVKHLATCSADHTARVWSI 236

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSL--DSRHDMLACGTELQGVDAELYIYDVRNWSS 137
           N VK++D +S  CI+TI   K +   +    +R ++LA  ++    D    ++D+R+   
Sbjct: 238 NLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISK----DKSCRVFDIRHSMK 293

Query: 138 PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYA 193
            +    D    D   + ++P + +    G+ DG    +DL Q  E  +   VI YA
Sbjct: 294 ELMCVRD--EVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPS--HVIPYA 345

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 4/109 (3%)

Query: 74  FATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVR 133
           FA  +   V+++  ++   I T +  K   + +   +   L C  +  G+   + +YD  
Sbjct: 55  FAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYDSY 111

Query: 134 NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           N  + + S   S H      KFH  D   L+S S D  T V+D++   E
Sbjct: 112 NPRTLLVSVAASQHPTHV-TKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 76  TATLNSVKIYDIKSNDCIATITND-------------KKSPFLSLDSRHDMLACGTELQG 122
           T+ L +V I+DIK+ D +AT+++               +  +L +    D+LA G     
Sbjct: 43  TSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGY---- 98

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            D  + ++D+   S  V    + H   IT ++F  + +  L+SGS D    V+DL  +
Sbjct: 99  ADGVIKVWDLM--SKTVLLNFNGHKAAITLLQFDSTGTR-LISGSRDSNIIVWDLVGE 153

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +D  VK W
Sbjct: 613 AHQDSIMSVKFLPESHN--FFSCSKDAVVKYW 642

>NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 88/220 (40%), Gaps = 19/220 (8%)

Query: 95  TITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIK 154
           T+ N  ++  L      + LA G      D  +Y  D    S  + S   +H   I  I 
Sbjct: 22  TLENPLRTECLQFSPCGNYLALGCSTG--DVVIYDMDTFRPSCILGSKFGAHTRIIQSIS 79

Query: 155 FHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWLSPRRIYTL----- 209
           + P D  +LL+GS D    V+DL  Q  +  L ++   + I +C W +   +  +     
Sbjct: 80  WSP-DGRYLLTGSGDWIVKVWDL--QSPEQPLNELAFDSPIWNCQWFNVESLLCIVTTFE 136

Query: 210 ---SHMETFSISELNDRTDELREPQPLDFGDIRDQWNCDYVIDIYPGYIATGRSQEGNGN 266
              +++  F   +   R  +  +   +D G +     C+ V    P  I TG S+     
Sbjct: 137 ENCAYLVDFKGQKSVSRAIDTLDTNEVDRGYVL---TCN-VCTKNPNIIITGTSKGWVDF 192

Query: 267 LQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRNHHNV 306
           +QII       E +    +  A+S+  I+DV I +N   +
Sbjct: 193 IQIITTSPSAYEFNLLHAVKIANSN--IKDVIISQNGDRI 230

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL 164
           +SL+   ++LA G    G D    ++D+ +   P+K FV  H   +  I F P   + L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           ++ I D+RN  +PV + +  H   +  IK+HP++ N LLS + D     +DL
Sbjct: 372 KIIILDMRNPETPVLT-LQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 77/184 (41%), Gaps = 47/184 (25%)

Query: 68  YNNASLFATATLNSVKIYDIKSNDCIAT----------------ITNDKKSPFL------ 105
           Y+N +L   +   ++K +D+ +  C+ T                 +  KK+ F       
Sbjct: 463 YDNFNLLTGSQDKTIKHWDLITGKCVQTFDVSFYLNNSPPFENKFSPTKKNYFAHSEAPT 522

Query: 106 --SLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFL 163
             SL      LA GT+    D  + ++D+R  S  V   ++ H D IT +KF   D   L
Sbjct: 523 IGSLQCFESALASGTK----DGLIRLWDLR--SGKVIRILEGHTDAITSLKF---DMTNL 573

Query: 164 LSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDR 223
           ++GS D    ++D+             N++ ++S G+ SP  +++L       +S    +
Sbjct: 574 ITGSLDKNIRIWDMR------------NWSLVNSYGYQSP--VWSLDFNSANVVSATGGK 619

Query: 224 TDEL 227
           T E+
Sbjct: 620 TSEI 623

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 10/116 (8%)

Query: 68  YNNASLFATATLNSV-KIYDIKSNDCIATITNDKKSPF-LSLDSRHDMLACGTELQGVDA 125
           Y++ SL A    + V KI+D+ S   + +    + +   L  DS    L  G+     D+
Sbjct: 86  YSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRSAVTQLLFDSTGTRLISGSR----DS 141

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
            + ++D+ +     K  + SH D IT +     D N+L+S S DG   ++DL  Q+
Sbjct: 142 NIIVWDLVSEVGLYK--LRSHKDSITGLSL--PDENWLMSVSKDGLIKLWDLKIQQ 193

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +D TVK W
Sbjct: 609 AHQDSIMNVKFLPESHN--FFSCSKDATVKYW 638

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 81/198 (40%), Gaps = 34/198 (17%)

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +D    ++D+++ S+ VK+ + +H  ++ D+KF  + +    S   DG   V+DL     
Sbjct: 188 IDTTCTVWDLQS-SNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAH 246

Query: 183 DDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELR-EPQPLDFGDIRDQ 241
              +Y+ +          L+   + +          +  + T  LR EP P D       
Sbjct: 247 STIIYEPL--------AGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPSPFD------- 291

Query: 242 WNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPR 301
                     P  +AT  +Q+ N  L I+ M       S  +T++  HS  V +  + P 
Sbjct: 292 ----------PNVVAT-FTQDSNAVL-ILDM---RYPGSPILTLE-GHSSAVNQMRWHP- 334

Query: 302 NHHNVLYSCGEDGTVKSW 319
              NVL +CG+D  V  W
Sbjct: 335 TQRNVLLTCGDDCQVLYW 352

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 61/128 (47%), Gaps = 15/128 (11%)

Query: 72  SLFATATLNS-VKIYDIKSND---CIATITNDKKSPFLSLDSRHDMLACGTELQGVDAEL 127
           ++FAT  ++  ++I+D +S      ++ + +D     +S + +   L    +  G     
Sbjct: 346 TVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGT---W 402

Query: 128 YIYDVRNWSS-------PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            ++D+R +S+       PV  + + H   IT I F+P D + +   S D    ++DL+ +
Sbjct: 403 GVWDLRQFSAQNTEKTTPVAQY-NFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVE 461

Query: 181 EEDDALYQ 188
            +D+ + Q
Sbjct: 462 ADDEEIKQ 469

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLL 164
           +SL+   ++LA G    G D    ++D+ +   P+K FV  H   +  I F P   + L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 86/196 (43%), Gaps = 29/196 (14%)

Query: 14  DNWCLKFQPLYNHG-LLTSLSNGEVKLLDWETLNPVRNFKIDQVSIN-SMKLINNDYNNA 71
           + + L + P+  +G LLT   +G++      T   + + +      N S++ I      +
Sbjct: 281 EGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTES 340

Query: 72  SLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD-------------MLACG 117
           ++FA+A  +  ++I+D +S          K  P LS+ + +              +LA G
Sbjct: 341 TVFASAGCDGYIRIWDTRSK---------KHKPALSVKASNTDVNVISWSEKIGYLLASG 391

Query: 118 TE--LQGV-DAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNV 174
            +  L GV D   +  D  N   PV  + D H   IT I F+P D + +   S D    +
Sbjct: 392 DDNGLWGVWDLRQFSPDNINDVQPVAQY-DFHKGAITSINFNPLDDSIIAVASEDNTVTL 450

Query: 175 YDLTQQEEDDALYQVI 190
           +DL+ + +D+ + Q I
Sbjct: 451 WDLSVEADDEEIKQQI 466

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 9/119 (7%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           V+IYD+  N CI T++         L   + +L+ G+     D ++   DVR    P   
Sbjct: 342 VEIYDVLKNKCIRTLSGHVDR-VACLSWNNHVLSSGSR----DRKILHRDVRA-PEPFFE 395

Query: 142 FVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSCGW 200
            +D+H  ++  +K++ ++ N L SG  D    VYD T ++    L    + A++ +  W
Sbjct: 396 QIDTHSQEVCGLKWNVNE-NKLASGGNDNMVYVYDGTLRQP--MLSMEEHTAAVKAMAW 451

>SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P40217 Saccharomyces
           cerevisiae YMR146C TIF34 Subunit of the core complex of
           translation initiation factor 3(eIF3) which is essential
           for translation
          Length = 349

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/145 (20%), Positives = 55/145 (37%), Gaps = 17/145 (11%)

Query: 42  WETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKK 101
           W+T  PVR  +        + +++     A         SV +YD+  N     I N  +
Sbjct: 90  WKTKTPVRRVEFSPAGDKILAVLDGVMGYA--------GSVTVYDVVRNTETNEIVNINE 141

Query: 102 SPFLSLDSRHDMLACGTELQGVDAELYIY-----DVRNWSSPVKSFVDS---HHDDITDI 153
            P   + +  D         G + +  +       V  +      ++DS   H   ++DI
Sbjct: 142 EPVFEILTHDDFGIASVASWGFEGKYIVAGHKDGKVSKYDGENGEYLDSLELHEQSVSDI 201

Query: 154 KFHPSDSNFLLSGSTDGYTNVYDLT 178
           +F P D  + ++ S D  + + D+T
Sbjct: 202 QFSP-DRTYFITSSRDSASKLVDVT 225

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 16/168 (9%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDW---ETLNPVRNFKIDQVSINSMKLINNDYNNASL 73
           C+ F P   + L+  LSN E++  D    E    V+ +   Q SI ++K      +   L
Sbjct: 225 CITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFP---DGKKL 281

Query: 74  FATATLNSVKIYDIKSNDCIATI--TNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYD 131
            +++   +V+I++ + N  I  I  T     P++ ++ +          Q +D  +Y Y 
Sbjct: 282 ISSSEDKTVRIWENRINIPIKQISGTAQHSMPWIDINPQGQSFCT----QSMDNTIYTYS 337

Query: 132 V--RNWSSPVKSFVDSHHDDITDIKFHPS-DSNFLLSGSTDGYTNVYD 176
           +  +    P K+F   H+     I F  S D  ++ SG + G T ++D
Sbjct: 338 MLPKYKRHPNKTF-KGHNTTGYGIHFAFSPDGQYIASGDSKGQTFIWD 384

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 71/161 (44%), Gaps = 21/161 (13%)

Query: 62  KLINNDYNNASLF-ATATLNSV-KIYDIKSNDCIATITNDKKSPF-LSLDSRHDMLACGT 118
           +++N D++ +  F A+A+ +   +++DI+S   +       K  + LS  +   +L  G 
Sbjct: 277 RVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSG- 335

Query: 119 ELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
              G+D    ++DVR   S +   +  H   I  + + P D   + +G  DG  N++D+ 
Sbjct: 336 ---GLDNAAIVWDVRTGKSIMN--LQGHAKPIYSVDWSP-DGYHIATGGGDGVINIWDIR 389

Query: 179 QQEEDDAL-----------YQVINYASIHSCGWLSPRRIYT 208
           +  E   L           +Q      + SCG+    RIY+
Sbjct: 390 KTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYS 430

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 69  NNASLFATATLNSVKIYDIKSNDCIATITNDKKSPF-LSLDSRHDMLACGTELQGVDAEL 127
            ++ +   A  N+ +I+D  +    AT+T        +S     +++A G+    +D  +
Sbjct: 155 TSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGS----MDNTI 210

Query: 128 YIYDVRNWSSPVKSFVDSHHDDITDIKFHP------SDSNFLLSGSTDGYTNVYDLTQQE 181
            ++D ++   P+   +  H   IT + + P       +S  L S S DG   ++D+T++ 
Sbjct: 211 RLWDSKD-GKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRV 269

Query: 182 EDDALYQVINYASIHSC-GWLSPRRIYTLSHMETFSISELN 221
               LY +  + +  SC  W     IY+ SH +T  + ++N
Sbjct: 270 ---CLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMN 307

>CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|Q03010 Saccharomyces
           cerevisiae YPL139c UME1 or uniprot|Q12206 Saccharomyces
           cerevisiae YOR229w WTM2 or uniprot|Q12363 Saccharomyces
           cerevisiae YOR230w WTM1
          Length = 457

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
             LY YD RN ++P+    + H   I    F P     L++G  +G  N +D+ +
Sbjct: 262 GNLYFYDSRNLATPIWKIENEH---ILSFAFSPLVETLLITGGANGIINFWDVKR 313

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 62/132 (46%), Gaps = 16/132 (12%)

Query: 82  VKIYDIKSNDCIATITN--DKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPV 139
           V+IYD+    CI T+    D+ S    L   + +L+ G+     D  +   DVR  + P 
Sbjct: 331 VEIYDVVKRKCIRTLPGHVDRTS---CLSWNNHILSSGSR----DHTILHRDVR-MAEPF 382

Query: 140 KSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINY-ASIHSC 198
              + +H  ++  +K++  D N L SG  D    VYD T       ++++  + A++ + 
Sbjct: 383 FERIKTHSQEVCGLKWN-VDENKLASGGNDNMVYVYDGTSSS---PVFKITEHKAAVKAM 438

Query: 199 GWLSPRRIYTLS 210
            W SP +  TL+
Sbjct: 439 AW-SPHKRGTLA 449

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           +K++D+ S   +  +   K S   L  D     L  G+     D+ + I+D+ +     K
Sbjct: 103 IKVWDLVSKTVLINLNGHKSSITVLKFDVNCTRLVSGSS----DSNIIIWDLVSEVGICK 158

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
             + SH D I+D+ +   D N+LLS S DG   V+DL
Sbjct: 159 --LRSHKDRISDL-YVDDDFNWLLSVSKDGLIKVWDL 192

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DG VK W
Sbjct: 612 AHQDSIMNVKFLPESHN--FFSCSKDGQVKYW 641

>TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1340

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 87  IKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKSFVD 144
           I S   I  ++ D  S F  LS    ++M+A    +Q    +L+  D +     + SF D
Sbjct: 54  ISSKSDIPVLSIDVDSTFNDLSWSIDNEMIAGA--MQNGTIQLFKTDKKESLEKIGSFED 111

Query: 145 SHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
              D IT IKF+   +N LLSGS+ G   V+D
Sbjct: 112 EAQD-ITIIKFNNKQNNVLLSGSSTGKILVWD 142

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 59/145 (40%), Gaps = 15/145 (10%)

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +D    ++D++  S+ VK+ + +H  ++ D KF    SN   S   DG   V+DL     
Sbjct: 187 IDTTCTVWDLQA-SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAH 245

Query: 183 DDALYQVINYASIHSCGWLS----------PRRIYTLSHMETFSISELNDRTDELREPQP 232
              +Y+  +    H+   +            R+    +   + ++S L  +     EP P
Sbjct: 246 STIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETSLAVSSLESQALLRLEPSP 305

Query: 233 LD---FGDIRDQWNCDYVIDI-YPG 253
            D      I+   N   ++D+ YPG
Sbjct: 306 FDPNILATIQQDSNVVIILDMRYPG 330

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWS---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    + IYD+   S   SP+ + +  H   I  + F+   ++ L+SG  DG   V+DL
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDL 261

>AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER107C
           (GLE2)
          Length = 361

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 27/157 (17%)

Query: 73  LFATATL-NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ--GVDAELYI 129
           LF+ A   N+V+I+D+++         + ++P L+     D    GT++   G D  L +
Sbjct: 48  LFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSD----GTKVASGGCDNILKL 103

Query: 130 YDVRNWSSPVKSFVDSHHDDITDIKF---HPSDSNFLLSGSTDGYTNVYDLTQQEEDDAL 186
           YDV   +S     + SH   +  ++F    PS+   +++GS D     +D+ Q       
Sbjct: 104 YDV---ASGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQP------ 154

Query: 187 YQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDR 223
            Q I+  ++       P R+Y L   +   +    +R
Sbjct: 155 -QPISTVAM-------PERVYALDSKQKLLVVGTAER 183

>NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {ON}
           Anc_8.631
          Length = 424

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G D   YI+D R  S+ V+ F  S   D+  I+F   D N +++G  DG  N++DL
Sbjct: 247 GSDGYTYIWDTRT-SAAVQKFFASD-TDVNAIQFF-KDGNSIVTGGDDGVINMFDL 299

>Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 92  CIATITNDKKSPFLSLDSRH--DMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDD 149
           C   I ND  S  ++LD  H   +LA  TE + V    Y YD+ +        + ++  D
Sbjct: 286 CCELIINDLDSAVITLDICHLGKILAICTEGEMV----YFYDINDGKLLQSKSLANYKSD 341

Query: 150 ITDIKFHPSDSNFLLSGSTDGYTN 173
           +  +KF+P+ S +++SG  D  +N
Sbjct: 342 LV-LKFYPNKSWYIMSGKNDTLSN 364

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 69/164 (42%), Gaps = 25/164 (15%)

Query: 25  NHGLLTSLSNGEVKLLDWETLNPVRNFK----IDQVSINSMKLINNDYNNASLFATATLN 80
           N  +++S  +G +K+ D  T +  RN+K    +++V I+         N   L +     
Sbjct: 87  NKWMVSSSEDGTIKVWDVRTPSVQRNYKHNAPVNEVVIHP--------NQGELISCDQDG 138

Query: 81  SVKIYDIKSNDCIATITNDKKSPF--LSLDSRHDMLACGTELQGVDAELYIYDVRNWS-- 136
           ++KI+D+  N C   +  +  +P   LS+ S   ML  G+         Y++ + N +  
Sbjct: 139 NIKIWDLGENQCTHQLALEDDTPLQSLSIASDGSMLVAGSN----KGNCYVWKMPNHTDT 194

Query: 137 ---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
               PV  F  SH   IT +     D   L + S D    V+ +
Sbjct: 195 ANLKPVTKF-RSHTKYITRVLL-SVDVKHLATCSADHTARVWSI 236

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLS-LDSRHDMLACGTELQGVDAELYIYDVRNWSSP 138
           ++VK +D+ ++ C+ T T       L+ L S H +LACG+  + +   L+ +   + S  
Sbjct: 298 HTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLH-LLACGSSARHI--TLHDFRANSSSKI 354

Query: 139 VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
            +  +  H + +  +   P +   L+SGS DG   V+D+
Sbjct: 355 TQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDI 393

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183
           +++I+D+RN S+P+   V  H   +  I F    S  ++S S DG    +D +   ED
Sbjct: 180 DVFIWDLRNGSTPLCQLV-GHESSVNSIDFSRFKSTEIMSSSNDGTVKFWDYSVNNED 236

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 6/65 (9%)

Query: 277 VESSKAITID--RAHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWD 334
           + S+KA  +D  R H++ V   +F P  H N++ S GED TV+ W     + T +++F  
Sbjct: 238 MSSTKAWEVDTCRGHTNNVDSVIFHP--HQNLIISVGEDKTVRVWD--LDKRTPVKQFKR 293

Query: 335 YSQRF 339
            + RF
Sbjct: 294 ENDRF 298

>Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           V+IYD+    CI T++         L   + +L  G+     D  +   DVR    P   
Sbjct: 326 VEIYDVIKRKCIRTLSGHVDR-VACLSWNNHVLTSGSR----DHRILHRDVR-MPDPFFE 379

Query: 142 FVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
            ++SH  ++  +K++ +D N L SG  D   NVY+ T +
Sbjct: 380 TIESHTQEVCGLKWNVAD-NKLASGGNDNMVNVYEGTSK 417

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 113 MLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYT 172
           +L+C      +D    ++D+ N ++ VK+ + +H  ++ D+KF    +    S   DG  
Sbjct: 207 LLSCS-----IDTTCTVWDLSNSTNYVKTQLIAHDSEVFDVKFLAQSTQLFASCGGDGSV 261

Query: 173 NVYDLTQQEEDDALY 187
            V+DL        +Y
Sbjct: 262 RVFDLRSLAHSTIVY 276

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 80/182 (43%), Gaps = 20/182 (10%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSI-----NSMKLINNDYNNA 71
            L+F P   + L ++ +NGE+ + D        ++      I     + +K ++ + + A
Sbjct: 118 TLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLA 177

Query: 72  SLFATA--TLNSVKIYDIKSNDCIATI--TNDKKS--PFLSLDSRHDML------ACGTE 119
            +FA+A  T     I+D+K+   +  +  T+ K    P L++   H  +      A G++
Sbjct: 178 HVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSD 237

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
               D  + I+D+RN + P+ +    H   I  + +   D + LLS   DG   ++D   
Sbjct: 238 ---SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKA 294

Query: 180 QE 181
            E
Sbjct: 295 NE 296

>KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 436

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 24  YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFATATLNSVK 83
           Y H  +T  S+G   L D    N  ++F I    ++++K  N   N  S  A +   S +
Sbjct: 232 YGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFN---NGESFMAGSDDGSAR 288

Query: 84  IYDIKSNDCIAT 95
           ++D++S+  I+T
Sbjct: 289 LFDLRSDCQIST 300

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 24/121 (19%)

Query: 76  TATLNSVKIYDIKSNDCIATITNDKKSP----------------FLSLDSRHDMLACGTE 119
           T  L +V I+D+K+ + +A+  ND   P                FL      ++LA G  
Sbjct: 68  TGALENVNIWDLKTGE-LASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYN 126

Query: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
               D  + ++D+  +S  V   ++ H   IT +KF  S +  L+SGS D    V+DL  
Sbjct: 127 ----DGVVKVWDL--YSKTVLCNLNGHSSAITALKFDTSGTR-LISGSRDSNIIVWDLVS 179

Query: 180 Q 180
           +
Sbjct: 180 E 180

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DG +K W
Sbjct: 651 AHQDSIMNVKFVPESHN--FFSCSKDGIIKYW 680

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL-------- 177
            + I D+RN  SPV   ++ H   +  +++HPS  N LLS + D     +DL        
Sbjct: 378 RVLILDMRNPGSPVL-VLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHP 436

Query: 178 TQQEEDDAL 186
           T Q+ D A+
Sbjct: 437 TDQDPDHAV 445

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 112 DMLACGTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGY 171
           D++  G E    +  + ++  ++ +    + ++ H + +TD KFHPS   F+ S S D  
Sbjct: 236 DLITAGGE----EGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPS-GRFIASASFDMT 290

Query: 172 TNVYDLTQQEE 182
             ++D+  QEE
Sbjct: 291 WRLWDVETQEE 301

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 60/139 (43%), Gaps = 5/139 (3%)

Query: 74  FATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVR 133
           FA  +   V+I+  ++   + T +  K   + +       L    +  G+ +    Y+ R
Sbjct: 55  FAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCANFRADGKLLVAGDATGLVSVYDSYNPR 114

Query: 134 NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDD-ALYQVINY 192
           N    +++   +H   +T  KFHP DS  L++ S D  T ++D++   E    L    +Y
Sbjct: 115 NVLVSIQA--STHPTHVT--KFHPMDSKTLITSSDDRVTRLWDISHAYEPTLELGGATDY 170

Query: 193 ASIHSCGWLSPRRIYTLSH 211
               +C   +P  + T S+
Sbjct: 171 VRSLTCVPSAPHLVATGSY 189

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 65/161 (40%), Gaps = 25/161 (15%)

Query: 28  LLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLI--------NNDYNNASLFATATL 79
           +LT+L +G V++ ++ET   VR+ ++    + + K I         +D N   +F   T 
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 80  NSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRN-WSSP 138
             V  + +   D I +I      P++   S              D  + +++  N WS  
Sbjct: 88  EKVADF-VAHPDYIRSIAVHPSKPYILTGSD-------------DLTVKLWNWENDWS-- 131

Query: 139 VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179
           ++     H   +  + F+P D N   SG  D    V+ L Q
Sbjct: 132 LEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQ 172

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 105/267 (39%), Gaps = 49/267 (18%)

Query: 73  LFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDV 132
           L ATA+  S+KI+++K++ CI T           L     ++  GT     + EL ++D+
Sbjct: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGL-LVILGTR----NGELQLFDL 459

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINY 192
            + SS + +  D+H   I  +    SD   L++GS D     +D          +QV N 
Sbjct: 460 AS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWD----------FQVENT 507

Query: 193 ASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELR-EPQPLDFG-DIRDQWNCDYVIDI 250
               +     P  I  L+H  T    ELND    LR  P        + D     + +D 
Sbjct: 508 LVPGTKDKFLP--ILKLNHDTTL---ELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562

Query: 251 YPGYIAT-GR-----------------SQEGNGNLQIIPMDGETVESSKAITIDRAHSDE 292
              Y++  G                  +   + N++I  +D      S       AH D 
Sbjct: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLF-----AHQDS 617

Query: 293 VIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           ++   F+P +H+   +SC +D  VK W
Sbjct: 618 IMSVKFLPESHN--FFSCSKDAVVKYW 642

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 277 VESSKAITID--RAHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWD 334
           + ++KA  +D  R H++ V   +F P  H N++ S GED T+++W     + T +++F  
Sbjct: 238 MSATKAWEVDTCRGHTNNVDSVIFHP--HQNLIISVGEDKTIRTWDL--DKRTPVKQFKR 293

Query: 335 YSQRF 339
            + RF
Sbjct: 294 ENDRF 298

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           R  S+ ++  +  H   ITDI FHPS    L + S D Y + +D+
Sbjct: 100 RTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVHAWDM 144

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWS---SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    + IYD+   +    P    +  H   I  + F+ + ++ L+SGS DG   V+DL
Sbjct: 185 GTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDL 243

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 63/130 (48%), Gaps = 17/130 (13%)

Query: 71  ASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLDSRHD----MLACGTELQGVDA 125
           +++FA+  ++  ++I+D +S      I+    +  +++ S  +    +LA G +    D 
Sbjct: 346 STVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----DG 401

Query: 126 ELYIYDVRNW-------SSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
              ++D+R +       +SPV  +   H   IT I F+P D + +   S D    ++DL+
Sbjct: 402 TWGVWDLRQFTPQNASTASPVAQY-QFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

Query: 179 QQEEDDALYQ 188
            + +D+ + Q
Sbjct: 461 VEADDEEIKQ 470

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 36/161 (22%)

Query: 17  CLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFAT 76
           CL F   +N     +  +  VK+ D  T   + +F   + +IN +++ NN   N+ L   
Sbjct: 356 CLDFAKSWNTLCTAANYDNTVKIWDLSTTEQLGSFSGHKATINCLQMSNN---NSLLMTG 412

Query: 77  ATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWS 136
           +   +VK+++I     +A   N++      L+ + +                        
Sbjct: 413 SKDATVKVWNIDLGIELAKKENNQ------LEEKDE------------------------ 442

Query: 137 SPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           SP     DSH D+IT + F   D  +L+S S D     YD+
Sbjct: 443 SPCVLTFDSHSDEITALSF---DGEYLISASRDKTVRQYDI 480

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DG VK W
Sbjct: 607 AHQDSIMSVKFVPESHN--FFSCSKDGLVKYW 636

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 82  VKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVK 140
           +KI+D+ S   +      K +   L  D     L  G++    D+++ I+D+       K
Sbjct: 99  IKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK----DSDIIIWDLVGEVGLYK 154

Query: 141 SFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
             + SH D IT I     D  +L+S S DG   ++DL  Q+
Sbjct: 155 --LRSHKDSITGIWCENED--WLISTSKDGLIKIWDLKTQQ 191

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 24/114 (21%)

Query: 81  SVKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVR------ 133
           S+KI+D+        +     S   + +D+R++ML  G    G DA L ++++       
Sbjct: 421 SIKIWDLSQKKQTGQMAGHLASISCMQIDNRYNMLITG----GRDAVLKMWNLNLGAQLY 476

Query: 134 ---------NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
                    + ++ V +F DSH D+IT + F   DS  L+SGS D     +DLT
Sbjct: 477 QEESDAIPSSETACVYTF-DSHVDEITALSF---DSGHLVSGSQDRTVRQWDLT 526

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 9/107 (8%)

Query: 124 DAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEED 183
           +  L+I D+    + V+S      D + D+ ++    N +L+   DG   ++D+T Q+  
Sbjct: 37  NGRLFIMDLTAQGTMVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDITLQQYP 96

Query: 184 DALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREP 230
            AL+Q  +   + SC W        L H +TF +S   D T ++  P
Sbjct: 97  IALFQE-HQREVFSCNW-------NLLHKDTF-VSSSWDGTVKVWTP 134

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 22/114 (19%)

Query: 80  NSVKIYDIKSNDCIATITNDKKS-PFLSLDSRHDMLACGTELQGVDAELYIYDVR----- 133
           +S+K++++   + +  +T    S   + LD++++ML  G    G DA L ++D+      
Sbjct: 437 HSIKLWNLSKKNQVGQMTGHHASINCMQLDNQYNMLISG----GRDAVLKLWDLSLAYQL 492

Query: 134 ---------NWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLT 178
                    N         DSH D+IT + F   DS  L+SGS D     +DL+
Sbjct: 493 YQEDTEFASNSEEACVYTFDSHLDEITALSF---DSGHLVSGSQDRTLRQWDLS 543

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 66/139 (47%), Gaps = 13/139 (9%)

Query: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ 121
           ++I +  +N   ++ +  +++K +D+ +  CI T T       ++  S  ++LACG+  +
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSAR 351

Query: 122 GVDAELYIYDVRNWSSP--VKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL-- 177
                + ++D R  +S    +  +  H + ++ +   P +   L SGS DG   V+D+  
Sbjct: 352 ----HITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRS 407

Query: 178 -----TQQEEDDALYQVIN 191
                T   ED ++ + +N
Sbjct: 408 TSPMYTITREDKSVQKGVN 426

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 73  LFATATLN-SVKIYDIKSNDCIATITNDKKSPFLSLD-SRHDMLACGTELQGVDA----- 125
           LFA+   + SV+++D++S      I     +P  + D S+        E    DA     
Sbjct: 339 LFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIAT 398

Query: 126 ------ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
                 ++ I D+RN  SPV   ++ H   I  IK+HP+    LLS S D     +DL
Sbjct: 399 FVSESNKILILDMRNSESPVL-VLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           ++ I D+RN  SP  + +  H   +  IK+HP+  N LLS S D     +DL
Sbjct: 371 DILILDMRNPESPALT-LKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 126 ELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           ++ I D+RN  SP+ + +  H   +  IK+HP+  N LLS   D     +DL
Sbjct: 374 KIIILDMRNPESPILN-LQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 83/225 (36%), Gaps = 56/225 (24%)

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           +D    ++D+++ S  VK+ + +H  ++ D++F    +    S   DG   V+DL     
Sbjct: 264 IDTTCIVWDLQS-SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAH 322

Query: 183 DDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDEL--REPQPLDFGDIRD 240
              +Y+  +                ++S     +I+  +  +D L   EP P D      
Sbjct: 323 STIIYEPPS---------------SSVSGATAGTITPSSKGSDALLRLEPSPYD------ 361

Query: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300
                      P  +AT  +       +II +D    ES   I   + H   V    + P
Sbjct: 362 -----------PNVLATFAADSN----KIIILDMRNPES--PILNLQGHGSSVNGIKWHP 404

Query: 301 RNHHNVLYSCGEDGTVKSW--------------KSPHSQSTALEE 331
               NVL SCG+D  V  W              KSP    T+LE+
Sbjct: 405 -TKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSPSIHGTSLED 448

>Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {ON}
           complement(187786..188673) [888 nt, 296 aa]
          Length = 295

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 6/101 (5%)

Query: 245 DYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIPRNHH 304
           D V+D Y   +A+  S +    ++I  +DGE   S K +   R H   V R  +      
Sbjct: 14  DSVLDYYGKRLASCSSDK---TVKIFALDGE---SFKLLDTLRGHEAPVWRVSWAHSKFG 67

Query: 305 NVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQS 345
            +L SC  DG +  W+    + T ++    +S   N  E S
Sbjct: 68  EILASCSFDGKIIIWEEVRGKWTMIDSLSVHSGSVNSIEWS 108

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 122 GVDAELYIYDVRNWSS---PVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G    + IYD+   S+   PV + +  H   I  + F+   ++ L+SG  DG   ++DL
Sbjct: 197 GTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWDL 255

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 6/65 (9%)

Query: 277 VESSKAITID--RAHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWD 334
           + S+KA  +D  R H++ V   +F P  H N++ S GED T++ W     + T +++F  
Sbjct: 238 MSSTKAWEVDTCRGHTNNVDSVIFHP--HQNLIISVGEDKTIRVWD--LDKRTPVKQFKR 293

Query: 335 YSQRF 339
            + RF
Sbjct: 294 ENDRF 298

>TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON}
           Anc_8.585 YBR175W
          Length = 319

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 123 VDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           +D  + I+DV N S  V   V +H + +  I     DS  + SGS DG   V+D
Sbjct: 118 MDESIKIWDVLNGS--VMRTVAAHSESVVSIDIPADDSTIVCSGSYDGLIRVFD 169

>KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 421

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           G D  +YI+D R  ++    FV     D++ +KF  ++ N +L+G+ DG   ++DL
Sbjct: 239 GSDGYVYIWDTRMRTAGQSFFVS--ESDVSTLKFF-NNGNAILTGTDDGIARMFDL 291

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 133 RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177
           RN ++ ++  +  H   ITDI FHP     L + S D Y   +D+
Sbjct: 100 RNSTNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDM 144

>NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2.450
           YKL121W
          Length = 977

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 19/91 (20%)

Query: 145 SHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEEDDALYQVINYASIHSC------ 198
           SH D +T +KFHP D  F L+G  D     + +    E+  +Y+   Y  I S       
Sbjct: 398 SHPDFVTSVKFHPVDDRFFLTGCLDHKCRFWSIL---ENSVVYEFNCYDLITSLTLSPGE 454

Query: 199 ----------GWLSPRRIYTLSHMETFSISE 219
                     G++       L H+ TF I+E
Sbjct: 455 GEFTIVGTFNGYIHILLTTGLKHVSTFHITE 485

>Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 84  IYDIKSNDCIATITNDKKSPFLSLDSRH--DMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           I+ +KS  C   I  D  S  ++LD  H   +L   TE    D  +Y YD+         
Sbjct: 279 IWSLKSL-CCEKIIQDLDSAVVALDVCHLGKILGVCTE----DEMVYFYDLNEAKLLESK 333

Query: 142 FVDSHHDDITDIKFHPSDSNFLLSGSTDGYTN 173
            + +H  D+  +KF+P  S ++LSG  D  +N
Sbjct: 334 SLANHKSDLV-LKFYPDKSWYILSGKNDTLSN 364

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DG +K W
Sbjct: 625 AHQDSIMNVKFVPESHN--FFSCSKDGLIKYW 654

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 73  LFATATLNSVKIYDIKSNDCIATITN--DKKSPFLSLDSRHDMLACGTELQGVDAELYIY 130
           L ATA+   +KI++IK+  CI T          FL   +   ++  GT       EL ++
Sbjct: 417 LLATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGT---LVIVGTR----GGELQLF 469

Query: 131 DVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           D+ + S+ +++  D+H   I  +    SD   L++GS D     +D   ++E
Sbjct: 470 DLAS-STLLETIEDAHDAAIWSLDL-TSDGKRLVTGSADKSVKFWDFQLEQE 519

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 14/116 (12%)

Query: 76  TATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQ--------GV---D 124
           T+ L ++ I+DIK+ +  + + +    P  S+D++    A  T LQ         V   D
Sbjct: 41  TSALENINIWDIKTGELSSHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYND 100

Query: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180
             + ++D+  +S  V   ++ H   IT +KF  + +  L+SGS D    V+DL  +
Sbjct: 101 GVIKVWDL--YSKTVLCNLNGHSSAITVLKFDSTGTR-LISGSRDSNIIVWDLVSE 153

>SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {ON}
           conserved hypothetical protein
          Length = 959

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 18/113 (15%)

Query: 69  NNASLFATATLNSVKIYD-IKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAEL 127
           +N S    A L+  KI D IK+  C            LSL      L  G    G    +
Sbjct: 116 SNNSDLTPARLSPSKIRDRIKTTSC------------LSLSPDEKFLIVGE--TGHHPRV 161

Query: 128 YIYDVRNWSSPVKSFVDSHHD-DITDIKFHPSDSNFLLSGS--TDGYTNVYDL 177
            +Y +   S+   +FV  HH   I ++KFHP+D    LS     DG+ +++ L
Sbjct: 162 LLYSLAPDSNDFPAFVIHHHSYGIANLKFHPTDPKIFLSLGLINDGFLHIWRL 214

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 146 HHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           H D +T ++FHP+D  F +SG  D    ++ + + E
Sbjct: 367 HQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 76/209 (36%), Gaps = 62/209 (29%)

Query: 82  VKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVRNWSSPVKS 141
           +KI+ +K+   + ++     S  L  DS   +LA G    G D  + + D+ N    +  
Sbjct: 85  LKIFQLKTGKVVRSMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDIEN--GYITH 138

Query: 142 FVDSHHDDITDIKFHPS-DSN--FLLSGSTDGYTNVYDL-------TQQEEDDALY---- 187
            +  H   I+ +KF+   DS    L SG T+G   V+DL       T QE   A+     
Sbjct: 139 SLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

Query: 188 --------------------QVINY------------------ASIHSCGWLSPRR---- 205
                                ++N+                    + SCG+L+ R     
Sbjct: 199 TEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIKTLPVNQQVESCGFLNTRDGKHI 258

Query: 206 IYTLSHMETFSISELNDRTDELREPQPLD 234
           IYT      F + +L   +   R  +P++
Sbjct: 259 IYTAGGDAIFQLIDLESGSMLKRTNKPIE 287

>KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.450
           YMR102C
          Length = 894

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 146 HHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQE 181
           H D +T +KFHP+D  F ++GS D    ++ +   E
Sbjct: 323 HTDFVTSVKFHPNDDRFFVTGSLDHKCRLWSILDNE 358

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 288 AHSDEVIRDVFIPRNHHNVLYSCGEDGTVKSW 319
           AH D ++   F+P +H+   +SC +DG VK W
Sbjct: 607 AHQDSIMSVKFLPESHN--FFSCSKDGLVKYW 636

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 74  FATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTELQGVDAELYIYDVR 133
           FA  +   V+++   +   I T +  K   + +       L C  +  G+   + +YD  
Sbjct: 55  FAVTSSTRVQLFSSSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSY 111

Query: 134 NWSSPVKSF-VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQEE 182
           N  + + S    SH   +T  KFH  DS  L++ S D  T V+D++   E
Sbjct: 112 NPRTLLLSINASSHPTHVT--KFHTQDSKTLVTASDDRITRVWDISHAYE 159

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 143 VDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176
           V+ H  D+T ++FHP + + L SGS D   +++D
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWD 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,657,984
Number of extensions: 1945767
Number of successful extensions: 8599
Number of sequences better than 10.0: 536
Number of HSP's gapped: 8689
Number of HSP's successfully gapped: 651
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)