Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H033302.284ON36936919780.0
NCAS0G038102.284ON66133013640.0
TDEL0G021502.284ON66134113630.0
Suva_9.1042.284ON80531313411e-180
KAFR0J013702.284ON78032713371e-179
YIL095W (PRK1)2.284ON81033413381e-179
NDAI0G006402.284ON62131213191e-179
Skud_14.3092.284ON63935413151e-178
Smik_9.842.284ON80832613241e-177
Skud_9.782.284ON80933913211e-177
NCAS0B062602.284ON72336113041e-175
KNAG0H020202.284ON59231212881e-174
YNL020C (ARK1)2.284ON63835712911e-174
SAKL0E07722g2.284ON79131213011e-174
Smik_14.3112.284ON63731912871e-174
Suva_14.3272.284ON63231912821e-173
KLLA0E08405g2.284ON77734012911e-173
NDAI0B035602.284ON75635212871e-172
CAGL0G02607g2.284ON68832112731e-171
KLTH0G10318g2.284ON79031312771e-170
Kwal_27.115422.284ON79131312701e-169
TPHA0C033802.284ON69731612311e-165
TBLA0B059302.284ON71736312281e-164
Kpol_1003.352.284ON71331212121e-161
ZYRO0A01848g2.284ON70431712071e-161
Ecym_33232.284ON74831212071e-160
ADL217W2.284ON75031911941e-158
CAGL0J03432g2.284ON62231411441e-152
KNAG0A054302.284ON78834011301e-148
Kpol_1039.332.284ON70135811121e-146
TBLA0B069402.284ON144334311141e-140
TPHA0D015402.284ON7073319781e-126
KAFR0A010403.273ON9123267839e-96
SAKL0D03234g3.273ON8583167703e-94
KNAG0J008203.273ON10913237789e-94
KNAG0H012203.273ON9133277584e-92
CAGL0H10208g3.273ON10273217513e-90
Kpol_1052.223.273ON11013217533e-90
Kpol_251.43.273ON8383187389e-90
NDAI0A057003.273ON11573297492e-89
ZYRO0E06864g3.273ON11153207421e-88
KLTH0C07260g3.273ON9013177322e-88
NCAS0A105903.273ON10953197402e-88
Smik_2.1913.273ON11083697351e-87
Skud_2.1793.273ON10903457341e-87
KLLA0F18612g3.273ON8143117212e-87
YBR059C (AKL1)3.273ON11083697323e-87
Suva_4.2973.273ON11073227314e-87
TPHA0M011203.273ON7883157174e-87
TBLA0E025903.273ON10613177295e-87
KAFR0C004303.273ON9493237239e-87
Ecym_26503.273ON8943107201e-86
Kwal_27.109453.273ON9353317183e-86
TPHA0A040303.273ON10543337209e-86
AGR027C3.273ON9613087107e-85
TDEL0D035203.273ON10493187121e-84
CAGL0K11990g3.273ON9913556952e-82
TBLA0I019303.273ON13613177013e-82
Kwal_56.242746.262ON3463382634e-25
NDAI0C026806.31ON7503412521e-22
Kpol_1023.266.31ON7392732431e-21
KLTH0H03080g6.262ON3463332301e-20
NCAS0D021006.31ON7262912342e-20
TPHA0F024306.31ON7982682306e-20
Suva_16.706.262ON3643472241e-19
TDEL0G043806.31ON7222752281e-19
YPL236C (ENV7)6.262ON3643292241e-19
KNAG0E008506.31ON7112752271e-19
TPHA0J004206.31ON7072742271e-19
Kpol_1037.206.31ON7042752262e-19
KAFR0G026906.31ON7132752244e-19
Skud_16.426.262ON3643342204e-19
KAFR0A050906.31ON6682382217e-19
Ecym_30356.31ON7402752218e-19
ACL006W6.31ON7082752201e-18
SAKL0A03344g6.262ON3643542161e-18
CAGL0J11638g6.31ON7462932182e-18
SAKL0H06754g8.668ON8841952164e-18
KLTH0C10912g6.31ON6972762155e-18
KNAG0F002901.52ON11252942156e-18
TBLA0B004906.31ON7872912139e-18
Kpol_1072.198.668ON8962032139e-18
TDEL0A067506.262ON3723022091e-17
Skud_1.723.177ON9742562121e-17
ZYRO0C07480g6.31ON7742752102e-17
KLLA0C06138g6.31ON7082812102e-17
KNAG0F001701.24ON5432052092e-17
YAR019C (CDC15)3.177ON9742622103e-17
Smik_1.793.177ON9742482094e-17
Smik_6.4416.262ON3643332054e-17
Skud_13.1546.31ON7052752084e-17
YMR001C (CDC5)6.31ON7052752084e-17
Kwal_56.224766.31ON6972762074e-17
Smik_13.1596.31ON7052752066e-17
SAKL0E01584g6.31ON6952752066e-17
Suva_13.1636.31ON7052732041e-16
SAKL0C01716g1.52ON12153052051e-16
ZYRO0E07876g6.262ON3693342011e-16
Ecym_21536.262ON3633492001e-16
TPHA0G032002.479ON15342002041e-16
CAGL0K08514g2.479ON14892182032e-16
ZYRO0F18062g1.24ON4711991994e-16
YCL024W (KCC4)1.52ON10372702004e-16
Kpol_431.92.479ON15521992005e-16
NCAS0C016708.668ON8961962005e-16
Smik_3.541.52ON10322742005e-16
TDEL0C067801.24ON4681981985e-16
KLLA0F13552g2.479ON12673051997e-16
NCAS0B044906.222ON3492031948e-16
KNAG0F029006.31ON6493111979e-16
Suva_1.863.177ON9742621962e-15
ABL034W2.479ON14252001952e-15
KAFR0C014403.92ON10952271952e-15
ZYRO0D05500g7.86ON12622331952e-15
KNAG0D048107.86ON14401811952e-15
NCAS0C049403.92ON11162411943e-15
Suva_3.1901.52ON10242701943e-15
Skud_7.928.140ON5632661933e-15
NDAI0E023908.668ON8831951933e-15
CAGL0I07513g3.92ON10762751933e-15
Kpol_1065.36.222ON3762751903e-15
Kpol_2002.241.24ON4871871914e-15
TDEL0D053203.92ON10572901934e-15
TDEL0A025502.479ON13691991934e-15
Suva_16.1608.668ON9181951924e-15
Ecym_73922.479ON14342011934e-15
SAKL0E02860g2.479ON13773011924e-15
TBLA0B082503.92ON13471991925e-15
KLTH0D05566g2.479ON11281991925e-15
TPHA0H026307.86ON13671841916e-15
TPHA0E038501.24ON4821951896e-15
ZYRO0F07194g8.668ON9381951908e-15
KLTH0D11044g8.668ON8492041908e-15
CAGL0M02299g8.668ON8931981908e-15
Suva_11.1232.479ON15262131908e-15
KLLA0C01650g1.52ON11123041909e-15
Kwal_26.77882.479ON12671991891e-14
TBLA0A071501.52ON13912981882e-14
NDAI0A006601.52ON10222251872e-14
NDAI0F016006.222ON4122031852e-14
KAFR0D032002.479ON14481981872e-14
Skud_3.391.52ON10172211872e-14
KNAG0D008306.262ON3873371842e-14
TBLA0A074601.24ON5161871852e-14
TDEL0A061408.668ON8611951862e-14
AFR335C3.92ON10331951863e-14
ACR133C8.668ON8511951863e-14
TPHA0G016308.668ON8711971863e-14
Skud_10.1191.271ON14812821863e-14
Skud_11.1262.479ON15182121863e-14
ACR281C7.86ON12591851854e-14
TBLA0E022907.86ON13001861854e-14
TPHA0E036401.52ON11372361844e-14
KLTH0C09548g3.92ON9931951836e-14
Kwal_55.215455.406ON8652561836e-14
TBLA0A047207.86ON12622351836e-14
KAFR0D041001.52ON11172901836e-14
AFR696C1.52ON11422011836e-14
NCAS0B086001.52ON11172341837e-14
NDAI0F045201.24ON4891971817e-14
TBLA0I011502.479ON17453231837e-14
KAFR0G012001.24ON5071941818e-14
TDEL0C064901.52ON11533051828e-14
NCAS0C041008.141ON9053321829e-14
Skud_4.7643.92ON7562001819e-14
Ecym_10301.24ON4402781809e-14
Ecym_21946.222ON3662821791e-13
KLTH0F16676g5.406ON8782051811e-13
AFL101C6.222ON3672711781e-13
CAGL0F00913g7.86ON12061841811e-13
ZYRO0E07018g6.222ON3672031781e-13
YKL101W (HSL1)2.479ON15182121811e-13
Smik_4.8031.24ON4901971791e-13
Suva_2.7031.24ON4851961791e-13
ZYRO0G03366g2.479ON16161921811e-13
Skud_16.1328.668ON9241951801e-13
CAGL0K05709g1.52ON11032331802e-13
Ecym_10581.52ON11643011802e-13
TBLA0B023103.92ON8191961792e-13
SAKL0C00946g1.24ON5641951782e-13
NCAS0A002801.24ON5352161782e-13
Skud_3.1656.371ON7161951792e-13
Kpol_1044.37.86ON9321821792e-13
KLLA0F11319g8.668ON8431951792e-13
YJL095W (BCK1)1.271ON14782821792e-13
KLLA0C08525g6.341ON15512981792e-13
Kwal_26.87518.668ON8482051782e-13
TDEL0H036407.86ON12372381792e-13
Smik_10.1471.271ON14782821792e-13
KLLA0C12485g3.92ON9252321782e-13
Kpol_463.81.271ON14472471792e-13
YDR490C (PKH1)3.92ON7662001783e-13
KNAG0A065402.479ON14321981783e-13
TDEL0F040608.279ON11262011783e-13
YPL150W8.668ON9011951783e-13
KAFR0D012207.86ON10551991783e-13
Suva_6.1691.271ON14842821774e-13
KAFR0H025108.668ON8791961774e-13
SAKL0B09856g7.86ON12742321774e-13
CAGL0H06259g7.86ON13361951774e-13
Ecym_35863.92ON10772671764e-13
NCAS0F015807.86ON13822361765e-13
Kwal_26.71547.86ON12131811765e-13
Kwal_26.73551.271ON14462401765e-13
NCAS0A057702.479ON14613141765e-13
NDAI0G042903.92ON11131961765e-13
YDR523C (SPS1)1.24ON4901971745e-13
AFR724C1.24ON4402781745e-13
Smik_4.7673.92ON7582001755e-13
Smik_11.1392.479ON15342131766e-13
Kwal_56.226933.92ON9841951756e-13
SAKL0A04246g6.222ON4002081736e-13
KAFR0A017602.496ON8852791756e-13
CAGL0E05720g6.222ON3582841726e-13
TPHA0E028206.222ON3842011727e-13
Kpol_1012.68.654ON6282331748e-13
ZYRO0B06512g3.92ON11112811748e-13
YDR507C (GIN4)1.52ON11422931748e-13
Suva_7.838.140ON5692101738e-13
Ecym_26407.86ON13252321748e-13
Suva_15.653.92ON10802311749e-13
KAFR0B028008.279ON10951981749e-13
KNAG0J016708.668ON10091981749e-13
Skud_15.543.92ON10822311741e-12
Skud_4.7971.24ON4851961721e-12
KLLA0F14190g1.271ON13382271731e-12
Skud_4.7831.52ON11352941731e-12
KLTH0G05214g5.591ON6532471721e-12
Smik_4.7891.52ON11362941731e-12
KLTH0F01672g1.52ON11642251731e-12
KNAG0L005207.86ON3681801701e-12
Kwal_47.183075.591ON6212701721e-12
KLLA0F07623g7.86ON12291941731e-12
YGL179C (TOS3)8.140ON5601901711e-12
KNAG0D010906.222ON3721911701e-12
Suva_1.507.86ON13601811721e-12
KNAG0I026706.371ON9081981721e-12
NCAS0B014508.652ON5052151711e-12
KAFR0A014201.271ON13982741722e-12
Suva_2.6871.52ON11281931722e-12
Kpol_1054.23.92ON10962771722e-12
KAFR0D033902.496ON7982241712e-12
NDAI0H024707.86ON14111841712e-12
YOL100W (PKH2)3.92ON10812341712e-12
SAKL0D05522g1.271ON14742301712e-12
NDAI0K021002.496ON9092351712e-12
Ecym_24058.668ON8551991702e-12
KAFR0F039704.192ON3843301682e-12
CAGL0M11396g8.279ON11922131712e-12
Kpol_2002.461.52ON11232381712e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03330
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   766   0.0  
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   530   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   529   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   521   e-180
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   519   e-179
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   520   e-179
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    512   e-179
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   511   e-178
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   514   e-177
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   513   e-177
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   506   e-175
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   500   e-174
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   501   e-174
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   505   e-174
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   500   e-174
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   498   e-173
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   501   e-173
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   500   e-172
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   494   e-171
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   496   e-170
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   493   e-169
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   478   e-165
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   477   e-164
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   471   e-161
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   469   e-161
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   469   e-160
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   464   e-158
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   445   e-152
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   439   e-148
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   432   e-146
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   433   e-140
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   381   e-126
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   306   9e-96
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   301   3e-94
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   304   9e-94
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   296   4e-92
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   293   3e-90
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   294   3e-90
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   288   9e-90
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   293   2e-89
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   290   1e-88
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   286   2e-88
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   289   2e-88
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   287   1e-87
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   287   1e-87
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   282   2e-87
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   286   3e-87
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   286   4e-87
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   280   4e-87
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   285   5e-87
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   283   9e-87
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   281   1e-86
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   281   3e-86
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   281   9e-86
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   278   7e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   278   1e-84
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   272   2e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   274   3e-82
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   105   4e-25
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   101   1e-22
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    98   1e-21
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    93   1e-20
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      95   2e-20
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    93   6e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    91   1e-19
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    92   1e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    91   1e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    92   1e-19
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    92   1e-19
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    92   2e-19
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    91   4e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    89   4e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             90   7e-19
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    90   8e-19
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    89   1e-18
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    88   1e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    89   2e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    88   4e-18
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    87   5e-18
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    87   6e-18
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    87   9e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    87   9e-18
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    85   1e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    86   1e-17
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    86   2e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    86   2e-17
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    85   2e-17
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    86   3e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    85   4e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    84   4e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    85   4e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    85   4e-17
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    84   4e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    84   6e-17
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    84   6e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    83   1e-16
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    84   1e-16
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    82   1e-16
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    82   1e-16
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    83   1e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    83   2e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    81   4e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    82   4e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    82   5e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    82   5e-16
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    82   5e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    81   5e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    81   7e-16
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     79   8e-16
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               80   9e-16
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    80   2e-15
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    80   2e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    80   2e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    80   2e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    80   2e-15
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   3e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    79   3e-15
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    79   3e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    79   3e-15
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    79   3e-15
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    78   3e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    78   4e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    79   4e-15
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    79   4e-15
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    79   4e-15
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    79   4e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    79   4e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   5e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    79   5e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    78   6e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    77   6e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    78   8e-15
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    78   8e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    78   8e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    78   8e-15
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    78   9e-15
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    77   1e-14
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    77   2e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     77   2e-14
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    76   2e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    77   2e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    77   2e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    75   2e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    76   2e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    76   2e-14
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    76   3e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    76   3e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    76   3e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    76   3e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    76   3e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    76   4e-14
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    76   4e-14
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    75   4e-14
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    75   6e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    75   6e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    75   6e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    75   6e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    75   6e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    75   7e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    74   7e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    75   7e-14
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    74   8e-14
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    75   8e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     75   9e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    74   9e-14
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    74   9e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    74   1e-13
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    74   1e-13
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    73   1e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    74   1e-13
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    73   1e-13
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    74   1e-13
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    74   1e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    74   1e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    74   1e-13
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    74   1e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    74   2e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    74   2e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    74   2e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    73   2e-13
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        73   2e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    74   2e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    74   2e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    74   2e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    74   2e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    74   2e-13
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    73   2e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    74   2e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    74   2e-13
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    73   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    74   2e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    73   3e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    73   3e-13
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    73   3e-13
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    73   3e-13
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    73   3e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    73   4e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    73   4e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    73   4e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    73   4e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    72   4e-13
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    72   5e-13
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    72   5e-13
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    72   5e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    72   5e-13
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   5e-13
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    72   5e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    72   5e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    72   5e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    72   6e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    72   6e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    71   6e-13
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    72   6e-13
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    71   6e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    71   7e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    72   8e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    72   8e-13
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    72   8e-13
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    71   8e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    72   8e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    72   9e-13
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    72   9e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    72   9e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    72   1e-12
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    71   1e-12
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    71   1e-12
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    71   1e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    71   1e-12
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    71   1e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    71   1e-12
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    70   1e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    71   1e-12
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    71   1e-12
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    70   1e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   1e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    71   1e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    71   1e-12
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     70   1e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    71   2e-12
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    71   2e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    71   2e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    70   2e-12
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    70   2e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    70   2e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    70   2e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    70   2e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    70   2e-12
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    69   2e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    70   2e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    70   2e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    70   2e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     70   2e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    69   3e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    70   3e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    70   3e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    70   3e-12
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    70   3e-12
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    70   3e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    69   3e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    69   3e-12
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    70   3e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    70   3e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    70   3e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    70   3e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    70   4e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   4e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    69   4e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    69   4e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    70   4e-12
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    69   4e-12
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    70   4e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   4e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    69   4e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     69   5e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    69   5e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    69   5e-12
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    69   5e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    69   5e-12
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    68   5e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    69   5e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    69   5e-12
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    68   5e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    69   5e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    69   6e-12
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    69   6e-12
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    69   7e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    69   7e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    69   7e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    69   8e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    68   8e-12
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    69   8e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    69   8e-12
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    69   8e-12
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    69   8e-12
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    68   9e-12
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    69   9e-12
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   1e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    68   1e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    67   1e-11
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    68   1e-11
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    68   1e-11
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    68   1e-11
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    68   1e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    68   1e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    68   1e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    67   1e-11
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    68   2e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              68   2e-11
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    68   2e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    67   2e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    68   2e-11
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    67   2e-11
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               67   2e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    67   2e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    67   2e-11
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    67   2e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    67   2e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   2e-11
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    67   2e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    66   2e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   2e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    67   2e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    67   2e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              67   2e-11
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    67   2e-11
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    67   2e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    67   3e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   3e-11
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    67   3e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    67   3e-11
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    67   3e-11
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    67   3e-11
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    67   3e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    67   3e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    66   3e-11
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    67   3e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    67   3e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    67   4e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    66   4e-11
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    66   4e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    65   4e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   4e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    66   4e-11
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    66   4e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    66   5e-11
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    66   5e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    66   5e-11
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    66   5e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    66   5e-11
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    66   5e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    66   5e-11
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    66   5e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    66   5e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    66   6e-11
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    66   6e-11
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    66   6e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    66   6e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    66   6e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    66   6e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    66   6e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    66   7e-11
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    65   7e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    66   7e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    66   7e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   7e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    65   7e-11
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    65   8e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    65   8e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    65   8e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    65   8e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    65   9e-11
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    65   9e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    65   9e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    65   9e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    65   9e-11
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    65   1e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       65   1e-10
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    65   1e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     65   1e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    65   1e-10
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    65   1e-10
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    65   1e-10
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    65   1e-10
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    65   1e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    65   1e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    65   1e-10
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    65   1e-10
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    65   1e-10
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    65   1e-10
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    65   1e-10
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    65   1e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    65   1e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    64   1e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   1e-10
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    64   1e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    65   1e-10
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    65   1e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    65   1e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    65   1e-10
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    65   1e-10
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    65   1e-10
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    65   2e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    65   2e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    64   2e-10
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    64   2e-10
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    65   2e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    64   2e-10
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    64   2e-10
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    64   2e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    64   2e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    64   2e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    64   2e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    64   2e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    64   2e-10
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    64   2e-10
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    63   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    64   2e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    64   2e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    64   2e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    64   2e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               64   2e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    64   2e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    63   2e-10
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    64   2e-10
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    64   3e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     63   3e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    63   3e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    63   3e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    64   3e-10
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    64   3e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    64   3e-10
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    64   3e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    64   3e-10
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    64   3e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    64   3e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    64   3e-10
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    64   3e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    64   3e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    64   3e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    64   4e-10
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   4e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   4e-10
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    64   4e-10
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    63   4e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    63   4e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    63   4e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    63   4e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    64   4e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    63   4e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    64   4e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    63   4e-10
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    64   4e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    62   4e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    63   4e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    63   4e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    63   4e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    63   4e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    63   5e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    63   5e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    63   5e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               62   6e-10
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    63   6e-10
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    63   6e-10
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    63   7e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    62   7e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    62   7e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    62   7e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    63   7e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    62   7e-10
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   7e-10
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    62   7e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    62   7e-10
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     62   8e-10
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   8e-10
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    61   8e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    62   8e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    62   8e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    62   8e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    62   8e-10
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    62   8e-10
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    62   9e-10
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    62   9e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    62   9e-10
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    62   9e-10
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    62   9e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   9e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    62   9e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    62   1e-09
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    62   1e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     61   1e-09
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     62   1e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    62   1e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    62   1e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    62   1e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    62   1e-09
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    62   1e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   1e-09
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    62   1e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    61   1e-09
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    62   1e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    62   1e-09
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    62   1e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    62   1e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    62   1e-09
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    62   1e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    62   1e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    62   1e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    62   1e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    61   1e-09
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    61   1e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    62   1e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    62   1e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    61   2e-09
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    61   2e-09
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    62   2e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    61   2e-09
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    61   2e-09
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    61   2e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    61   2e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    61   2e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    61   2e-09
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    61   2e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    61   2e-09
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    61   2e-09
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    61   2e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    61   2e-09
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    61   2e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    61   2e-09
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              60   2e-09
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    61   2e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    60   2e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    61   2e-09
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    61   2e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    61   2e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    61   2e-09
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    60   2e-09
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    61   2e-09
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    60   2e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    61   2e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   3e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    60   3e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    60   3e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    60   3e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    61   3e-09
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    60   3e-09
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    60   3e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   3e-09
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    60   3e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    60   3e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    60   3e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              60   3e-09
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    60   3e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    60   3e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    60   3e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       60   3e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    60   3e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    60   3e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    60   3e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    60   4e-09
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    60   4e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    60   4e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    60   4e-09
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    60   4e-09
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    60   4e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    60   4e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    60   4e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    59   4e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    60   4e-09
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    59   4e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    60   4e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    59   5e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    60   5e-09
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      60   5e-09
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    60   5e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    60   5e-09
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    59   5e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    59   6e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    59   6e-09
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    59   6e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    60   6e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    59   6e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    60   6e-09
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    59   6e-09
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    59   6e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   6e-09
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    60   6e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    60   6e-09
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    60   6e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    60   6e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    59   6e-09
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    59   6e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   6e-09
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    60   6e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    59   6e-09
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    59   7e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    59   7e-09
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    59   7e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    59   7e-09
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    59   8e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    59   8e-09
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    59   8e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   8e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    59   8e-09
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    59   8e-09
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    59   8e-09
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    59   8e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    59   9e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    59   9e-09
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    59   9e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    59   1e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    58   1e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    59   1e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    58   1e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    59   1e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    59   1e-08
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    59   1e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    59   1e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    59   1e-08
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    59   1e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    59   1e-08
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    59   1e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    59   1e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    58   1e-08
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    58   1e-08
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    59   1e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    58   1e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    59   1e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   1e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    58   1e-08
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    58   1e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    58   1e-08
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    59   1e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    59   1e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   1e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    59   1e-08
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    58   1e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    58   1e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    58   2e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    58   2e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   2e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    58   2e-08
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    57   2e-08
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    58   2e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    58   2e-08
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    58   2e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    57   2e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    58   2e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    57   2e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    57   2e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    58   2e-08
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    57   2e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    58   2e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    58   2e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    58   2e-08
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    58   2e-08
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    58   2e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    57   2e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    58   2e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     57   2e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    57   2e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   2e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     58   2e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    57   2e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    57   2e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    57   2e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    58   2e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    57   3e-08
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    57   3e-08
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   3e-08
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    57   3e-08
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    57   3e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   3e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    57   3e-08
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    57   3e-08
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    57   3e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    57   3e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    57   3e-08
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    57   3e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    57   3e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    57   3e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    57   3e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    57   3e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    57   4e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   4e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    57   4e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    57   4e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    57   4e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   4e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    57   4e-08
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    57   4e-08
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    57   4e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    57   4e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   4e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    56   4e-08
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    57   4e-08
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    57   5e-08
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    57   5e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    57   5e-08
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    57   5e-08
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    57   5e-08
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    57   5e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   5e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    56   5e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    57   5e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    57   5e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    56   5e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               57   5e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    57   5e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    57   6e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    56   6e-08
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    57   6e-08
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    57   6e-08
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    56   6e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    56   6e-08
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    56   6e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    56   6e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    56   6e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    56   6e-08
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    56   6e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    56   6e-08
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    56   6e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              55   6e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    56   7e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    56   7e-08
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    56   7e-08
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    56   7e-08
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    55   7e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    56   7e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    56   7e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    55   7e-08
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    56   8e-08
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    56   8e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    56   8e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    55   8e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    56   8e-08
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    56   8e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    56   8e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    56   8e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    55   8e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    55   8e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              56   8e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    55   8e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    56   8e-08
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    56   8e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    55   9e-08
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     56   9e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    56   9e-08
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    55   9e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    55   9e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    56   9e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    56   9e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    56   9e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    55   9e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    56   1e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     55   1e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    55   1e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    56   1e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    55   1e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    56   1e-07
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    56   1e-07
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    55   1e-07
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    55   1e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    55   1e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   1e-07
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    55   1e-07
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    55   1e-07
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    55   1e-07
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    55   1e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   1e-07
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    55   1e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   1e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    56   1e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    55   1e-07
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    55   1e-07
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    55   1e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    55   1e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    55   1e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    55   1e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              55   1e-07
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    55   1e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   1e-07
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    55   1e-07
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    55   1e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   1e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    55   1e-07
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    55   1e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    55   1e-07
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    55   1e-07
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    55   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    54   1e-07
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    55   2e-07
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    55   2e-07
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    55   2e-07
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    55   2e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   2e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   2e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   2e-07
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    55   2e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    54   2e-07
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    55   2e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    55   2e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    55   2e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    55   2e-07
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    55   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    55   2e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    55   2e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    54   2e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    55   2e-07
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    55   2e-07
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    55   2e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    55   2e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    55   2e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    55   2e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    54   2e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    55   2e-07
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    55   2e-07
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    55   2e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    55   2e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    55   2e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    55   2e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   2e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    55   2e-07
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    55   2e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    55   2e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    55   2e-07
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    54   2e-07
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    54   2e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    54   2e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    55   2e-07
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    54   2e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    55   2e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    54   3e-07
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    55   3e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    55   3e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    54   3e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    54   3e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    55   3e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    54   3e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   3e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    54   3e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               54   3e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    54   3e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    54   3e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    54   3e-07
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    54   3e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    54   3e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    54   3e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    54   3e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   3e-07
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    54   3e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    54   3e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   3e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    54   3e-07
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    54   3e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              54   3e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    54   3e-07
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    54   3e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    53   3e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    54   4e-07
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    54   4e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    54   4e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    54   4e-07
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    54   4e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    54   4e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    54   4e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   4e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    54   4e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    53   4e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   4e-07
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    53   4e-07
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    54   4e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    53   4e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   5e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   5e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    54   5e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    53   5e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    53   5e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               54   5e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    54   5e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    52   5e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               53   5e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    53   5e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    54   5e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    53   5e-07
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    53   5e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    54   5e-07
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    54   5e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   5e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    54   5e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    54   5e-07
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    53   5e-07
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    53   5e-07
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               53   6e-07
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    53   6e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    53   6e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    54   6e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    53   6e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    53   6e-07
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    53   6e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    52   6e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    53   6e-07
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    53   6e-07
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    53   7e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   7e-07
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              53   7e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    53   7e-07
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    52   7e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    52   7e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    53   7e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    52   7e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    53   7e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   7e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    53   7e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    53   7e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    52   8e-07
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    53   8e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    52   8e-07
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    53   8e-07
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    53   8e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    53   8e-07
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    53   8e-07
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    52   8e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    53   8e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    52   8e-07
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    52   9e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    53   9e-07
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    52   9e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    52   9e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    53   9e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    52   9e-07
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    52   9e-07
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    53   9e-07
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    50   9e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     52   9e-07
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    52   9e-07
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    53   9e-07
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    52   9e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    52   9e-07
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     52   9e-07
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    52   1e-06
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               52   1e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    52   1e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    52   1e-06
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    53   1e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    52   1e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   1e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    52   1e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   1e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   1e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    52   1e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   1e-06
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    52   1e-06
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    52   1e-06
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    52   1e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   1e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    52   1e-06
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    52   1e-06
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    52   1e-06
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    52   1e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    51   1e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    52   1e-06
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    52   1e-06
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    52   1e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    52   1e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    52   1e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    52   1e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    52   2e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    51   2e-06
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    52   2e-06
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    52   2e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    51   2e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   2e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   2e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    52   2e-06
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    51   2e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    52   2e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    51   2e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    51   2e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   2e-06
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    52   2e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    52   2e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    51   2e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    52   2e-06
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    51   2e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    52   2e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    52   2e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    51   2e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    51   2e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    52   2e-06
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    51   2e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    51   2e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    52   2e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    52   2e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    51   2e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    51   2e-06
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    51   2e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               51   2e-06
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    51   2e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    52   2e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    51   2e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    51   2e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    51   2e-06
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    51   2e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    50   2e-06
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    52   2e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    51   2e-06
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    51   2e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    51   2e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    51   2e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    51   2e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    52   2e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    51   2e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    51   2e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    51   3e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    50   3e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   3e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    51   3e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    51   3e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    50   3e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    50   3e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    50   3e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    50   3e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    51   3e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    51   3e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    51   3e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    51   3e-06
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    50   3e-06
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 51   3e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    51   3e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    50   3e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    50   3e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    51   3e-06
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    51   3e-06
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    51   3e-06
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    51   3e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    50   3e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    50   3e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    50   3e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    51   3e-06
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    50   3e-06
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    50   3e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    51   3e-06
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    51   4e-06
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    51   4e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    51   4e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    51   4e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    51   4e-06
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   4e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              51   4e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    50   4e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    50   4e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    50   4e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    50   4e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    50   4e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   4e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   4e-06
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    50   4e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    50   4e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    50   4e-06
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    50   5e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    50   5e-06
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    50   5e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    50   5e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    50   5e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    50   5e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    50   5e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   5e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    50   5e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    50   5e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   5e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    50   5e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    50   5e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    50   5e-06
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    50   5e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    50   5e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   5e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    50   6e-06
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    50   6e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   6e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    50   6e-06
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    50   6e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     50   6e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    50   6e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    49   6e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    50   6e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    50   6e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    50   6e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    50   6e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    49   6e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    50   7e-06
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    49   7e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    50   7e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    49   7e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    50   8e-06
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    50   8e-06
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   8e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    49   8e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    50   8e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    49   8e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    49   8e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    50   8e-06
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    49   8e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    49   8e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    49   8e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    49   8e-06
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    50   8e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     50   9e-06
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    49   9e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    49   9e-06
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    49   9e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    49   9e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    50   9e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    49   9e-06
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    49   9e-06
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    49   9e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   1e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    49   1e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    49   1e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    49   1e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    49   1e-05
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     49   1e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    49   1e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    49   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    50   1e-05
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    49   1e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    49   1e-05
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    49   1e-05
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    49   1e-05
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    49   1e-05
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    49   1e-05
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    49   1e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    49   1e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    49   1e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    49   1e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    49   1e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    49   1e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    49   1e-05
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    49   1e-05
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    49   1e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    49   1e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    49   1e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    49   1e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    49   1e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    49   1e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   1e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    49   1e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   1e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    49   1e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    49   1e-05
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    49   1e-05
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       49   1e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   1e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   1e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   1e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    49   1e-05
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    49   1e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    49   1e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    49   1e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    49   1e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    49   1e-05
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    48   1e-05
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    49   1e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    49   1e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    49   1e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    49   2e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    49   2e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   2e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   2e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   2e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    49   2e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   2e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    49   2e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    49   2e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    49   2e-05
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    49   2e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    49   2e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    48   2e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    49   2e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    49   2e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    48   2e-05
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    49   2e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    49   2e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    49   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   2e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    49   2e-05
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    49   2e-05
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    49   2e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    48   2e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    48   2e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    49   2e-05
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    48   2e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    48   2e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    48   2e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    49   2e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    49   2e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    48   2e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    48   2e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    48   2e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    48   2e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    48   2e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    48   2e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   2e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    48   2e-05
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    48   2e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    48   2e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    48   2e-05
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    48   2e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    48   3e-05
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    48   3e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   3e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    48   3e-05
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    48   3e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    48   3e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    48   3e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    47   3e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    48   3e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    48   3e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    48   3e-05
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    48   3e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    47   3e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    47   3e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   3e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    47   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    48   3e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    47   3e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    47   3e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    47   3e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    48   3e-05
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    48   3e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    48   3e-05
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    47   3e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    47   3e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    47   3e-05
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    47   4e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    47   4e-05
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    48   4e-05
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    47   4e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    48   4e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    47   4e-05
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    47   4e-05
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     47   4e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   4e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    47   4e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    47   4e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    47   4e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    47   4e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    47   4e-05
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    47   4e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    47   4e-05
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    47   4e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    47   4e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    47   4e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    47   4e-05
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    47   4e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    47   5e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    47   5e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    47   5e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   5e-05
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    47   5e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    47   5e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    47   5e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    46   5e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    47   5e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    47   5e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    47   5e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    47   5e-05
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    47   5e-05
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    47   5e-05
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    47   5e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    47   5e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    47   5e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    47   5e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    47   5e-05
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    47   5e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    47   5e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    47   6e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    47   6e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    47   6e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    46   6e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    47   6e-05
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    47   6e-05
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    46   6e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    47   6e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    47   6e-05
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    47   6e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    47   6e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    47   6e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    47   6e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   6e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    47   6e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    47   6e-05
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    47   6e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   6e-05
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    47   6e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    47   6e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   6e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    46   7e-05
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    47   7e-05
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    47   7e-05
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    47   7e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    46   7e-05
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    47   7e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    47   7e-05
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    47   8e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    46   8e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    46   8e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    47   8e-05
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              47   8e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    46   8e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    47   8e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    46   8e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    46   8e-05
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    46   8e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    47   9e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    46   9e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    46   9e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    46   9e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    46   9e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    46   9e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    46   9e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    46   9e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    46   9e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    46   9e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    46   9e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   1e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     46   1e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    46   1e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    46   1e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   1e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    46   1e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    46   1e-04
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    46   1e-04
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    46   1e-04
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    46   1e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    46   1e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    46   1e-04
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    46   1e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    46   1e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    46   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   1e-04
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    46   1e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    45   1e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    46   1e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    45   1e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    45   1e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    45   1e-04
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    45   1e-04
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    46   1e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    46   1e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    46   1e-04
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    45   1e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    45   1e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    46   1e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    46   1e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    46   1e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   1e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   1e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    46   1e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    45   2e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    45   2e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    45   2e-04
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    45   2e-04
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    45   2e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    45   2e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    45   2e-04
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    45   2e-04
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    45   2e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    45   2e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   2e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    45   2e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    45   2e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    45   2e-04
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    45   2e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    45   2e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    45   2e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    45   2e-04
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             45   2e-04
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    44   2e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   2e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    45   2e-04
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    45   2e-04
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               45   2e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    45   2e-04
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    45   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    45   2e-04
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    45   2e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    45   2e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    44   2e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    44   2e-04
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    45   2e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    45   2e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    45   2e-04
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    45   2e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    45   2e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   2e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    45   2e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    45   2e-04
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    45   2e-04
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    45   2e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   3e-04
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    45   3e-04
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    45   3e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    44   3e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    45   3e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    45   3e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    45   3e-04
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    45   3e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    44   3e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   3e-04
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    45   3e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    45   3e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    44   3e-04
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    44   3e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    45   3e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    44   4e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    44   4e-04
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    45   4e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               44   4e-04
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    44   4e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    44   4e-04
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    44   4e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    44   4e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    44   4e-04
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    44   4e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    44   4e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    44   4e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    44   4e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    44   4e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    44   4e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    44   4e-04
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   4e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    44   4e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    44   4e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    44   5e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    44   5e-04
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    44   5e-04
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    44   5e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    44   5e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    43   5e-04
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    44   5e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    44   5e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   5e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    44   5e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    44   5e-04
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    44   6e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    44   6e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    44   6e-04
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    44   6e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    43   6e-04
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    44   6e-04
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    44   6e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    44   6e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    44   6e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    44   6e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    44   6e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    44   6e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    44   6e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   6e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    44   6e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    44   7e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    44   7e-04
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    43   7e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    44   7e-04
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    44   7e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    43   7e-04
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    43   8e-04
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    43   8e-04
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    43   8e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    43   8e-04
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    43   8e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    44   8e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    43   8e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    43   8e-04
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    43   9e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    43   9e-04
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    43   9e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    43   9e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    43   9e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    43   0.001
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    43   0.001
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    43   0.001
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.001
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    43   0.001
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    43   0.001
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    43   0.001
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    43   0.001
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    43   0.001
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    43   0.001
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    43   0.001
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    43   0.001
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    43   0.001
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.001
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    43   0.001
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    43   0.001
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    43   0.001
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    42   0.001
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    43   0.001
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    43   0.001
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    43   0.001
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    43   0.001
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    42   0.001
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    43   0.001
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    43   0.001
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    43   0.001
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    43   0.001
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    43   0.001
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    43   0.001
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    42   0.001
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    43   0.001
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    43   0.001
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    43   0.001
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    43   0.001
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    43   0.001
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    42   0.001
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               42   0.001
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.001
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    42   0.001
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    42   0.001
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    42   0.002
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     42   0.002
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.002
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    42   0.002
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    42   0.002
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    42   0.002
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    42   0.002
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    42   0.002
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    42   0.002
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    42   0.002
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    42   0.002
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    42   0.002
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    42   0.002
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    42   0.002
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    42   0.002
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    42   0.002
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    42   0.002
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    42   0.002
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    42   0.002
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    42   0.002
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    42   0.002
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.002
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    42   0.002
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    42   0.002
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    42   0.002
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    42   0.002
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.002
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    42   0.002
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    42   0.002
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    42   0.002
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    42   0.002
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               42   0.002
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    42   0.003
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    42   0.003
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.003
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      42   0.003
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    42   0.003
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    42   0.003
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    42   0.003
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    41   0.003
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    41   0.003
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    42   0.003
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    42   0.003
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    42   0.003
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    42   0.003
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    42   0.003
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    42   0.003
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.003
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    42   0.003
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    41   0.003
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    41   0.003
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    41   0.003
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    41   0.003
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    41   0.003
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    41   0.004
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    41   0.004
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    41   0.004
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    41   0.004
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    41   0.004
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    41   0.004
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    41   0.004
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.004
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    41   0.004
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    41   0.004
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    41   0.004
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    41   0.004
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    41   0.004
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    41   0.004
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    41   0.004
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    41   0.005
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     41   0.005
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     41   0.005
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    41   0.005
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    41   0.005
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    41   0.005
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    40   0.005
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    41   0.006
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    40   0.006
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    40   0.006
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    40   0.006
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    40   0.006
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    40   0.006
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    40   0.006
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    40   0.006
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    40   0.006
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    40   0.006
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    40   0.006
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    40   0.006
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    40   0.007
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    40   0.007
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    40   0.007
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    40   0.007
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    40   0.007
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    40   0.007
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    40   0.007
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    40   0.007
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    40   0.007
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    40   0.007
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    40   0.008
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    40   0.008
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    40   0.009
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    40   0.009
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    40   0.009
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    40   0.009
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    40   0.009
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    40   0.009
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      40   0.009
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    39   0.009
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.009
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    40   0.010
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    40   0.010
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.010
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    40   0.010
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    40   0.010
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    40   0.011
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    39   0.011
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    40   0.011
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    40   0.011
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    40   0.011
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    40   0.011
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    40   0.011
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    40   0.011
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    39   0.011
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    39   0.012
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    40   0.012
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    40   0.012
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    40   0.012
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      40   0.012
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    39   0.012
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    40   0.013
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    40   0.013
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    39   0.013
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    39   0.013
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    39   0.013
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.014
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    39   0.014
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    39   0.015
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    39   0.015
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    39   0.016
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    39   0.016
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.016
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    39   0.016
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    39   0.016
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    39   0.017
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               39   0.017
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.018
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    39   0.019
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    39   0.019
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    39   0.020
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    39   0.020
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    39   0.020
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    39   0.021
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    39   0.022
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    39   0.022
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    38   0.022
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    39   0.024
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               39   0.027
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    39   0.027
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    39   0.029
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    39   0.030
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    38   0.032
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    38   0.033
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    38   0.034
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    38   0.034
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    38   0.034
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    38   0.034
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    38   0.034
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    38   0.035
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    38   0.036
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    38   0.036
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    38   0.036
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      38   0.036
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    38   0.037
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    38   0.037
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    38   0.037
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    38   0.038
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    38   0.039
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    38   0.040
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    38   0.041
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    38   0.041
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    38   0.041
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.044
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    38   0.044
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    38   0.045
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    38   0.049
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    38   0.050
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    38   0.051
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       38   0.051
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    37   0.053
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.054
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    37   0.054
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    37   0.055
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    37   0.055
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    37   0.056
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    37   0.057
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    37   0.060
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    37   0.060
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    37   0.062
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    37   0.064
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    37   0.065
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    37   0.066
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    37   0.066
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    37   0.068
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    37   0.070
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    37   0.070
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    37   0.074
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    37   0.075
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    37   0.076
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    37   0.081
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.081
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    37   0.083
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    37   0.088
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    37   0.091
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    37   0.093
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.093
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.094
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    37   0.094
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    36   0.097
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    37   0.11 
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    37   0.11 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.11 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    37   0.11 
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    36   0.12 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.12 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    36   0.12 
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    36   0.12 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             36   0.13 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    36   0.13 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    36   0.14 
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    36   0.14 
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    36   0.15 
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    36   0.15 
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    36   0.15 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    36   0.15 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    36   0.15 
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    36   0.16 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    36   0.16 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    36   0.16 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    36   0.18 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.18 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    36   0.18 
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    36   0.20 
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    35   0.22 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    35   0.22 
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    35   0.23 
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    35   0.24 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.26 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.27 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    35   0.29 
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    35   0.30 
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    35   0.30 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    35   0.30 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.34 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    35   0.37 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.37 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.38 
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    35   0.39 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    35   0.40 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    34   0.40 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    34   0.54 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    34   0.56 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    34   0.59 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               34   0.60 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    34   0.62 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    34   0.68 
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   0.70 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    34   0.71 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    34   0.76 
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    33   0.79 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    33   0.82 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   0.83 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    33   0.83 
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    33   0.93 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    33   0.98 
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    33   1.00 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    33   1.0  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    33   1.1  
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    33   1.1  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    33   1.1  
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    33   1.1  
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    33   1.2  
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    33   1.2  
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    33   1.2  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    33   1.2  
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    33   1.3  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    33   1.3  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    33   1.4  
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    33   1.6  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    33   1.6  
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    33   1.7  
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    33   1.8  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    32   1.8  
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    33   1.9  
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    32   1.9  
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    32   2.2  
Kpol_1001.25 s1001 complement(68111..72046) [3936 bp, 1311 aa] {...    32   2.5  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   2.6  
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    32   2.7  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    32   2.7  
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    32   2.7  
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    32   2.8  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    32   3.0  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    32   3.1  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   3.4  
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    32   3.4  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    32   3.5  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    32   3.7  
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    32   3.7  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   3.7  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    31   4.0  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    31   4.1  
NCAS0A13090 Chr1 complement(2575145..2576440) [1296 bp, 431 aa] ...    31   4.1  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    32   4.3  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    31   4.3  
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     32   4.3  
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    31   4.5  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    31   4.8  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    31   4.9  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    31   5.3  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    31   5.4  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    31   6.8  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    30   9.5  

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPMIDH 360
           QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPMIDH
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPMIDH 360

Query: 361 QLKKIKRFH 369
           QLKKIKRFH
Sbjct: 361 QLKKIKRFH 369

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 279/330 (84%), Gaps = 1/330 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I  Y PGT+L VGSH+V+++KY+TSGGFAQIYTV+ISPPD F ++N+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHA+K N N GSYEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQ RL E E+L+I SQV QGIAAMHAL PPLLHRDIKIENVL++   +YK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V GIIRPP N QE+ YVQHD++KNTTAQYR+PEMID YRGLPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEKN GEAAIL A +++PN+P YS+RLK LI  MLME P QRPN YQV+EE+S M
Sbjct: 241 YYTTPFEKN-GEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVN 330
           QNV CPI NFYL+        + +Q  P N
Sbjct: 300 QNVQCPIPNFYLMNNNVTQGQMAMQTQPQN 329

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/341 (73%), Positives = 286/341 (83%), Gaps = 6/341 (1%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I  Y+PGT+L VGSH  ++I Y+TSGGFAQ+Y+ EI P D+F DSN+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHA+KS+F NGSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L+I SQV QGIAAMHALQPPL+HRDIKIENVLIS + QYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP NPQE  YVQHDVLKNTTAQYRSPEMID YRG PIDEKSDIWA+GVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GGE AIL +R+++P  PIYS+RLK LI  MLMENP QRPN+ QV+E++S+M
Sbjct: 241 YYTTPFEK-GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPIL 341
           Q + CP+ NFYL+       M Q Q    N L  S+T P+L
Sbjct: 300 QGIQCPVRNFYLL-----RAMEQQQQSTQNQLRYSRTQPVL 335

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  521 bits (1341), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 270/313 (86%), Gaps = 2/313 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I  Y PGTIL VGSH  +IIKY+TSGGFAQ+Y+ EISPPD +  +NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHA+KS  N  +YEVF+LMEYCERGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRL+NRL ESE+L I  Q  QGIAAMHALQPPL+HRDIKIENVLIS    YK+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP NPQE  YVQHD+L NTTAQYRSPEMID YRGLPIDEKSDIWA+GVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GEAAIL ARY+YP+FP YS+RLK+LI  MLME P QRPNI QV+EE+S++
Sbjct: 240 YYTTPFEKT-GEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 301 QNVPCPIVNFYLV 313
           QN PCPI NFYL+
Sbjct: 299 QNRPCPIRNFYLL 311

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  519 bits (1337), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 232/327 (70%), Positives = 283/327 (86%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I+T+  G IL VGSH  ++IKY+TSGG+AQ+Y VEISP D + +SNIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN+HVVSYIDSHASKS   NG+YEVF+LME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MN+RLQ+RLTE+E+L+I S  +QGIAAMH LQP LLHRDIKIENVLIS++N+YK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V GI+RPP N QE  +V HD++KNTTAQYRSPEM+D  +GLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEKNGGEAAIL AR++YP++P+YS+RLK+LI  ML +NP  RPN+ QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPI 327
           Q +PCPI NFYL+   + +K    QP+
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPV 327

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  520 bits (1338), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 245/334 (73%), Positives = 277/334 (82%), Gaps = 2/334 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I  Y PGTIL VGSH  +IIKY+TSGGFAQ+YT EISPPD + ++NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P K  LNTLRAEVDAMKLLRNNKHVVSYIDSHA++S  N  +YEVF+LME+CERGGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL ESE+L I SQ  QGI AMHALQPPL+HRDIKIENVLIS    YK+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP N QE  YVQHD+L NTTAQYRSPEMID YRGLPIDEKSDIWA+GVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK+ GEA IL ARY+YP+FP YS+RLK+LI  MLME P QRPNI QV+EE+S++
Sbjct: 240 YYTTPFEKS-GEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNV 334
           QN PCPI NFYL+    ++   QL   P +T  V
Sbjct: 299 QNKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYV 332

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  512 bits (1319), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP++  YHPGT+L VGSHQ RIIKY+TSGGFAQ+YT EISP D F +S+I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNN HVVSYIDSHA+K + N GSYEVFLLMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E+E+L I SQV+QG+AAMHALQPPLLHRDIKIENVL++    YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V GIIRPP NPQE  YVQHD++KNTTAQYRSPEMI+  +GLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL A +++PNFP YS+R+K LI   L   P QRPNIYQ++EE+SK+
Sbjct: 241 YYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299

Query: 301 QNVPCPIVNFYL 312
           QNVPCPI +FYL
Sbjct: 300 QNVPCPIPDFYL 311

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  511 bits (1315), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/354 (68%), Positives = 288/354 (81%), Gaps = 13/354 (3%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV I+KY+TSGGFAQ+Y+  ISPPD    SNIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LLRNN++VVSYIDSHA+K+  +NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L I SQV QG+AAMHALQPPL+HRDIKIENVLIS +N+YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP NPQEL YVQ D+ KNTTAQYRSPEM+D +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GGE AILS  +E+P +P YSE+L+ LI  +L++NP QRPN+YQ+++ IS M
Sbjct: 241 YYTTPFEK-GGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSS 354
           QNVPCPI +            +Q+   P + LN+++ H +      R L  HS+
Sbjct: 300 QNVPCPISD------------IQVPQAPDSHLNLTELHQLSATQNIRSLNSHST 341

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  514 bits (1324), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/326 (73%), Positives = 274/326 (84%), Gaps = 2/326 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I  Y PGTIL VGSH  +IIKY+TSGGFAQ+YT EISPPD + ++NIACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHA+KS  N  +YEVF+LME+CERGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL ESE+L I SQ  QGIAAMHALQPPL+HRDIKIENVLIS +  YK+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP N QE  YVQHD+L NTTAQYRSPEMID YRGLPIDEKSDIWA+G+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK+ GEA IL ARY+YP FP YS+RLK+LI  MLME P +RPNI QV+EE+S++
Sbjct: 240 YYTTPFEKS-GEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQP 326
           Q  PCPI NFYL+    +   +  +P
Sbjct: 299 QIKPCPIRNFYLLRAMSQTAQLASEP 324

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  513 bits (1321), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 241/339 (71%), Positives = 277/339 (81%), Gaps = 2/339 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I  Y PGT+L VGSH  +IIKY+TSGGFAQ+YT EISPPD + ++N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHA+KS  N  +YEVF+LME+CERGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQ+RL ESE+L I SQ  QGIAAMH LQPPL+HRDIKIENVLIS    YK+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP N QE  YVQHD+L NTTAQYRSPEMID YR  PIDEKSDIWA+GVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GEAAIL +RY+YP+FP YS+RLK LIH MLME P QRPNI QV+EE+S++
Sbjct: 240 YYTTPFEK-SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHP 339
           QN PCPI NFYL+    ++  +  +P  V  ++  Q  P
Sbjct: 299 QNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLP 337

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  506 bits (1304), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 244/361 (67%), Positives = 287/361 (79%), Gaps = 15/361 (4%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I TY PGT+L VGSH  +IIKY+TSGGFAQIYT EISP + + +S  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN+HVVSYIDSHA++S    G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRLTE E+L+I SQ  QG++AMHALQP L+HRDIKIENVLIS   ++KICDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V   IRPP NPQEL YVQHDVLKNTTAQYR+PEM+D YRGLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GGEAAIL +RY+YP FPIY+++LK+LI A LME+P +RPNI Q++EEIS++
Sbjct: 241 YYTTPFEK-GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPMIDH 360
           Q +PCPI NFYL       + + +Q         S  +PI+   +Q  L+   SS  I  
Sbjct: 300 QGIPCPINNFYL------SRTINVQ--------ASLMNPIITPTQQTALKHSQSSATISD 345

Query: 361 Q 361
           Q
Sbjct: 346 Q 346

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/312 (73%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I TY  GT L VGSHQV+IIKY+T+GGFAQIY   ISP D F  +NIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAMKLLRNN+ VVSYIDSHA+KS+F NG+YEVFLLMEYCE GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           +N+RLQNRL ESEV++I   V+QG+AAMHALQPPL+HRDIKIENVL+SK+N++K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG IRPP NPQEL  VQ+D+++NTTAQYRSPEMID  RG PIDEKSDIWA+GVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK+ GEA IL++RYE+P FP YS+RL+HLI  +L   P+ RPNIY V++E+S M
Sbjct: 241 YYTTPFEKS-GEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299

Query: 301 QNVPCPIVNFYL 312
           +N+ CPI+NFYL
Sbjct: 300 KNISCPIINFYL 311

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  501 bits (1291), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 240/357 (67%), Positives = 289/357 (80%), Gaps = 15/357 (4%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+  I+PPD   +S++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHA+K+  +NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L I SQV QG+AAMHALQPPL+HRDIKIENVLIS +N+YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V GIIRPP N QEL YVQ D+LKNTTAQYRSPEMID +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GG+ AILS ++E+P +P YSE+LK LI  +L+++P  RPN+YQ+++ IS M
Sbjct: 241 YYTTPFEK-GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQRILEQHSSSPM 357
           QNVPCPI +  +V     H            LN+++ H +     Q IL  +S + M
Sbjct: 300 QNVPCPINDIQVVQAPSSH------------LNLTELHQL--SATQNILSLNSPTTM 342

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  505 bits (1301), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/312 (74%), Positives = 273/312 (87%), Gaps = 2/312 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           M+QP ++TY  GT+L VGSH+ RIIKY+TSGGFA IY+ EISPPD    S+IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLN+LRAEVDAMKLL+ +K VVSYIDSHA+KS+ NNGSYEVFLLMEYC RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E EVL I SQV+QG+AAMHALQPPL+HRDIKIENVLIS+   +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP NPQEL YVQHD+LKNTTAQYRSPEMID YRGLP+DEKSDIWA+GVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL +++++P +P YS++LK+LI A+L ENP QRPNI Q++ E+S++
Sbjct: 240 YYTTPFEK-AGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRI 298

Query: 301 QNVPCPIVNFYL 312
           Q VPCP+ NFYL
Sbjct: 299 QGVPCPVKNFYL 310

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  500 bits (1287), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/319 (73%), Positives = 273/319 (85%), Gaps = 1/319 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+V ISPPD   ++N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN++VVSYIDSHA+K+   NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L I SQV QG+AAMHALQPPL+HRDIKIENVLIS +N+YK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V GIIR P N QEL YVQ D+LKNTTAQYRSPEMID +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GGE AILS ++E+P +P YSE+LK LI  +L++NP  RP+++Q+++ IS M
Sbjct: 241 YYTTPFEK-GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299

Query: 301 QNVPCPIVNFYLVTQQQKH 319
           QNVPCPI +   V     H
Sbjct: 300 QNVPCPINDIQTVQAPSSH 318

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 274/319 (85%), Gaps = 1/319 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I TY+ GT L VGSHQV IIKY+TSGGFAQ+Y+  ISPPD   +SN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN++VVSYIDSHA+K+  +NGSYEVF+LMEYCERGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL ESE+L I  QV QG+AAMHALQPPL+HRDIKIENVLIS  N+YK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP NPQEL YV+ DVLKNTTAQYRSPEM+D +RGLPIDEKSDIWA+G+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GGE AIL+ ++E+  +P YSE+L++LI  +L++NP QRPN++Q++++I+ M
Sbjct: 241 YYTTPFEK-GGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299

Query: 301 QNVPCPIVNFYLVTQQQKH 319
           QN P PI +   V +   H
Sbjct: 300 QNAPYPIRDVQTVQRPSNH 318

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  501 bits (1291), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/340 (67%), Positives = 283/340 (83%), Gaps = 2/340 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I+ Y  GTILPVGSHQV+++KY+ SGGFA +Y+VEISPPD  C  N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLNTLRAEVD+MK LR NK +VSYIDSHA+KS  N G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L+I SQV+QG+AAMHALQPPL+HRDIKIENVL+SK++++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IR P N +E  YVQ+D++KNTTAQYR PEMID YRGLPIDEKSDIWA+GVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEKN GE+AIL++++E+P +P YS+R+K+LI  ML  +P +RPNI QV+EE+S++
Sbjct: 241 YYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIP-VNTLNVSQTHP 339
           Q +PCPI NFYL+    K +  ++ P P V  + V  T P
Sbjct: 300 QGIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVP 339

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  500 bits (1287), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 242/352 (68%), Positives = 282/352 (80%), Gaps = 12/352 (3%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I  Y  GT+L VG+H+  I KY+TSGGFAQIY VEI+P D++  SN+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN+HVVSYIDS+A KS FNNGSYEV LLMEYCE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MN+RLQNRL+E+E+L+I SQ AQG+A MHALQP LLHRDIKIENVL S + ++K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G IRPP N QEL YVQHD+LKNTTAQYR PEM+D YRGLPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL ++++YP FPIYS+RLK+LI  ML ENP +RPNI +++EEIS +
Sbjct: 241 YYTTPFEKT-GENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSI 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQ----------PIPVNTLNV-SQTHPIL 341
           Q VPCPI NFYL+  QQ    +QLQ            P+  LN  +QT PI+
Sbjct: 300 QGVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPII 351

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  494 bits (1273), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/321 (72%), Positives = 270/321 (84%), Gaps = 1/321 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP++D  + GT L VG+H V+I+KY+TSGGFAQIY VEI     F  SN+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLL NNKHVVSYIDSHA++S  N+G+YEVFLLMEYCE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRLTE E+L I SQ  QGIA MHAL PPLLHRDIKIENVL+SK   YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP N QEL YVQHD++KNTTAQYR PEM+D YRGLPIDEK+DIWA+GVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL AR+++P+FP YS+RLK+LI +ML E+P  RPN+ QV+EE+S+M
Sbjct: 241 YYTTPFEK-LGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKM 321
           QNVPCPI NFYL+   +K K+
Sbjct: 300 QNVPCPIRNFYLLRAMEKVKL 320

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  496 bits (1277), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/313 (73%), Positives = 261/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQ   D Y PGT L VGSH+ RIIKY+TSGGFA IYT EI P D    + IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N+HVVSYIDSHA+KS  ++GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E EVL ITS + QGIAAMHALQPPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP NPQE  YVQHD+LKNTTAQYR+PEMID YRG PI+EKSDIWA+GVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GEAAIL +R+++P++P YS+ LKHLI  ML ENP QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKV-GEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299

Query: 301 QNVPCPIVNFYLV 313
           Q  PCP+ NFY+ 
Sbjct: 300 QGTPCPLRNFYVT 312

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  493 bits (1270), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/313 (73%), Positives = 262/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP    Y  GT L VGSHQ RIIKY+TSGGFA IY+ EISP D     N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLN LRAEVDAMKLLR NKHVVSYIDSHA+KS   +GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRLTE+EVL I S + QGIAAMHAL PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP N QE  YVQ+D+LKNTTAQYRSPEMID YRG PI+EKSDIWA+GVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  G+AAIL +R+++P +P YS+RLK+LI  ML ENP+QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKV-GDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRI 299

Query: 301 QNVPCPIVNFYLV 313
           QNVPCP+ NFYL+
Sbjct: 300 QNVPCPLRNFYLL 312

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  478 bits (1231), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/316 (71%), Positives = 263/316 (83%), Gaps = 5/316 (1%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP+I  Y PG ILPVGSHQ +I+KY+TSGGFAQ+Y VEISP D    SNIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKS----NFNNGSYEVFLLMEYCERGG 116
           PDK SLN  RAEV+AMKLLRNNK+VVSYIDSHA+KS       NGSYEVFLLMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176
           LIDFMNTRLQNRL E E+L+I S V+QG+AAMHALQPPLLHRDIKIENVLIS  N++K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFL 236
           DFGSV G+IRPP N  EL +VQHD+LKNTTAQYRSPEM+   + +PI+EKSDIWA+GVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296
           YK+CYYTTPFEK  GE AIL +RY+YP +P YS+ LK+LI  MLM +P +RPNI QV+EE
Sbjct: 241 YKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299

Query: 297 ISKMQNVPCPIVNFYL 312
           +S++Q VPCP+ NFYL
Sbjct: 300 VSRLQGVPCPLKNFYL 315

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  477 bits (1228), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 232/363 (63%), Positives = 278/363 (76%), Gaps = 7/363 (1%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I  Y PGT L VG HQV IIKY+TSGGFAQIY V+++PP+     N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+A++S  N+G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E EVL+I +QV QGI AMH+L PPL+HRDIKIENVLIS + +YK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSGIIRPP N +E  +VQ D++KNTTAQYR PEM+D YRG PI+EKSDIWA+GVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFE NGGE AIL ARY+YP +P+YS RLK+LI  MLME P QRPN+ QV+EE+S M
Sbjct: 241 YYTTPFE-NGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSM 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQ-----LQPIPV-NTLNVSQTHPILQDGKQRILEQHSS 354
           Q +PCP+ NFYL  QQ    M+      + PIP  NT+      P+      +I  QHSS
Sbjct: 300 QGIPCPLPNFYLQRQQATQLMMNNTNGSIYPIPTQNTMMNQMPPPMNMMNNSQIAAQHSS 359

Query: 355 SPM 357
           + M
Sbjct: 360 NMM 362

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  471 bits (1212), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I TY  G  L VG H   I+KY+TSGG+AQ+Y  +ISPPDS   S+I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+A+KS  +NG+YEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L+I SQV QG+AAMH+L+PPLLHRDIKIENVLIS S +YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP + QE  +VQHD+LKNTTAQYR+PEMID  R LPIDEKSDIWA+GVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GEAAIL +RYEY  +P YS+ LK+LI  ML   P QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEK-AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRL 299

Query: 301 QNVPCPIVNFYL 312
           Q +PCPI NFYL
Sbjct: 300 QGIPCPIKNFYL 311

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  469 bits (1207), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/317 (68%), Positives = 258/317 (81%), Gaps = 1/317 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P+I TY PGT+L VG+H  +I+KYI SGGFAQ+Y+ E+ P D+   +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +KHVV YIDSHA++S   NG+YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRL E E+L+I SQV QGIAAMHALQPPL+HRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG IRPP NPQE  +VQHD+LKNTTAQYRSPEMID YR   IDEKSDIWA+G+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK GG+ AIL +RY++   PIYS+RLK+LI  ML + P QRPNI QV+EE+S+M
Sbjct: 241 YYTTPFEK-GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299

Query: 301 QNVPCPIVNFYLVTQQQ 317
           Q V  P+ NFYL+   Q
Sbjct: 300 QGVSSPMRNFYLLRAMQ 316

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  469 bits (1207), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/312 (70%), Positives = 256/312 (82%), Gaps = 2/312 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQ   D++ PGT+L VGSH+V+++KY+TSGGFAQIY  E+  PDS    ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLNTLRAEVDAMKLLR NKH+VSYIDSHASKS  NNGSYEV LLMEYC RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQ+RL E EVL I +QV QGI AMHALQPPL+HRDIKIENVLI+++   K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP N  EL YVQHD+LKNTTAQYR+PEMID YRG  +DEKSDIWA+GVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL A +++P++P YS RLK+LI  ML ENP  RPN  QV+EE+ ++
Sbjct: 240 YYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298

Query: 301 QNVPCPIVNFYL 312
           Q  PCP+ NFYL
Sbjct: 299 QGQPCPVKNFYL 310

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  464 bits (1194), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 219/319 (68%), Positives = 264/319 (82%), Gaps = 4/319 (1%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQ   D   PG IL VGSH+V+II+Y+TSGGFAQIY+ E+  P     S +ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDKPSLNTLRAEVDAMK+L+ ++HVVSYIDSHA+KS  ++G+YEV+LLMEYC RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MN+RLQ RL+E EVL I S VAQGI AMHAL PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG+IRPP N  E  YVQHD+LKNTTAQYR+PEMID YR LP+DEKSDIWA+GVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           Y+TTPFEK  GE AIL A++++P++P Y++RLK+LI  ML E+P QRPNI QV+EE+S++
Sbjct: 240 YFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 301 QNVPCPIVNFYLVTQQQKH 319
           Q VPCP+ NFYL  ++ KH
Sbjct: 299 QGVPCPLPNFYL--ERMKH 315

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 257/314 (81%), Gaps = 1/314 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MN P I  Y PGT + VGSH V I+KY+TSGG+AQIY+ +I P D F  +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK  LNTLRAEVDAMK L+++K++VSYIDSHA+KS + +G+YEVFL+MEYC RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNTRLQNRLTE+E+L+I   ++QG+AAMH LQPPL+HRDIKIENVLIS  ++YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG IRPP  P+EL YV+HD++ +TTAQYR+PEM+D  +G  +++KSDIWA+GVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFE+  GEA IL+   E+P +P YS+ +K LI +ML +NP  RPNI+Q+I+ +SK+
Sbjct: 241 YYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299

Query: 301 QNVPCPIVNFYLVT 314
            NV CPI N ++ T
Sbjct: 300 LNVNCPIPNIHVPT 313

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 267/340 (78%), Gaps = 10/340 (2%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQP I  Y PG ++ VGSHQ +I+KY+TSGGFAQIY+VEISP D + +SNIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P+K  LN LR EVDAMKLL+NN+HVVSYIDS+A+KS F NGSYEVFLLMEYCERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MNT+L+ RL E EVL+I +QV QGIAAMH L PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEK---SDIWAIGVFLY 237
           V GIIRPP NPQELQYVQHDV+KNTTAQYRSPEMID  +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
            L +YT  F ++  E AIL+ RY+YP +PIYS+RLK+++  +L  +P +RPNI Q++EEI
Sbjct: 241 -LLHYT--FRED-REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 298 SKMQNVPCPIVNFYLVTQQQKHK-MVQLQPIPVNTLNVSQ 336
           SK+QN+PCPI NFYL  ++ +H+  V + P+  +  N +Q
Sbjct: 297 SKIQNIPCPIDNFYL--ERSRHQGAVSVMPVNFSRANTTQ 334

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  432 bits (1112), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 275/358 (76%), Gaps = 9/358 (2%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           MNQ ++  Y P T++ VGSH  +I+KY+ SGG+AQ+Y+  ++P D    +NIACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PDK SLN LRAEVDA+K+LRN K+VVSYIDSHASK + + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           +NTRL+NRL E E+L I +QVA G+A MH LQP L+HRDIKIEN+LIS++ +YK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           V G+IRPP + +E++Y+QHD++KNTTAQYRSPEM+D  +G  I+EKSDIWA+GVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFEK  GE AIL ++++YP +P+YS+ LK++I  +L  +P +RPNI Q+IEE+S++
Sbjct: 241 YYTTPFEKE-GEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRL 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPI--LQDGKQRILEQHSSSP 356
           Q +  P+ NFYL    +   +  +QP+  N+  V    PI  +QD  +R +    SSP
Sbjct: 300 QGIVPPMKNFYLSRALETSSL--MQPLQNNSYKV----PISDIQDKHKRQIPNIQSSP 351

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  433 bits (1114), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 257/343 (74%), Gaps = 13/343 (3%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSN----IACLK 56
           MNQP+I  Y  G +LP+G+HQV I KY+  GGFAQ+Y+V +   DS    N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGG 116
           RVIVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC RGG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176
           +IDF+NTRL +RL E E+L I S V QG+AAMH LQPPL+HRDIKIENVLIS++  YKIC
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFL 236
           DFGS   ++RPP  PQE  ++ HD++ NTTAQYRSPEMID Y G PIDEKSDIWA+GVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296
           YKLCYYTTPFEK  GE AIL+ ++++P++P YS+ ++++I  ML ++P +RPNI QV+E+
Sbjct: 239 YKLCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297

Query: 297 ISKMQNVPCPIVNFYLV------TQQQKHKMVQLQPIPVNTLN 333
           +SK+Q VPCPI NF L       ++   +K   L     N+ N
Sbjct: 298 VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFN 340

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  381 bits (978), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 239/331 (72%), Gaps = 3/331 (0%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           M+Q   D Y  GT L V SH+V I  Y+TSGGFAQ+YT  I+         + CLKRVIV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P+K SLN LRAEVDAMK+L+NNK++VSYIDSHA++   +  SY V LLMEYC   GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MN RL+ RL E E+L I + V+QG+  MH LQPPLLHRDIKIENVL+S    +K+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
           VSG++R P + +E  Y+Q+D+LKNTTAQYRSPEM++   G PI+EKSDIWA+G+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           YYTTPFE++G   AI+  ++ YP +P Y++ LK++I  +L  NP QRPNI Q++EE+ ++
Sbjct: 241 YYTTPFEEHGSR-AIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRI 299

Query: 301 QNVPCPIVNFYLVTQQQKHKMVQLQP--IPV 329
           Q+   P+ NFY+       +M   QP  IP+
Sbjct: 300 QHKSSPLPNFYVQRAMSSLQMDTTQPHRIPI 330

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  306 bits (783), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 210/326 (64%), Gaps = 23/326 (7%)

Query: 7   DTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI--------SPPDSFCDSNI------ 52
           + ++PG ++ VG H+V IIKY+  GGFAQIY+V          + PDS  DSNI      
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 53  -------ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEV 105
                  ACLKRV+VPD+  LN LR EV+ M+ L+   ++V Y DS+AS+ +  N  +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 106 FLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENV 165
            LLME C    L+D+MN RL  +L+E E+L I   V  GI+ MH LQ PL+HRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 166 LISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDE 225
           L+  SN +K+CDFGS S       + QE+  +  ++  +TT QYRSPEMID YR LPIDE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 226 KSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPH 285
           KSDIWA+GVFLYKL +YTTPFE   G+ AIL ++YE P    YS RL +LI  ML ENP+
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMT-GQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPN 314

Query: 286 QRPNIYQVIEEISKMQNVPCPIVNFY 311
            RPNIYQV+ ++     +  PI + Y
Sbjct: 315 LRPNIYQVMHQVCITIGIEPPIKDKY 340

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  301 bits (770), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 207/316 (65%), Gaps = 10/316 (3%)

Query: 4   PKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI--------SPPDSFCDSNIACL 55
           P ++   PGT++ VGSH+V I+KY+  GGFA IY V+         +P  S  + ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERG 115
           KRV+V D+  LN LR EV+ MK L+N+ ++V Y DS+AS+    +  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKI 175
            L+D+MN RL  +L+E EVL I   V + +A MH L  PL+HRDIKIENVL+   N +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVF 235
           CDFGS S         Q++  + +++  +TT QYR+PEMID YR LPIDEKSDIWA+G+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           LYKL +YTTPFE   G+ AIL ++Y+ P    YS +L +LI  ML ENP+ RPNIYQVI 
Sbjct: 267 LYKLLFYTTPFELT-GQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIY 324

Query: 296 EISKMQNVPCPIVNFY 311
           ++  +  V  P  + Y
Sbjct: 325 QVCAIMKVDVPFEDKY 340

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  304 bits (778), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 158/323 (48%), Positives = 217/323 (67%), Gaps = 21/323 (6%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDS--------------- 50
           I+ +  G  + VGSH V I+KY+T GGFAQIY V+++   +  D+               
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  NIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLME 110
           ++ CLKRV+V D+  L+ ++ EV+ MK LR   +VV Y DS+A+++   NG +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKS 170
           YC    L+D+MN RL  +LTESE+L+I   +  G++ +H L  PL+HRDIKIENVL+  +
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 NQYKICDFGSVSGIIRPP--HNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSD 228
           N++K+CDFGS +  I PP     Q++  + HD+  +TT QYRSPEMID +R LP++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRP 288
           IWA+GVFLYKL +YTTPFE   G+ AIL ++YE P    YSERL +LI  ML ENP+ RP
Sbjct: 264 IWALGVFLYKLLFYTTPFELT-GQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRP 321

Query: 289 NIYQVIEEISKMQNVPCPIVNFY 311
           NIYQV+ EI  + NV  PI + Y
Sbjct: 322 NIYQVLSEICSILNVEVPIPDIY 344

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  296 bits (758), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 215/327 (65%), Gaps = 25/327 (7%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTV-----------EISP--PDSFCDSNI 52
           ++ Y PG ++ VGSH+V I++YI  GGFAQIY+V           E SP   D     ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGS--------YE 104
           ACLKRVIV D+  LN LR EV+ MK L    ++V Y DS+AS+    NG+        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V LLME C    L+D+MN RL  +L+E E+L +   V+  IA MH L+ PL+HRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           VL+ + N++K+CDFGS S         +++ Y+  ++  +TT QYRSPEMID YR LPID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENP 284
           EKSDIWA+G+FLYKL ++TTPFE+  G+ AIL +++E+P    YS +L +LI  ML ENP
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERT-GQFAILHSKFEFPQNN-YSFKLINLIIVMLSENP 310

Query: 285 HQRPNIYQVIEEISKMQNVPCPIVNFY 311
           + RPNIYQV+ +I +++ VP PI + Y
Sbjct: 311 NLRPNIYQVLHQICQLKQVPIPIADKY 337

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  293 bits (751), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 211/321 (65%), Gaps = 12/321 (3%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE----------ISPPDSFCDS 50
           +N P  + Y  G ++ VG+H+V I+ Y+  GGFAQIY V+          +    +    
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLME 110
           +IACLKRVIV D+  LN +R EV+ MK L+++ ++V Y DS+AS+       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKS 170
            C    L+D+MN RL+ +L+ESE+L I   V+ GI+ MH L  PL+HRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 NQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIW 230
           N +K+CD GS S    P  + Q++  +  ++  +TT QYR+PEMID YR LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 AIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
           A+G+FLYKL +YTTPFE   G+ AIL ++Y++P    YS ++ +LI  ML ENP+ RPNI
Sbjct: 252 ALGIFLYKLLFYTTPFEIT-GQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNI 309

Query: 291 YQVIEEISKMQNVPCPIVNFY 311
           +QV+  I  + N+P PI + Y
Sbjct: 310 FQVVYHICSIMNLPVPIEDRY 330

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  294 bits (753), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 204/321 (63%), Gaps = 13/321 (4%)

Query: 2   NQPK-IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSN--------- 51
           N+P  ++ +  G+ + VG+ +V I+KY+T GGFAQIY V+     +  DSN         
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 52  -IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLME 110
            +ACLKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+AS+       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKS 170
            C    L+DFMN RL  +L+E E+L+I   V   +A MH L PPL+HRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 NQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIW 230
           N +K+ DFGS S         Q++  +  D+  +TT QYRSPEMID Y+ LPIDEKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 AIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
           A+G+FLYKL +Y TPFE   G+ AIL ++Y++P    YS RL +LI  ML ENP+ RPNI
Sbjct: 257 ALGIFLYKLLFYITPFEMT-GQFAILHSKYDFPQTN-YSSRLINLIIIMLSENPNLRPNI 314

Query: 291 YQVIEEISKMQNVPCPIVNFY 311
           YQV+ EI  +      I + Y
Sbjct: 315 YQVLHEICSISGTRLEITDKY 335

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  288 bits (738), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 204/318 (64%), Gaps = 12/318 (3%)

Query: 4   PKI-DTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIA--------- 53
           PK+ D+Y PGTI+ VG H+V ++KY+  GGFA+IY V+     S  D N           
Sbjct: 23  PKVLDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQL 82

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCE 113
           CLKRV+V D   LN +R EV+ M+ L+    VV Y DS+AS+       YEV LLME C 
Sbjct: 83  CLKRVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCS 142

Query: 114 RGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQY 173
              L+D+MN RL  +L+E E+L I   V   +A MH L  PL+HRDIKIENVL+   N +
Sbjct: 143 NNSLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNF 202

Query: 174 KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIG 233
           K+CDFGS S  +    + Q++  +  ++  +TT QYRSPEMID YR LP++EKSDIWA+G
Sbjct: 203 KLCDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALG 262

Query: 234 VFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
           VFLYKL +YTTPFE+  G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPNIYQV
Sbjct: 263 VFLYKLMFYTTPFERT-GQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQV 320

Query: 294 IEEISKMQNVPCPIVNFY 311
           + +I  +  +  P+ + Y
Sbjct: 321 LNQICYISGIKNPMDDAY 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  293 bits (749), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 206/329 (62%), Gaps = 26/329 (7%)

Query: 7   DTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCDSN-------------- 51
           + +  GT + VGSH+V IIKYI  GGFAQIY V+ +   + F DSN              
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 52  ---------IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGS 102
                    IACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+AS+ +     
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 103 YEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKI 162
           +EV LLME C    L+D+MN RL  +LTE E+L I   +   ++ MH L+ PLLHRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 163 ENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLP 222
           ENVL+   N +K+CDFGS S  +      Q++  +  ++  +TT QYRSPEMID YR LP
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLME 282
           IDEKSDIWA+G+FLYKL ++ TPFE   G+ AIL ++YE+P    YS +L +LI  ML E
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMT-GQFAILHSKYEFPKNN-YSSKLINLIIIMLAE 319

Query: 283 NPHQRPNIYQVIEEISKMQNVPCPIVNFY 311
           NP+ RPNIYQV++ I  M NV  PI + Y
Sbjct: 320 NPNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  290 bits (742), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/320 (47%), Positives = 203/320 (63%), Gaps = 11/320 (3%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCDS--------N 51
           + +P +D Y PGT++ VG+ QV II +I  GGFAQIY+V+ I     F +         +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEY 111
           IACLKRV+VPD+  L+ +R EV+ MK LR  K ++ Y DS+AS+       YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
           C    L+D+MN RL  RLTE E+L +       I+ MH L  PL+HRDIKIENVL+   N
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
            +K+CDFGS S         Q++  +  ++  NTT QYRSPEMID YR LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIY 291
           +G+FLYKL ++ TPFE   G+ +IL ++YE+P    YS +L +LI  ML ENP+ RPNIY
Sbjct: 254 LGIFLYKLLFFITPFEMT-GQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIY 311

Query: 292 QVIEEISKMQNVPCPIVNFY 311
           QV+  I  +     PI + Y
Sbjct: 312 QVMHHICSVIGCEVPIEDKY 331

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  286 bits (732), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 202/317 (63%), Gaps = 11/317 (3%)

Query: 4   PKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTV---------EISPPDSFCDSNIAC 54
           P ++    G+ + VG+H+V I+KY+  GGFA IY V         E +P  +      AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCER 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHAS+S      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
             L+D+MN RL  +L+E E+L I   V + +A MH L  PL+HRD+KIENVL+   N +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGV 234
           +CDFGS S  +   +  QE+  + +++  +TT QYRSPEMID YR LPIDEKSDIWA+G+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
           FLYKL +YTTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPNIYQ++
Sbjct: 264 FLYKLLFYTTPFELT-GQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIM 321

Query: 295 EEISKMQNVPCPIVNFY 311
           + +  +  V  PI + Y
Sbjct: 322 DNLCSIMKVENPIEDKY 338

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  289 bits (740), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 206/319 (64%), Gaps = 12/319 (3%)

Query: 3   QPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCDS---------NI 52
           +P  + Y PGT + VG+H+V IIKYI  GGFAQIY V+ I   + F ++         ++
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYC 112
           ACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+AS+ +     +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 ERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQ 172
               L+D+MN RL  +LTE E+L I   V   ++ MH L  PLLHRDIKIENVL+   N 
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 YKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAI 232
           +K+CDFGS S         Q++  +  ++  +TT QYRSPEMID YR LPIDEKSDIWA+
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
           G+FLYKL ++TTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPNIYQ
Sbjct: 256 GIFLYKLLFFTTPFELT-GQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQ 313

Query: 293 VIEEISKMQNVPCPIVNFY 311
           V+  I  +  +  PI + Y
Sbjct: 314 VLHNICSISGMKVPIEDQY 332

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  287 bits (735), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 224/369 (60%), Gaps = 25/369 (6%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI-----------SPPDSFCD 49
           M  P ++ + PG I+ VG+H+V +I Y+  GGFAQIY V+            S P    D
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 50  SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLM 109
             +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+AS+       +EV LLM
Sbjct: 74  --VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLM 131

Query: 110 EYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISK 169
           E C    L+D+MN RL  +LTESE++ I   V   I+ MH L  PL+HRDIKIENVL+  
Sbjct: 132 ELCPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDA 191

Query: 170 SNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDI 229
           +N +K+ DFGS S         Q++  +  ++  +TT QYRSPEMID YR LPI+EKSDI
Sbjct: 192 NNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 251

Query: 230 WAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPN 289
           WA+G+FLYKL ++TTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPN
Sbjct: 252 WALGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPN 309

Query: 290 IYQVIEEISKMQNVPCPI--------VNFYLVTQ-QQKHKMVQLQPIPVNTLNVSQTHPI 340
           IYQV+  + ++ N+  PI         NF   TQ Q K + VQLQ   +    + Q +  
Sbjct: 310 IYQVLYHLCEILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQNNK- 368

Query: 341 LQDGKQRIL 349
           L D ++ +L
Sbjct: 369 LSDSEENLL 377

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  287 bits (734), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/345 (46%), Positives = 213/345 (61%), Gaps = 24/345 (6%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI-----------SPPDSFCD 49
           M  P ++ Y PG I+ VG+H+V I+ Y+  GGFAQIY V+            S P    D
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 50  SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLM 109
             +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+AS+       +EV LLM
Sbjct: 74  --LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLM 131

Query: 110 EYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISK 169
           E C    L+D+MN RL  +LTE+E++ I   VA  I+ MH L  PL+HRDIKIENVL+  
Sbjct: 132 ELCPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDA 191

Query: 170 SNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDI 229
            + +K+ DFGS S         Q++  +  ++  +TT QYRSPEMID YR LPI+EKSDI
Sbjct: 192 KDSFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 251

Query: 230 WAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPN 289
           WA+G+FLYKL ++TTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPN
Sbjct: 252 WALGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPN 309

Query: 290 IYQVIEEISKMQNVPCPI--------VNFYLVTQ-QQKHKMVQLQ 325
           IYQV+  +  + NV  PI         NF   TQ Q K + VQLQ
Sbjct: 310 IYQVLCHLCDILNVEVPIEDKYAEGPYNFARYTQFQNKLQNVQLQ 354

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  282 bits (721), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 148/311 (47%), Positives = 202/311 (64%), Gaps = 12/311 (3%)

Query: 11  PGTILPVGSHQVRIIKYITSGGFAQIYTVEI----SPPDSFCDS------NIACLKRVIV 60
           P T + VG+H+  I++++  GGFA IY V+     +  D+  DS      +IACLKRVIV
Sbjct: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           PD+  LN LR EV+ MK LR + ++V Y DS+AS+    +  +E+ LLME C +  L+D+
Sbjct: 91  PDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDY 150

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           MN +L  +LTE+E+L I   V+  IA MH L  PL+HRDIKIENVL+ K + +K+CDFGS
Sbjct: 151 MNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGS 210

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240
            S         Q++  + +++  +TT QYRSPEMID YR LPI+EKSDIWA+G+FLYKL 
Sbjct: 211 TSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270

Query: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           +YTTPFE   G+ AIL ++YE P    YS +L +LI  ML ENP  RPNIYQV+  +  +
Sbjct: 271 FYTTPFELT-GQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHHVCSI 328

Query: 301 QNVPCPIVNFY 311
                P  + Y
Sbjct: 329 LKCDVPFTDKY 339

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  286 bits (732), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 223/369 (60%), Gaps = 25/369 (6%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI-----------SPPDSFCD 49
           M  P ++ Y PG I+ VG+H+V ++ Y+  GGFAQIY V+            S P    D
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 50  SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLM 109
             +ACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+AS+       +EV LLM
Sbjct: 74  --VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLM 131

Query: 110 EYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISK 169
           E C    L+D+MN RL  +LTE+E++ I   VA  I+ MH L   L+HRDIKIENVL+  
Sbjct: 132 ELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDA 191

Query: 170 SNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDI 229
            N +K+ DFGS S         Q++  +  ++  +TT QYRSPEMID YR LPI+EKSDI
Sbjct: 192 KNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 251

Query: 230 WAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPN 289
           WA+GVFLYKL ++TTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPN
Sbjct: 252 WALGVFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPN 309

Query: 290 IYQVIEEISKMQNVPCPI--------VNFYLVTQ-QQKHKMVQLQPIPVNTLNVSQTHPI 340
           IYQV+  + ++ NV  PI         NF   TQ Q K + VQLQ   +    + Q +  
Sbjct: 310 IYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQNNK- 368

Query: 341 LQDGKQRIL 349
           L D ++ +L
Sbjct: 369 LSDSEENLL 377

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  286 bits (731), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 203/322 (63%), Gaps = 15/322 (4%)

Query: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI-----------SPPDSFCD 49
           M  P ++ Y PG I+ VG+H+V I+ Y+  GGFAQIY V+            S P    D
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 50  SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLM 109
             +ACLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+AS+       +EV LLM
Sbjct: 74  --VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLM 131

Query: 110 EYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISK 169
           E C    L+D+MN RL  +L+ESE++ I   VA  I+ MH L  PL+HRDIKIENVL+  
Sbjct: 132 ELCPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDA 191

Query: 170 SNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDI 229
            N +K+ DFGS S         Q++  +  ++  +TT QYRSPEMID YR LPI+EKSDI
Sbjct: 192 ENNFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDI 251

Query: 230 WAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPN 289
           WA+G+FLYKL ++TTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPN
Sbjct: 252 WALGIFLYKLLFFTTPFEMT-GQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPN 309

Query: 290 IYQVIEEISKMQNVPCPIVNFY 311
           IYQV+  I  + N   PI + Y
Sbjct: 310 IYQVLYHICDILNAEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  280 bits (717), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 198/315 (62%), Gaps = 11/315 (3%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYT---------VEISPPDSFCDSNIACLK 56
           IDTY PG I+ VG H+V IIKY+  GGFA+IY          ++I+        ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGG 116
           RV+V D   LN +R EV  MK L    ++V   DS+AS+       YEV LLME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176
           L+D+MN RL  +LTE E+L I   V   +A MH L  PL+HRDIKIENVL+   N +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFL 236
           DFGS S  +      +++  +  ++  +TT QYRSPEMID YR + I+EKSDIWA+G+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296
           YKL +Y TPFE+  G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPNIYQV+  
Sbjct: 336 YKLLFYITPFERT-GQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAY 393

Query: 297 ISKMQNVPCPIVNFY 311
           I K+ N+  PI + Y
Sbjct: 394 ICKIINIKTPIDDIY 408

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  285 bits (729), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 201/317 (63%), Gaps = 16/317 (5%)

Query: 9   YHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCD-------------SNIAC 54
           Y  GT + VGSH+V +IKYI  GGFAQIYTV+ I   + F                +IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCER 114
           LKRV+V D   LN +R EV+ M+ L+    VV Y DS+AS  + +   YEV LLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
             L+D+MN RL  RL+E E++ I      GIA +H L+ PL+HRDIKIENVL+ + N +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGV 234
           +CDFGS S       N +++     ++  NTT QYRSPEMID YR  PIDEKSDIWA+GV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
           FLYKL ++TTPFE+  G+ AIL ++YE+P    YS +L +LI  ML ENP  RPNIYQV+
Sbjct: 339 FLYKLLFFTTPFERT-GQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVL 396

Query: 295 EEISKMQNVPCPIVNFY 311
           + +  +     P+ + Y
Sbjct: 397 QYLCSINGWKVPLNDKY 413

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  283 bits (723), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 206/323 (63%), Gaps = 19/323 (5%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTV-------EISPPDSFCD--------- 49
           I+ +  G  L VG+H+V I+ Y+T GGFAQIY V       E    D+  +         
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 50  -SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLL 108
             ++ACLKRV+V D+  LN +R EV+ MK LR   ++V Y DS+A++S+  N  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLIS 168
           ME C    L+++MN RL  +L+E EVL I   V  G+A MH L+ PL+HRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 KSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSD 228
            +N +K+CDFGS +         Q++  +  +V  +TT QYRSPEMID YR LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRP 288
           IWA+GVFLYKL +YTTPFE   G+ A+L ++++ P    YS ++ +L+  ML EN + RP
Sbjct: 268 IWALGVFLYKLLFYTTPFETT-GQFAMLHSKFDIP-ANKYSSKIINLVIIMLSENLNLRP 325

Query: 289 NIYQVIEEISKMQNVPCPIVNFY 311
           NIYQV+  I ++  V  PI++ Y
Sbjct: 326 NIYQVMHYICQLIQVDTPILDIY 348

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  281 bits (720), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 199/310 (64%), Gaps = 14/310 (4%)

Query: 12  GTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCD--------SNIACLKRVIVPDK 63
           G+IL VG H+V II+Y+  GGFA IY V      +  D         +IACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
             LN LR EV+ MK L+   +VV Y DS+AS+       +EV LLME C  G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
           RL  +L+E EVL I   + +GI+ MH L+ PL+HRDIKIENVL+  +N +K+CDFGS S 
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 IIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYT 243
            +      QE+  + +++  +TT QYRSPEMID YR L I+EKSDIWA+G+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKNGGEAAILSARYEYP--NFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQ 301
           TPFE   G+ AIL ++Y+ P  NF   S +L +LI  ML ENP+ RPNIYQ++  I  + 
Sbjct: 271 TPFELT-GQFAILHSKYDIPQNNF---SSKLINLIIVMLAENPYIRPNIYQILYHICSIM 326

Query: 302 NVPCPIVNFY 311
               PI + Y
Sbjct: 327 ECDVPIEDHY 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 207/331 (62%), Gaps = 11/331 (3%)

Query: 4   PKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTV---------EISPPDSFCDSNIAC 54
           P ++    G+ + VG+H+V I+KY+  GGFA IY V         E  P       ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCER 114
           LKRV+V D+  LN +R EV  MK L    ++V Y DSHAS++   +  +EV LLME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
             L+D+MN RL  +L+E E+L I   V + +A MH L  PL+HRD+KIENVL+  ++ +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGV 234
           +CDFGS S      +  QE+  + +++  +TT QYRSPEMID YR LPI+EKSDIWA+G+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
           FLYKL +YTTPFE   G+ AIL ++YE+P    YS +L +LI  ML ENP+ RPNIYQV+
Sbjct: 306 FLYKLLFYTTPFELT-GQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVM 363

Query: 295 EEISKMQNVPCPIVNFYLVTQQQKHKMVQLQ 325
           + +  +  V  P+ + Y +      K  Q Q
Sbjct: 364 DNLCSILKVKNPLEDKYQLGSYSFEKYSQYQ 394

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  281 bits (720), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 205/333 (61%), Gaps = 33/333 (9%)

Query: 2   NQP-KIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCD---------- 49
           N+P  I+ Y  GTIL VG  ++ I+KY+T GGFAQIYTV  I   + F +          
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 50  ----SNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNG---- 101
                ++ACLKRV+VPD+  L+ +R EVD MK L N  ++V Y DS+ASK   N+     
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHA 150
                       +E+ LLMEYC    L+DFMN RL  +LTE+E+L   + +   +  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYR 210
           L  PL+HRDIKIENVL+  +N +K+ DFGS + I  P    Q++  +  D+  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 SPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSE 270
           SPEMID Y+ LPIDEKSDIWA+GV LYKL +YTTPFE   G+ AIL ++YE+P    YS 
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFEL-TGQFAILHSKYEFP-ANNYSS 329

Query: 271 RLKHLIHAMLMENPHQRPNIYQVIEEISKMQNV 303
           +  +LI  ML ENP+ RPNI+QV+  +  + N 
Sbjct: 330 KFINLIIIMLAENPNLRPNIFQVLYYLKSISNT 362

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  278 bits (710), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 147/308 (47%), Positives = 196/308 (63%), Gaps = 10/308 (3%)

Query: 12  GTILPVGSHQVRIIKYITSGGFAQIYTV-------EISPPDSFCD-SNIACLKRVIVPDK 63
           G+ + VG HQV +I+Y+  GGFA IY V       E+   D      +  CLKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
             LN LR EV+ MK LRN  ++V Y DS+AS+       YEV LLME C  G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
           RL  +L+E+EVL I   +  G++ MH  + PL+HRDIKIENVL+   N +K+CDFGS S 
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 IIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYT 243
            +    + QE+  + +++  +TT QYRSPEMID YR LPI+EKSDIWA+G+FLYKL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNV 303
           TPFE   G+ AIL ++YE P    +S +L +L+  ML ENP+ RPN+YQV+  I  M   
Sbjct: 272 TPFELT-GQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMEC 329

Query: 304 PCPIVNFY 311
              I + Y
Sbjct: 330 EVKIDDLY 337

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  278 bits (712), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 146/318 (45%), Positives = 204/318 (64%), Gaps = 13/318 (4%)

Query: 4   PKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCD--------SNIAC 54
           P ++ + PG ++ VG+H+V ++ Y+  GGFAQIY V+ +   + F +         ++AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCER 114
           LKRV+V D+  L+ +R EV+ MK L   +++V Y DS+A + +  N  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
             L+D+MN RL  +LTE E+L I   V+  ++ MH L+ PL+HRDIKIENVL+   N +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGV 234
           +CDFGS S         QE+  +  ++  +TT QYR PEMID YR LPI+EKSDIWA+G+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKNGGEAAILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
           FLYKL ++ TPFE   G+ AIL ++YE+ PN   YS +L +LI  ML ENP  RPNIYQV
Sbjct: 257 FLYKLLFFITPFEMT-GQFAILHSKYEFPPNH--YSSQLINLIIIMLAENPFVRPNIYQV 313

Query: 294 IEEISKMQNVPCPIVNFY 311
           +  I  M  V  PI + Y
Sbjct: 314 LNHICTMIGVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  272 bits (695), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/355 (43%), Positives = 218/355 (61%), Gaps = 36/355 (10%)

Query: 3   QPKIDTYHP-GTILPVGSHQVRIIKYITSGGFAQIYTVE-ISPPDSFCDSNI-------- 52
           QP+I+   P G ++ VGSH+V ++ Y+  GGFAQIY V+ +   + F   N         
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 53  ----ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASK-----SNFNNGSY 103
               ACLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+AS+      N   G +
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQG-F 207

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           EV LLME C    L+D+MN RL  +LTE E+  I   +   +A MH L  PL+HRDIKIE
Sbjct: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPI 223
           NVL+  +N +K+CDFGS S       + Q++  +  D+  +TT QYRSPEMID ++ +PI
Sbjct: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327

Query: 224 DEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP-IYSERLKHLIHAMLME 282
           +EKSDIWA+GVFLYKL ++TTPFE+  G+ A+L +++E+P  P  YS +L +LI  ML E
Sbjct: 328 NEKSDIWALGVFLYKLLFFTTPFERT-GQFAMLHSKFEFP--PNSYSSKLINLIIVMLAE 384

Query: 283 NPHQRPNIYQVIEEISKMQNVPCPIV-----------NFYLVTQ-QQKHKMVQLQ 325
           NP  RPNIYQV+  +S++ N   P             NF   T+ Q++ + VQLQ
Sbjct: 385 NPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQ 439

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  274 bits (701), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 200/317 (63%), Gaps = 13/317 (4%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEI-----------SPPDSFCDSNIAC 54
           I+ Y PG ++ VG+HQV+I  Y+  GGFAQIY V+               +S    +IAC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCER 114
           LKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A + N     YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
             L+D+MN RL+ +L E+E++ I       ++ MH L  PL+H+DIK+EN+L+  +N +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGV 234
           +CDFGS S       +  ++  +  ++  +TT QYRSPEMID YR LPI+E SDIWA+GV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
           FLYKL ++ TPFE+  G+ +IL A+++ P    Y  +L +LI  ML EN + RPNIYQV+
Sbjct: 272 FLYKLLFFITPFER-TGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVM 329

Query: 295 EEISKMQNVPCPIVNFY 311
            EI  + N P PI + Y
Sbjct: 330 YEICSITNTPLPIEDKY 346

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  105 bits (263), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/338 (25%), Positives = 147/338 (43%), Gaps = 60/338 (17%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAE 72
           + + +   + RI K +  GG + +Y VE    + F       LK+   P      ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSI 66

Query: 73  VDAMKLLRN-----NKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN 127
             AMK + N     + ++   +DS   +    +GS  V++L+ Y  +G L D +N  L +
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQEK--DGSKTVYVLLPYFAKGSLQDLINRHLLD 124

Query: 128 --RLTESEVLSITSQVAQGIAAMHALQP-------------------PLL---------- 156
             +++E ++L +   +A+G+  +H   P                    LL          
Sbjct: 125 CTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 157 ------HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYR 210
                 HRD+K  N++IS  +   I D GS S      ++ Q L   Q     N T  Y 
Sbjct: 185 SQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 211 SPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK----NGGEA--AILSARYEYPN 264
           +PE++D      I EK DIW+ G  +Y +C+  +PFE+    +G     AI + +Y  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 265 FPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQN 302
              YS  L  LI   L  NP QRP++ ++I  + ++Q 
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 155/341 (45%), Gaps = 30/341 (8%)

Query: 11  PGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLR 70
           P +++       R   ++  GGFA+ + ++      F    +A   ++ +  + +   L 
Sbjct: 84  PPSLIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLL 140

Query: 71  AEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLT 130
           +E+   K ++++ ++V +ID     +N       V++L+E C  G L+D +  R    LT
Sbjct: 141 SEIQIHKSMKHS-NIVQFIDCFEDDAN-------VYILLEICPNGSLMDLLKKR--KSLT 190

Query: 131 ESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHN 190
           E EV   T+Q+   I  +H+ +  ++HRD+K+ N+   K    K+ DFG  + +     N
Sbjct: 191 EPEVRFFTTQICGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----N 244

Query: 191 PQELQYVQHDVLKNTTAQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK- 248
            +E +Y         T  Y +PE ++  + G   +   DIW+IGV +Y L     PF+  
Sbjct: 245 DRERKYTVCG-----TPNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAK 297

Query: 249 --NGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVPCP 306
             N     I   +Y YP     S+  + LIH +L  NP QRP I  +I+++      P  
Sbjct: 298 DVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPAR 357

Query: 307 IVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHPILQDGKQR 347
           I    + T     + + L+   +N  N      +++ G +R
Sbjct: 358 ISPDVMDTVPNYEEELTLEESFINFKNCMANCGLIESGNKR 398

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 133/273 (48%), Gaps = 31/273 (11%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + + N L +E+   K +R+ +++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID      N       V++L+E C  G L+D +  R    LTE EV   T+Q+   + 
Sbjct: 159 HFIDCFEDDIN-------VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+    ++HRD+K+ N+   K    KI DFG ++ II   +N  E +Y         T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYTIC-----GT 258

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSAR-----YE 261
             Y +PE+I   + +    + DIW++GV ++ +     PF+    E + +  R     Y 
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ--AKEVSTIYDRIKHCNYS 316

Query: 262 YPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
           +P     S+ +K LI  +L  NP +RP I +++
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 93.2 bits (230), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 147/333 (44%), Gaps = 54/333 (16%)

Query: 15  LPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVP--DKPSLNTLRAE 72
           + V  H+  I + +  GGF+ +Y VE        ++ +  LK++  P     S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESR------ENGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN--RLT 130
           VD  +  ++  ++   IDS   +    +GS  V++L+ Y  +G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 ESEVLSITSQVAQGIAAMHALQPP-------------------LL--------------- 156
           E EV+ +   VA+G+  +H   P                    LL               
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 157 -HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI 215
            H DIK  N++IS      I D GS S      ++ Q L   Q    ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK----NGGEA--AILSARYEYPNFPIYS 269
           D      I EK D+W+ G  +Y +C+  +PFE+    +G     ++ + +Y  P+   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 270 ERLKHLIHAMLMENPHQRPNIYQVIEEISKMQN 302
             L  ++   L  +P  RP++ ++I  +  +Q+
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 137/291 (47%), Gaps = 30/291 (10%)

Query: 11  PGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLR 70
           P +++       R   ++  GGFA+ + ++      F    +A   ++ +  + +   L 
Sbjct: 81  PPSLIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLL 137

Query: 71  AEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLT 130
           +E+   K +++  ++V ++D     +N       V++L+E C  G L+D M  R    LT
Sbjct: 138 SEIQIHKSMKH-PNIVHFVDCFEDDTN-------VYILLEICSNGSLMDLMKKR--KTLT 187

Query: 131 ESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHN 190
           E EV   T+Q+   +  MH+ +  ++HRD+K+ N+   K    K+ DFG  + +     N
Sbjct: 188 EPEVRFFTTQICGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA----N 241

Query: 191 PQELQYVQHDVLKNTTAQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN 249
            +E +Y         T  Y +PE ++  + G   +   DIW+IGV +Y L     PF+  
Sbjct: 242 NRERKYTVCG-----TPNYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQAK 294

Query: 250 GGEA---AILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
                   I + +Y YP     S   K LI  +L  +P +RP+I ++I+++
Sbjct: 295 DVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 131/268 (48%), Gaps = 28/268 (10%)

Query: 31  GGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYID 90
           GGFA+ + ++     SF    ++  K+ I  ++     L +E+   + LR + H+V ++D
Sbjct: 102 GGFARCFHIKDDVGISFACKIVS--KKSIKTERTKFKLL-SEIQIHQNLRYS-HIVKFMD 157

Query: 91  SHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHA 150
               + N       V++L+E C  G L+D +  R    LTE+EV  +T+QV   I  MH+
Sbjct: 158 CFEDELN-------VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINYMHS 208

Query: 151 LQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYR 210
               ++HRD+K+ NV   K+   KI DFG  + +     N  E +Y         T  Y 
Sbjct: 209 --NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-----TPNYI 257

Query: 211 SPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA---AILSARYEYPNFPI 267
           +PE+I   + +    ++DIW++G+ +Y +     PF+          I   +YE+P    
Sbjct: 258 APEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPPDKY 316

Query: 268 YSERLKHLIHAMLMENPHQRPNIYQVIE 295
            +  +K LI  +L+ +P QRP I  +++
Sbjct: 317 ITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/347 (23%), Positives = 148/347 (42%), Gaps = 60/347 (17%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIAC-----LKRVIVPDKPSLN 67
           T + V   + +I + +  GG + +Y V++       ++ +A      LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +    +GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLTESEVLSITSQVAQGIAAMHA---------------------------------LQ 152
              ++E+E + I   V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDV 201
             +L           HRDI   N+L S      I D GS S       N  +L+ +Q  V
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN----GGEA--AI 255
             N T  Y +PE++       +D K DIW++G   Y L +  +PFE+     G     AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 256 LSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQN 302
            + +Y +P    +SE L  +I   +  +P QRP   Q++  +  +++
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 132/275 (48%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A L    +  + +   L +E+   K +R+  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID    ++N       V++L+E C  G L++ +  R    LTE EV   T+Q+  GI 
Sbjct: 162 QFIDCFEDETN-------VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K+   KI DFG  + +     N +E +Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTVCG-----T 261

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW+IGV +Y L     PF+    N     I    + +
Sbjct: 262 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVF 319

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   + L+  +L  +P +RP+I +V++ +
Sbjct: 320 PKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 137/329 (41%), Gaps = 60/329 (18%)

Query: 17  VGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIA-----CLKRVIVPDKPSLNTLRA 71
           V   + RI + +  GG + +Y V++S      D+ IA      LK++I P   S++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL--QNRL 129
           E++  K  ++  +V+  IDS   +    +GS  +++++ Y   G L D +N RL     +
Sbjct: 85  EIENYKRFQS-PYVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEGTFV 141

Query: 130 TESEVLSITSQVAQGIAAMHA---------------------------------LQPPLL 156
           +E+E + I   V +G+  +H                                  L+  +L
Sbjct: 142 SEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDML 201

Query: 157 -----------HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT 205
                      HRDI   N+L S      I D GS S       N  +L  +Q  V  N 
Sbjct: 202 SSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNC 261

Query: 206 TAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN----GGEA--AILSAR 259
           T  Y  PE+++      +  K DIW++G   Y L +  +PFE+     G     AI + +
Sbjct: 262 TLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGK 321

Query: 260 YEYPNFPIYSERLKHLIHAMLMENPHQRP 288
           Y +P    +SE L  +I   +  +P QRP
Sbjct: 322 YSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 132/275 (48%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +R+  +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NVV 151

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L++ +  R    +TE EV    +Q+   I 
Sbjct: 152 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K+   KI DFG  + +     N +E +Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 251

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW+IGV +Y L     PF+    N     I +  + +
Sbjct: 252 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAF 309

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   K LIH +L  +P +RP+I ++I+ +
Sbjct: 310 PKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 126/274 (45%), Gaps = 28/274 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ +         F    +A L    +  + +   L +E+   K ++N  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   I 
Sbjct: 144 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    KI DFG  + +     N +E +Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 243

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEYP 263
             Y +PE++   +      + DIW+IGV LY L     PF+    N     I    + +P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 264 NFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
                S   K LI  +L  +P +RP++ ++I+ +
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 131/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A L    +  + +   L +E+   K +++ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   I 
Sbjct: 143 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   ++   KI DFG  + +     N +E +Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW+IGV LY L     PF+    N     I    + +
Sbjct: 243 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSF 300

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   K LI  +L  +P +RP+I ++++ +
Sbjct: 301 PKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + +       F    +A   ++ +  + +   L +E+   K +++  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   I 
Sbjct: 156 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   +    KI DFG  + +     N +E +Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----CGT 255

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW+IGV +Y L     PF+    N     I    + +
Sbjct: 256 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSF 313

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P   + S   K LI  +L  +P +RP++ ++++ I
Sbjct: 314 PKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 141/334 (42%), Gaps = 60/334 (17%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEI-----SPPDSFCDSNIACLKRVIVPDKPSLN 67
           T + V   + +I + +  GG + +Y V++     S  +S   + +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +    +GS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEK--DGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLTESEVLSITSQVAQGIAAMHA---------------------------------LQ 152
              ++E+E + I   V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDV 201
             +L           HRDI   N+L S      I D GS S       N  +L  +Q  V
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN----GGEA--AI 255
             N T  Y +PE+++      +  K DIW++G   Y L +  +PFE+     G     AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 256 LSARYEYPNFPIYSERLKHLIHAMLMENPHQRPN 289
            + +Y +P    +SERL  +I   +  +P QRP 
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPT 351

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 89.7 bits (221), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 115/238 (48%), Gaps = 27/238 (11%)

Query: 67  NTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQ 126
           +T+  E++  KL+  +K+++S ID     +        +++++E C  G L D +  R +
Sbjct: 94  STILKEIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSK 145

Query: 127 NRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIR 186
             L E E   +  Q+   +  +H  +  ++H D+K+ N+LI  SN  ++CDFG       
Sbjct: 146 RSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFG------- 196

Query: 187 PPHNPQELQYVQHDVLKNTTAQYRSPEMIDFY-----RGLPIDEKSDIWAIGVFLYKLCY 241
             H+        + + K  T  Y SPE+I  +     + L   ++SDIW+IG+ LY + +
Sbjct: 197 --HSFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLYAMIF 254

Query: 242 YTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296
             TPFE     +    I+  +Y +      S ++K LI  +L   P +R  I +++ +
Sbjct: 255 DKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-PNIV 133

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            + D     +N       V++L+E C  G L+D +  R Q  LTE EV   T+Q+   I 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    KI DFG  + +     N +E +Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDF-YRGLPIDEKSDIWAIGVFLYKLCYYTTPF---EKNGGEAAILSARYEY 262
             Y +PE++   + G   +   D+W+IGV +Y L     PF   E N     I    + +
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNF 291

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   K LI  +L  +P +RP++ +++E +
Sbjct: 292 PRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +++  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 133

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            + D     +N       V++L+E C  G L+D +  R Q  LTE EV   T+Q+   I 
Sbjct: 134 QFTDCFEDDTN-------VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    KI DFG  + +     N +E +Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYTI-----CGT 233

Query: 207 AQYRSPEMIDF-YRGLPIDEKSDIWAIGVFLYKLCYYTTPF---EKNGGEAAILSARYEY 262
             Y +PE++   + G   +   DIW+IGV +Y L     PF   E N     I    + +
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSF 291

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   K LI  +L  +P +RP++ +++E +
Sbjct: 292 PKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 149/354 (42%), Gaps = 74/354 (20%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAE 72
           ++L  G H   I + +  GGF+ +Y V+     S  ++++  LK++  P       + + 
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCP----FGNIESV 69

Query: 73  VDAMKLLRNNKHVVSYIDSHASKSNF---NNGSYEVFLLMEYCERGGLIDFMNTRLQNRL 129
            +AM+ + + K   S   +H   S      +GS  VF+L+ Y   G L+D +NT L +  
Sbjct: 70  SEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 130 T--ESEVLSITSQVAQGIAAMH-------------ALQPPLLHRD--------------- 159
           T  E E++ I   VA+G+  MH             ++   L +RD               
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 160 -------------------------IKIENVLISKSNQYKICDFGSVSGIIRPPHNPQEL 194
                                    IK  N++ S      ICD GS S       +  +L
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 QYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN---GG 251
              Q    ++ T  +RSPE+++      IDEK DIW++G  LY +C+  +PFE+     G
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 252 EA---AILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQN 302
            +   AI + ++  P    YS  L  +I   +  +  +RP+I +++  +  +Q 
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 137/293 (46%), Gaps = 30/293 (10%)

Query: 26  KYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHV 85
           +++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K + ++ ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNI 140

Query: 86  VSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGI 145
           V +ID      N       V++L+E C  G L++ +  R    +TE EV    +Q+  GI
Sbjct: 141 VQFIDCFEDNVN-------VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT 205
             MH+ +  ++HRD+K+ N+   +    KI DFG  + +     N +E ++         
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLA----NDRERKFTI-----CG 240

Query: 206 TAQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYE 261
           T  Y +PE ++  + G   +   DIW+IGV LY L     PF+    N     I    + 
Sbjct: 241 TPNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFA 298

Query: 262 YPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVPCPIVNFYLVT 314
           YP     S+  K+LI  +L  NP +RP+I ++++ +      P   +N  + T
Sbjct: 299 YPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFPPYTLNSVMTT 351

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 99/195 (50%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L +++   +Q+R++  E   + +Q+   +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K  + KI DF    G  R       L+ V        T  Y +PE+I+   Y G 
Sbjct: 158 NILLDKKGRAKITDF----GFTRECATKTMLETVC------GTTVYMAPELIERKSYDGF 207

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP--NFPIYSERLKHLIHAM 279
            I    DIW++GV LY + + T PF++            E P  N  + S+  K LI  +
Sbjct: 208 KI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQL 263

Query: 280 LMENPHQRPNIYQVI 294
           L ++P QRP + QV+
Sbjct: 264 LCKDPSQRPQLSQVL 278

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 130/276 (47%), Gaps = 32/276 (11%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NIV 139

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   + 
Sbjct: 140 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    KI DFG  + +     N +E +Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSAR-----YE 261
             Y +PE++   +      + DIW+ GV +Y L     PF+    E  I+  R     Y 
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ--AKEVNIIYERIKCGDYV 296

Query: 262 YPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           +P     S+    LI  +L  +P +RP++ ++I+ +
Sbjct: 297 FPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 134/294 (45%), Gaps = 44/294 (14%)

Query: 5   KIDTYHPGTILPVGS-HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDK 63
           +I ++  G  L +GS  +V++    T+G  A I  +  +    F DSN+  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTI---FQDSNVTSMVDNTTPDA 70

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
                 R E+  MKLL N+ +V+   D   + SN        ++++EY E+G L + +  
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVE 121

Query: 124 RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
           R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  + 
Sbjct: 122 R--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA- 176

Query: 184 IIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYK 238
                           D L  T+     Y +PE++    Y G      SD+W+ GV LY 
Sbjct: 177 ------------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----SDVWSCGVILYA 220

Query: 239 LCYYTTPFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
           L     PF++  G        + + ++E P     S+  ++LI  +L+ NP +R
Sbjct: 221 LLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 139/291 (47%), Gaps = 30/291 (10%)

Query: 11  PGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLR 70
           P +++       R  +++  GGFA+ + ++      F    +A   ++ +  + +   L 
Sbjct: 131 PPSLIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLL 187

Query: 71  AEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLT 130
           +E+   K +++ +++V ++D      N       V++L+  C  G L++ +  R    LT
Sbjct: 188 SEIQIHKSMKH-QNIVQFVDCFEDHIN-------VYILLGMCPNGSLMELLKKR--KILT 237

Query: 131 ESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHN 190
           E EV   T Q+   I  MH+ +  ++HRD+K+ N+   ++   KI DFG  + +     N
Sbjct: 238 EPEVRFFTVQICGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA----N 291

Query: 191 PQELQYVQHDVLKNTTAQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK- 248
            +E +Y         T  Y +PE ++  + G   +   DIW+IGV ++ L     PF+  
Sbjct: 292 DRERKYTVCG-----TPNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQAK 344

Query: 249 --NGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
             N   + I ++ Y +P     S+  K LI  +L+ +P  RP+I +++E +
Sbjct: 345 DVNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 86.7 bits (213), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 102/203 (50%), Gaps = 38/203 (18%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++++EYC    L D++ ++   R++  E   I +Q+   +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLE 159

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT-------TAQYRSPEMI- 215
           N+L+ K N  K+ DFG                    D  KNT       T  Y +PE++ 
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLR 202

Query: 216 -DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNG---GEAAILSARYEYPNFPIYSER 271
            + Y G  I    DIWA+G+ LY +   T PF+++     E  I+SA  +Y N   +++ 
Sbjct: 203 REKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDN-KYFNDD 257

Query: 272 LKHLIHAMLMENPHQRPNIYQVI 294
              L++ +L ++P  RP I Q++
Sbjct: 258 SIDLVNRLLSKDPSMRPTIEQIL 280

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 129/302 (42%), Gaps = 57/302 (18%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYC 112
           LKR+  P  +  S++    EVD  K  ++  ++++ +DS   +    +GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQEK--DGSKTLCILLPYF 129

Query: 113 ERGGLIDFMNTRL--QNRLTESEVLSITSQVAQGIAAMH--------------------- 149
             G L D +N  L     ++E+E + I   +A+G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------LHRDIKIENVLISKSNQYKICDFGSVSGIIR 186
                      PL                +HRDI++ N+L S      + D GS      
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
                 +L  +Q  V  N +  Y +PE+++      ID K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EKN---GGEA---AILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           E+     G +   AI   +Y +P    YSE L  +I + L  +P  RP+I ++++ +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 301 QN 302
           Q 
Sbjct: 370 QT 371

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 123/256 (48%), Gaps = 31/256 (12%)

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEY 111
           +  +K ++      LN + AE+  +K L N+ ++V Y         F   SYE+++L+EY
Sbjct: 50  VVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-------HGFIRKSYELYILLEY 101

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
           C  G L   + +R    L+E+E  S  +Q   G+  +H     ++HRDIK  N+L+S  N
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
             K+ DFG VS I+    N   L           T  + +PE++   RG      SDIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP--IYSERLKHLIHAMLMENPHQRPN 289
           +G  + ++     P+  N  +A I  A      +P   +SE LK  +    ++N ++RP 
Sbjct: 204 LGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPT 262

Query: 290 IYQVIEE--ISKMQNV 303
             Q+++   I+  +NV
Sbjct: 263 ADQLLKHAWITSTENV 278

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 131/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + +       F    +A L    +  + +   L +E+   K +++ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L++ +  R Q  LTE EV   T+Q+   I 
Sbjct: 206 QFIDCFEDDTN-------VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   ++   KI DFG  + +     N +E ++         T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKFTVCG-----T 305

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   D+W+IGV +Y L     PF+    N     I    + +
Sbjct: 306 PNYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIF 363

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S   K L+  +L  +P +RP+I ++++ +
Sbjct: 364 PKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 128/281 (45%), Gaps = 28/281 (9%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A L    +  + +   L +E+   K +++  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKH-PNIV 150

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            + D     +N       V++L+E C  G +++ +  R +  LTE EV     Q+   I 
Sbjct: 151 QFTDCFEDDTN-------VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    KI DFG  + +     N +E +Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA----NDKERKYTI-----CGT 250

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA---AILSARYEYP 263
             Y +PE++   +      + DIW+IGV LY L +   PF+    E     I    + +P
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 264 NFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVP 304
                S   K+LI  +L  NP  RP++Y++ + +      P
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFP 350

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 98/205 (47%), Gaps = 29/205 (14%)

Query: 100 NGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRD 159
           N  Y ++++MEYC  G   D + T  +  L E++V  +   V  G+  +HA     +HRD
Sbjct: 82  NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRD 139

Query: 160 IKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYR 219
           IK  N+L++ S   K+ DFG VS  +R     +             T  + +PE++    
Sbjct: 140 IKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV---------GTPYWMAPEVV-MNE 188

Query: 220 GLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP---------IYSE 270
           G+  +EKSDIW++G+  Y+L     P  K     AI   R    N P          Y+ 
Sbjct: 189 GMGYNEKSDIWSLGITTYELLKGVPPLAKYD---AIRVMR----NIPKRKPPKLHGAYTN 241

Query: 271 RLKHLIHAMLMENPHQRPNIYQVIE 295
            +KH I   L+++P +RP+  +++E
Sbjct: 242 LVKHFIATCLIKDPEKRPSASELLE 266

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 126/262 (48%), Gaps = 31/262 (11%)

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEY 111
           +  +K V+  +   LN + AE+  +K L +N ++V Y         F   SYE+++L+EY
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-------HGFIRKSYELYILLEY 101

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
           C  G L   + +R    L+E+E  +  +Q   G+  +H     ++HRDIK  N+L+S  N
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
             K+ DFG VS I+    N   L           T  + +PE++   RG      SDIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP--IYSERLKHLIHAMLMENPHQRPN 289
           +G  + ++     P+  N  +A I  A      +P   +SE LK  +    ++N ++RP 
Sbjct: 204 LGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPT 262

Query: 290 IYQVIEE--ISKMQNVPCPIVN 309
             Q+++   I+  +NV    +N
Sbjct: 263 ADQLLKHVWINSTENVKVDKLN 284

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 120/248 (48%), Gaps = 29/248 (11%)

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEY 111
           +  +K ++  +   LN + AE+  +K L N+ ++V Y         F   SYE+++L+EY
Sbjct: 50  VVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-------HGFIRKSYELYILLEY 101

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
           C  G L   + +R    L+E+E  +  +Q   G+  +H     ++HRDIK  N+L+S  N
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
             K+ DFG VS I+    N   L           T  + +PE++   RG      SDIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP--IYSERLKHLIHAMLMENPHQRPN 289
           +G  + ++     P+  N  +A I  A      +P   +SE LK  +    ++N ++RP 
Sbjct: 204 LGATVVEMLTKNPPYH-NLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPT 262

Query: 290 IYQVIEEI 297
             Q+++ +
Sbjct: 263 ADQLLKHV 270

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 137/333 (41%), Gaps = 60/333 (18%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIA-----CLKRVIVPDKPSLN 67
           T + V   + +I + +  GG + +Y V++       ++ I       LK++I P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS  ++    NGS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVTQEK--NGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLTESEVLSITSQVAQGIAAMH------------------------------------ 149
              ++E+E + I   V +G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDV 201
                   A      HRDI   N+L S      I D GS S       +  +L  +Q  V
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN----GGEA--AI 255
             N T  Y +PE+++      +  K DIW++G   Y L +  +PFE+     G     AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 256 LSARYEYPNFPIYSERLKHLIHAMLMENPHQRP 288
            + +Y +P    +SE L ++I   +  +P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++    + F    +A   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     SN       V++L+E C  G L++ +  R    LTE EV   T+Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+    +   KI DFG  + +     N  E +Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW++GV LY L     PF+    N     I    + +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S+  K LI  +L  +P +RP++ ++++ +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++    + F    +A   +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     SN       V++L+E C  G L++ +  R    LTE EV   T+Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+    +   KI DFG  + +     N  E +Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW++GV LY L     PF+    N     I    + +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S+  K LI  +L  +P +RP++ ++++ +
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 129/276 (46%), Gaps = 32/276 (11%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +R+  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            ++D     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   + 
Sbjct: 140 QFVDCFEDDTN-------VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+   K    K+ DFG  + +     N +E +Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSAR-----YE 261
             Y +PE++   +      + DIW+ GV +Y L     PF+    E  I+  R     + 
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ--AKEVNIIYERIKCGDFV 296

Query: 262 YPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           +P     S     LI  +L  +P +RP++ ++I+ +
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 129/275 (46%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++    D F    +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     SN       V++L+E C  G L++ +  R    L+E EV   T+Q+   I 
Sbjct: 143 QFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+    +   KI DFG  + +     N  E +Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW++GV LY L     PF+    N     I    + +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S+  K LI  +L  +P +RP++ ++++ +
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 131/275 (47%), Gaps = 30/275 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++      F    +A   ++ +  + +   L +E+   K +++  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 137

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            +ID     +N       V++L+E C  G L+D +  R    LTE EV   T+Q+   I 
Sbjct: 138 QFIDCFEDDTN-------VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH  +  ++HRD+K+ N+    +   KI DFG  + +     N +E +Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 237

Query: 207 AQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF---EKNGGEAAILSARYEY 262
             Y +PE++   + G   +   DIW+IGV +Y L     PF   E N     I S  Y +
Sbjct: 238 PNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIF 295

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
           P     S+ +  LI  +L  +P +RP++ ++++ +
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 128/273 (46%), Gaps = 30/273 (10%)

Query: 27  YITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVV 86
           ++  GGFA+ + ++    + F    +A   +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIA 146
            ++D     SN       V++L+E C  G L++ +  R    LTE EV   T+Q+   I 
Sbjct: 143 QFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
            MH+ +  ++HRD+K+ N+    +   KI DFG  + +     N  E +Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK---NGGEAAILSARYEY 262
             Y +PE ++  + G   +   DIW++GV LY L     PF+    N     I    + +
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           P     S+  K LI  +L  +P +RP++ ++++
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMD 333

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 86/305 (28%), Positives = 140/305 (45%), Gaps = 39/305 (12%)

Query: 1   MNQPKIDTYHPGTILPVGSH-QVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVI 59
           +   KI  +  G+IL  GS  +V + ++ T+G  A +  V  S   +   +N + +    
Sbjct: 18  LKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSN 77

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLID 119
            PD       R E+  MKLL N+ +V+   D   +KSN       +++++EY E+G L +
Sbjct: 78  DPDLLPYGIER-EIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFN 128

Query: 120 FMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFG 179
            +  R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG
Sbjct: 129 LLVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG 184

Query: 180 SVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVF 235
             +                 D L  T+     Y +PE++    GLP    +SD+W+ GV 
Sbjct: 185 MAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVI 228

Query: 236 LYKLCYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
           LY L     PF+++ G    L     S  YE P     S   + LI  +L  +P +R   
Sbjct: 229 LYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKT 288

Query: 291 YQVIE 295
            ++++
Sbjct: 289 REILK 293

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 139/334 (41%), Gaps = 61/334 (18%)

Query: 15  LPVGSHQVRIIKYITSGGFAQIYTVE---ISPPDSFCDSNIACLKRVIVP--DKPSLNTL 69
           L +   +  I K +    F+ IY V+        S   +N+  LKR+  P  +  S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNR- 128
             EVD  K  ++  +++  +DS  ++    +GS  V++L+ Y   G L D  +  L N  
Sbjct: 86  MKEVDNYKRFQS-PYIIHLVDSQVAQQR--DGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LTESEVLSITSQVAQGIAAMHA---------------------------------LQPP 154
            ++E+E + I   +A+G+  +H                                  L+  
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 155 LL------------HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVL 202
           +L            HRDIK  N+L S      I + GS S      +   +L  +Q  V 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 KNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKN---GGEA---AIL 256
            + T  Y +PE++       +D K DIW++G   Y + +  +PFE+     G +   AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 257 SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
           +  + +P+   YSE L  LI   L  NP  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/349 (20%), Positives = 143/349 (40%), Gaps = 64/349 (18%)

Query: 9   YHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNT 68
           +  G  + +      +   +  G    +Y V+   P       +  LK+V  P   +   
Sbjct: 18  WFDGVRISINGKSYLVTTLLREGELTALYQVKC--PKRSHSGGVYALKKVTCPIGRADFV 75

Query: 69  LRAEVDAMKLLR-NNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL-- 125
            RA  +     R N+ ++ + +D   ++ +  NG+  +++L+ Y   G L D +N  +  
Sbjct: 76  TRAMTEISNYQRFNSPYITNILDFQVAQHD--NGTKIIYMLLPYFPAGSLQDLINNMIIR 133

Query: 126 QNRLTESEVLSITSQVAQGIAAMHA----------------------------------- 150
            + L+ES V+ +   + +G+  MH                                    
Sbjct: 134 GDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMEL 193

Query: 151 --LQPPL--------LHRDIKIENVLISKSNQYKICDFGSVSGIIRPP---HNPQELQYV 197
             L PPL        +H  +  EN+++S      I +  S    +R P    +  +L  +
Sbjct: 194 DLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGL 250

Query: 198 QHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGG------ 251
           Q  + +N+   Y  PE++D +    I  + DIW++G   Y L Y  + F +         
Sbjct: 251 QEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPI 310

Query: 252 EAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300
           + +I +  + +P+ P YS+ LK ++   L+ +PH+RP+IY+ + +  ++
Sbjct: 311 KHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 103/200 (51%), Gaps = 30/200 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +LTE E +    Q+ +G+   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K  +  KI DFG  +           LQ V + +LK +     Y SPE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAA-----------LQ-VSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  ++   + RY+ PN+   S+  K L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 276 IHAMLMENPHQRPNIYQVIE 295
           I  +L+ NP  R    Q++E
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 110/218 (50%), Gaps = 28/218 (12%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +L+E E +   +Q+ QG++  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRG 220
           N+L+ K N+  KI DFG  +  +  P+   E            +  Y SPE++    Y G
Sbjct: 256 NLLLDKKNKVIKIADFGMAA--LELPNKLLETSC--------GSPHYASPEIVMGKPYHG 305

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHLIH 277
            P    SD+W+ G+ L+ L     PF  +  +  +L   + R++ P  P  +   K LI 
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLIT 359

Query: 278 AMLMENPHQRPNIYQVIEE--ISKMQNVPCPIVNFYLV 313
            +L+ NP +R  I +++    I K +N P  I    L+
Sbjct: 360 RILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLL 397

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 100/199 (50%), Gaps = 27/199 (13%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N + E +V  ITSQV +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI----DFYRG 220
           +L++     K+ DFG VSG IR     +   +V        T  + +PE++    D Y  
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRA--TLKRGTFV-------GTPYWMAPEVVSKENDGY-- 191

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPI----YSERLKHLI 276
              DEK+DIW++G+ +Y+L     P  K      +++     P  P     YS   K+ +
Sbjct: 192 ---DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKP--PALHGHYSHSAKNFV 246

Query: 277 HAMLMENPHQRPNIYQVIE 295
            + L++NP  R + Y+++E
Sbjct: 247 SSCLVKNPVGRASAYEMVE 265

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 124/270 (45%), Gaps = 46/270 (17%)

Query: 69  LRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNR 128
           +  E+  MKLL ++ +V+S  D   + +N       ++L++EY E+G L + +       
Sbjct: 74  IEREIVIMKLL-SHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVD--HGP 123

Query: 129 LTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPP 188
           L E E ++   Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +      
Sbjct: 124 LPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAA------ 175

Query: 189 HNPQELQYVQHDVLKNTTAQ--YRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKLCYYTTP 245
                LQ    D+L+ +     Y +PE++    GLP +   SD+W+ GV L+ L     P
Sbjct: 176 -----LQ-TDADLLETSCGSPHYAAPEIV---SGLPYEGFASDVWSCGVILFALLTGRLP 226

Query: 246 FEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI---------- 290
           F++  G    L       ++E PN    S   + LI  +L+ +P QR  I          
Sbjct: 227 FDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286

Query: 291 -YQVIEEISKMQNVPCPIVNFYLVTQQQKH 319
            YQ I++   ++++P      Y +     H
Sbjct: 287 KYQTIKDSKSIKDLPRENTYLYPLADSNNH 316

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 106/199 (53%), Gaps = 30/199 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +LTESE +    Q+  GI+  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K  +  KI DFG  +           LQ V + +L+ +     Y SPE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAA-----------LQ-VSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SDIW+ G+ L+ L     PF  +  +  ++   + RY+ P++   S+  K+L
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 276 IHAMLMENPHQRPNIYQVI 294
           I  +L+ +P +R +  Q++
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 98/196 (50%), Gaps = 22/196 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D + +   +R+   E + + +Q+  G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ KS   K+ DF    G  R       L+ +        T  Y +PE+I+   Y G 
Sbjct: 159 NILLDKSGDAKLTDF----GFTRECMTKTTLETICG------TTVYMAPELIERKSYDGF 208

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP--NFPIYSERLKHLIHAM 279
            I    DIW++GV LY +   + PF+++          ++ P  N  I +   K LI  +
Sbjct: 209 KI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRL 264

Query: 280 LMENPHQRPNIYQVIE 295
           L +NP+ RP + Q+++
Sbjct: 265 LAKNPNDRPTVEQILK 280

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 123/274 (44%), Gaps = 50/274 (18%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLL ++ +V+S  D   + +N       ++L++EY E+G L + +  R    L E
Sbjct: 77  EIVIMKLL-SHPNVLSLYDVWETDNN-------LYLILEYAEKGELFNLLVDR--GPLPE 126

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
            E +    Q+   I+  HAL   ++HRD+K EN+L+  S   KI DFG            
Sbjct: 127 REAIKCFKQIIIAISYCHALG--IVHRDLKPENLLLDNSYNIKIADFG------------ 172

Query: 192 QELQYVQHDVLKNTTA----QYRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKLCYYTTPF 246
             +  +Q D     T+     Y +PE++    GLP +   SD+W+ GV L+ L     PF
Sbjct: 173 --MAALQTDAGMLETSCGSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPF 227

Query: 247 EKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI----------- 290
           ++  G    L       ++E PN    S   + LI  +L+ +P QR  I           
Sbjct: 228 DEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287

Query: 291 YQVIEEISKMQNVPCPIVNFYLVTQQQKHKMVQL 324
           YQ I++   ++++P      Y +     H  V +
Sbjct: 288 YQTIKDSKSIKDLPRENTYLYPLADADNHTSVTI 321

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 100/198 (50%), Gaps = 27/198 (13%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L ES+   IT +V +G+  +H  +   +HRDIK  N
Sbjct: 88  MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAAN 145

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI----DFYRG 220
           +L++   + K+ DFG VSG IR     +   +V        T  + +PE++    D Y  
Sbjct: 146 ILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV-------GTPFWMAPEVVSKDSDGY-- 193

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPI----YSERLKHLI 276
              DEK+DIW++G+ +Y+L   + P  K      +++     P  P+    YS   KH +
Sbjct: 194 ---DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKP--PVLHGHYSSAAKHFV 248

Query: 277 HAMLMENPHQRPNIYQVI 294
            + L++NP  RP+  +++
Sbjct: 249 ASCLVKNPKNRPSAVELL 266

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 140/305 (45%), Gaps = 56/305 (18%)

Query: 2   NQPKIDTYHPGTILPVGSH-QVRIIKYITSGGFAQIYTVEISPPDSFCDSN-IACLKRVI 59
           N+  +  +  G  L  GS  +VR+ K + +G  + I  V    P  F  SN I  L   I
Sbjct: 66  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIV----PKKFVKSNQIKQLPYGI 121

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLID 119
                       E+  MKL+ ++ +V+   +   +KS       E++L++EY E G L D
Sbjct: 122 ----------EREIIIMKLI-SHPNVMGLYEVWENKS-------ELYLVLEYVEGGELFD 163

Query: 120 FMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQY-KICDF 178
           ++ ++   +L ESE +    Q+ Q +A  H     + HRD+K EN+L+ K  +  KI DF
Sbjct: 164 YLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPENLLLDKKKRSIKIADF 219

Query: 179 GSVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMI--DFYRGLPIDEKSDIWAIG 233
           G  +                 D L  T+     Y SPE++    Y G P    SD+W+ G
Sbjct: 220 GMAA-------------LETSDKLLETSCGSPHYASPEIVLGRKYHGSP----SDVWSCG 262

Query: 234 VFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
           + L+ L     PF  +  +  +L   S +Y+ P +   S   K LI  +L+ +P++R  I
Sbjct: 263 IILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDLISRILVVDPNRRITI 320

Query: 291 YQVIE 295
            Q+++
Sbjct: 321 DQILQ 325

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 98/203 (48%), Gaps = 22/203 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V+LLMEY   G L   +  R      +        Q+A  +  +H  Q  ++HRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +LI  +N  K+ DFG    II P       + V+   L  T   Y SPEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFGW--SIINP-------RGVKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLIHAMLM 281
           +K D+WA+GV  Y+L   + PFE++  E     IL    ++P     S  +K LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 282 ENPHQRPNIYQVIEEISKMQNVP 304
            NP +R ++  V++    ++N P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 127/311 (40%), Gaps = 59/311 (18%)

Query: 5   KIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKP 64
           K   Y+ G+ +  GSH V             +Y V  S    F    + C      P+K 
Sbjct: 38  KEKVYYRGSEINRGSHSV-------------VYKVFDSEDRIFAGKKVHC------PNKE 78

Query: 65  SLNTLRAEVDAMKLL--RNNKHVVSYIDSHASKSNFNNGSYE-VFLLMEYCERGGLIDFM 121
           +   +  E++  K++   ++ H+V+  D+      F  G    ++++++YC    L   +
Sbjct: 79  NKRKIIKELEIYKVICRSHHNHIVALRDA------FQWGKESCIYMILDYCSNNSLQSIL 132

Query: 122 NTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSV 181
             R    L E E   +  Q+  GI  +H     ++H D+K+ N+L  +  Q KICDFGS 
Sbjct: 133 QYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLKICDFGSS 188

Query: 182 SGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRG--------LPIDEKSDIWAIG 233
                 P  P E+           T  Y +PE +  ++         L I    DIW++G
Sbjct: 189 FIATSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISFPIDIWSMG 239

Query: 234 VFLYKLCYYTTPFEKNGGE----------AAILSARYEYPNFPIYSERLKHLIHAMLMEN 283
           + LY L Y   PF K+  E            I S   E+P         + LI  ML +N
Sbjct: 240 IVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKMLSQN 299

Query: 284 PHQRPNIYQVI 294
           P +R  + +++
Sbjct: 300 PLERITLVEIV 310

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 125/262 (47%), Gaps = 31/262 (11%)

Query: 52  IACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEY 111
           +  +K ++  +   LN + AE+ ++    NN ++V Y         F   SYE+++L+EY
Sbjct: 50  VVAIKEIVYENDEELNDIMAEI-SLLKNLNNNNIVKY-------HGFIRKSYELYILLEY 101

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
           C  G L   + +R    L+E+E  +  +Q   G+  +H     ++HRDIK  N+L+S  N
Sbjct: 102 CANGSLRRLV-SRSPTGLSENESKTYVTQTLWGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
             K+ DFG VS I+    N   L           T  + +PE++   RG      SDIW+
Sbjct: 159 TVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG-NRG--ASTLSDIWS 203

Query: 232 IGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP--IYSERLKHLIHAMLMENPHQRPN 289
           +G  + +L     P+  N  +A I  A      +P   +SE LK  +    ++N ++RP 
Sbjct: 204 LGATVVELLTKNPPYH-NLTDANIYYAVENDTYYPPTAFSESLKDFLSKCFVKNMYKRPT 262

Query: 290 IYQVIEE--ISKMQNVPCPIVN 309
             Q+++   I+  +NV    +N
Sbjct: 263 ADQLLKHAWITSTENVKVDKLN 284

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 99/200 (49%), Gaps = 30/200 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY E G L D++  R   +L E E +    Q+ QG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K N+  KI DFG  +           L+     +L+ +     Y SPE++    Y
Sbjct: 194 NLLLDKKNKTVKIADFGMAA-----------LETTNR-LLETSCGSPHYASPEIVMGQKY 241

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILS---ARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +     +L     RY+ P+    S+  K L
Sbjct: 242 HGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDL 295

Query: 276 IHAMLMENPHQRPNIYQVIE 295
           I  +L+ +P +R  + +++E
Sbjct: 296 ISKILVVDPEKRITVDKILE 315

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 113/227 (49%), Gaps = 25/227 (11%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E +A++ + N+K +V    +   +S+       ++ L+EYC  G  +  M  +    L E
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDESS-------LYFLLEYCPNGDFLSLM--KKYGSLNE 277

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
           +     ++QV   I  +H     ++HRDIK EN+L+ K  + K+ DFG+   +    +N 
Sbjct: 278 TVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNK 335

Query: 192 QELQYVQHDVLKNTTAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNG 250
            +L       +   TA+Y +PE++ D +    +D + D+WA G  LY++     PF+   
Sbjct: 336 FDLLTRSKSFV--GTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATN 389

Query: 251 GEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
                  ++  +Y +   FP+    ++ L+  +L+++ +QRP+I Q+
Sbjct: 390 EYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 106/233 (45%), Gaps = 32/233 (13%)

Query: 66   LNTLRAEVDAMKLLRNNKH----VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFM 121
            L T+ +E+  M  L  NKH    +++ ID       F +  Y       + E G +  F 
Sbjct: 1049 LGTIPSEIQIMAAL--NKHPDGNILTLIDF------FEDDDYYYIETPVHGETGCIDLFD 1100

Query: 122  NTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSV 181
               L+  +TE E   I  QV   I  +H+    ++HRDIK ENV++      K+ DFGS 
Sbjct: 1101 LIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVKLIDFGSA 1158

Query: 182  SGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEK-SDIWAIGVFLYKLC 240
            + +   P           DV   T   Y +PE++    G P D K  DIWAIGV LY + 
Sbjct: 1159 AYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIGVLLYTIV 1204

Query: 241  YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
            +   PF  N  E  IL    ++      SE   +LI  +L +NP QRP I +V
Sbjct: 1205 FKENPF-YNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 84/181 (46%), Gaps = 23/181 (12%)

Query: 116  GLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G ID  +   L+N +TE EV  I  Q+  GI  +H     ++HRDIK ENV++  +   K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAI 232
            + DFGS + +   P           DV   T   Y +PE++  D Y G P     DIWAI
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
            G+ LY + +   PF  N  E  IL     +      S   K LI  +L  N  +RP I  
Sbjct: 1375 GILLYTIVFKENPF-YNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDD 1431

Query: 293  V 293
            +
Sbjct: 1432 I 1432

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 112/241 (46%), Gaps = 30/241 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G L+  M  +    L E       +Q+   I  MH+    ++HRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLM--KKFGSLNEECCCYYGAQIIDAIKFMHS--KGIIHRDIKPEN 303

Query: 165 VLISKSNQYKICDFGSVSGII-RPPHNPQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLP 222
           +L+ K  + KI DFG+   +  +PP    +L       +   TA+Y SPE++ D Y    
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFV--GTAEYVSPELLNDNY---- 357

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHA 278
            D +SDIWA G  ++++     PF+          ++  +Y +   FP     ++ L+  
Sbjct: 358 TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTV---VRDLVKR 414

Query: 279 MLMENPHQRPNIYQVIE----------EISKMQNVPCPIVNFYLVTQQQKHKMVQLQPIP 328
           +L++ P QR  I + IE          + S + N P P +  Y +  +    + QL+ IP
Sbjct: 415 ILIKAPEQRLTI-EAIEKHHFFRSKNFQDSSIWNDPAPEIQPYKINAKSMQAVPQLKDIP 473

Query: 329 V 329
           +
Sbjct: 474 L 474

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 120/270 (44%), Gaps = 52/270 (19%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLL ++ +V+S  D   + +N       ++L++EY E+G L + +  R    L E
Sbjct: 69  EIVVMKLL-SHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDR--GPLPE 118

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
            E +    Q+   I+  HAL   ++HRD+K EN+L+      KI DFG            
Sbjct: 119 KEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFG------------ 164

Query: 192 QELQYVQHDVLKNTTA----QYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
             +  +Q D     T+     Y +PE++    YRG      SD+W+ GV L+ L     P
Sbjct: 165 --MAALQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLTGRLP 218

Query: 246 FEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI---------- 290
           F+++ G    L       ++E P+    S+  ++LI  +L+ +P QR             
Sbjct: 219 FDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLK 278

Query: 291 -YQVIEEISKMQNVPCPIVNFYLVTQQQKH 319
            YQ I +   ++N+P      Y +     H
Sbjct: 279 KYQTIRDSKSIRNLPRENTYLYPLADAGNH 308

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 118/266 (44%), Gaps = 41/266 (15%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLS------ITSQVAQGIAAMHALQPPL 155
           S +V+L++EYC RG +      +L+ +     +LS      I S V  G+  +H+    +
Sbjct: 128 SAKVYLVLEYCSRGPVKWCPENQLEIKAVGPPILSFQQARNIVSDVVSGLEYLHSQG--I 185

Query: 156 LHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT---TAQYRSP 212
           +HRDIK  N+LIS +   KI DFG VS  I        +Q     +LK+    T  + +P
Sbjct: 186 IHRDIKPSNLLISSNGTVKISDFG-VS--ILTAAESTNIQSSHEPILKSKTFGTPAFFAP 242

Query: 213 EMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERL 272
           E+             DIW++GV LY L + T PF  N G     +   +  +FP Y E L
Sbjct: 243 ELCSTETYCCRSSAIDIWSLGVTLYCLLFGTLPFNANSGLELFDNIINKPLDFPSYEEIL 302

Query: 273 KH---------------LIHAMLMENPHQRPNIYQVIEE--ISKMQNVPCPIVNFYL--- 312
           KH               L++ +L +NP +R ++ +      + +  N   P+V   L   
Sbjct: 303 KHDSSNVTIEEYRDAKDLLYKLLEKNPSRRISLAETKTHPFMCRYDNNAAPVVTPLLADP 362

Query: 313 -------VTQQQKHKMVQLQPIPVNT 331
                  ++     K V+L  +PVN+
Sbjct: 363 ETFRELKISPPSSCKKVELLNLPVNS 388

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++  EYC    L D +   LQ R+  S  + + +Q+   +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGL 221
           N+L+ K+   K+ DF    G  R       L+ +        T  Y +PE+I  + Y G 
Sbjct: 159 NILLDKNGNAKLTDF----GFTRECMTKTSLETICG------TTVYMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAM 279
            I    DIW++GV LY +   + PF+++           E P F   I SE  K L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 280 LMENPHQRPNIYQVI 294
           L ++P++RP++ +++
Sbjct: 265 LSKDPNERPSMQEIL 279

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 44/275 (16%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E +A++ L N++ +V    +   +S+       ++ L+EY   G  +  M  +    L+E
Sbjct: 230 EKNALQRLNNSRGIVKLFFTFQDESS-------LYFLLEYAPNGDFLSVM--KKYGSLSE 280

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPH-- 189
                 ++Q+  GI  +H+    ++HRDIK EN+L+ K  + KI DFG+   I+ P +  
Sbjct: 281 DCTRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGTAK-ILEPKNED 337

Query: 190 --NPQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
             NP E   +        TA+Y SPE++ D Y    +D + DIWA G  ++++     PF
Sbjct: 338 EDNP-EFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPF 392

Query: 247 EKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE------- 295
           +          ++  +Y +   FP+    ++ L+  +L++ P QR  I Q+ +       
Sbjct: 393 KATNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLKVPEQRLTIPQIEKHHFYKDI 449

Query: 296 --EISKMQNVPCPIVNFYLVTQQQKHKMVQLQPIP 328
             E   +   P P +  Y +  +       +QP+P
Sbjct: 450 SFEDGSVWTAPAPEIQPYKINAK------SMQPVP 478

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 119/275 (43%), Gaps = 34/275 (12%)

Query: 24  IIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNK 83
           I + +  G F ++Y V   P    C   +  + ++ + +       + E+D    L +  
Sbjct: 120 IGRKLGKGKFGKVYCVRHKPSGLICA--LKVMNKMEIVNFNVQKQFKREIDIQYHLNHKN 177

Query: 84  HVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL-QNRLTESEVLSITSQVA 142
               Y   H SK+        V+L+MEY   G L   +      N +T S  +    Q+ 
Sbjct: 178 LTKLYAFFHDSKN--------VYLVMEYLIGGELYKLLKKNGPMNDITASNYVY---QMT 226

Query: 143 QGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVL 202
             +  MH  +  ++HRD+K EN+LI  +NQ K+ DFG     I  P+N +          
Sbjct: 227 DALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC----- 276

Query: 203 KNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSAR 259
              T  Y SPE+I        DE  D+WA+G+  Y+L     PFE++  E     I  + 
Sbjct: 277 --GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSD 331

Query: 260 YEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
            ++P  P  S   + LI  +L   P +R N+ QV+
Sbjct: 332 LKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 99/187 (52%), Gaps = 15/187 (8%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D + T   N L E++V  IT +V +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +L++   + K+ DFG VSG IR     +   +V        T  + +PE+++       +
Sbjct: 144 ILLTDEGKVKLGDFG-VSGQIRATM--KRGTFV-------GTPYWMAPEVVN-KESNGYN 192

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILS-ARYEYPNF-PIYSERLKHLIHAMLME 282
           EK+DIW++G+ +Y+L     P  K      ++S  R + P     YS+  K  + A L++
Sbjct: 193 EKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKGFVAACLVK 252

Query: 283 NPHQRPN 289
           +P+ RP+
Sbjct: 253 DPNLRPS 259

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 136/290 (46%), Gaps = 49/290 (16%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E +A++ L N++ +V    +   +S+       ++ L+EY   G  +  M  +    L E
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDESS-------LYFLLEYAPNGDFLSIM--KKYGSLNE 265

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
                 ++Q+   I  +H+    ++HRDIK EN+L+ K  + K+ DFG+   I+ P  N 
Sbjct: 266 DCACYYSAQIIDAIDFLHSKG--IVHRDIKPENILLDKDFKVKLTDFGTAK-ILEPKPNT 322

Query: 192 QELQYVQHDVLKNT-----TAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
            +     +D+L  +     TA+Y SPE++ D Y    +D + DIWA G  L+++     P
Sbjct: 323 TD----SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPP 374

Query: 246 FEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE------ 295
           F+          ++  +Y +   FP+    ++ L+  +L++ P QR  I Q+        
Sbjct: 375 FKATNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTIPQIKSHHFFKD 431

Query: 296 ---EISKMQNVPCPIVNFYLVTQQQKHKMVQLQPIP-VNTLNVSQTHPIL 341
              +   + + P P +  Y V+ +       +QPIP ++  +V Q  P++
Sbjct: 432 KNFKDGSIWDEPAPEIQPYKVSAR------SMQPIPALSCGSVPQRRPVI 475

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 30/199 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ +R   RL E E +    Q+ QG++  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K N   KI DFG  +              V + +L+ +     Y SPE++    Y
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGKQY 293

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P     S+  + L
Sbjct: 294 HGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LSKEAQDL 347

Query: 276 IHAMLMENPHQRPNIYQVI 294
           I  +L  NP +R    +++
Sbjct: 348 IAKILTVNPAKRLTTEEIL 366

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D + +   +R++  E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K+   K+ DF    G  R       L+ V        T  Y +PE+I+   Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETVCG------TTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAM 279
            I    DIW++GV LY L   + PF+ +           E PN+   +  +  K LI  +
Sbjct: 212 KI----DIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTLIPDDAKDLISRL 267

Query: 280 LMENPHQRPNIYQVI 294
           L +NP +RP++ QV+
Sbjct: 268 LAKNPKERPSLPQVL 282

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 98/201 (48%), Gaps = 32/201 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY E G L D++ +R   +L E E +    Q+ QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLISKSN-QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMI--DF 217
           N+L+ K N   KI DFG  +           L+    D L  T+     Y SPE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-----------LETT--DKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKH 274
           Y G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P     S   K 
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKD 297

Query: 275 LIHAMLMENPHQRPNIYQVIE 295
           LI  +L+ +P  R  I +V+E
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 136/301 (45%), Gaps = 47/301 (15%)

Query: 7   DTYHP---GTILPVGSH-QVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPD 62
           DT  P   G  L  GS  +VR+ K + +G  A I  V    P     S  A  K      
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIV----PKKVVRSTNASKKSNAANG 111

Query: 63  KPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMN 122
                  R E+  MKL+ ++ ++++  +   +KS       E+FL++EY E G L D++ 
Sbjct: 112 NLPYGIER-EIIIMKLI-SHPNIMALYEVWENKS-------ELFLVLEYVEGGELFDYLV 162

Query: 123 TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN-QYKICDFGSV 181
           ++   +L E E +    Q+ QG+A  H     + HRD+K EN+L+ K N Q KI DFG  
Sbjct: 163 SK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPENLLVDKKNHQIKIADFGMA 218

Query: 182 SGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFYRGLPIDEKSDIWAIGVFLY 237
           +                + +L+ +     Y SPE++    Y G P    SD+W+ G+ L+
Sbjct: 219 A------------LETTNKLLETSCGSPHYASPEIVMGKNYHGSP----SDVWSCGIILF 262

Query: 238 KLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
            L     PF  +  +  +L   S +Y  P     S   + LI  +L+ +P  R  I +V+
Sbjct: 263 ALLTGHLPFNDDNIKKLLLKVQSGKYHMPQN--ISSEAQDLISKILIVDPRGRITINEVL 320

Query: 295 E 295
           +
Sbjct: 321 Q 321

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 102/199 (51%), Gaps = 22/199 (11%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G L+  +  +      E+  +  T+Q+   I  +H++   ++HRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT-----TAQYRSPEMI-DFY 218
           +L++K  + K+ DFG+ + I+ P    Q       ++L+ +     TA+Y SPE++ D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKH 274
                D + DIWA G  L++L     PF+          I+  +Y +   FP     L+ 
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTI---LRD 501

Query: 275 LIHAMLMENPHQRPNIYQV 293
           LI  +L++NP+ R  I+Q+
Sbjct: 502 LIKKILIKNPNNRLTIHQI 520

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 101/199 (50%), Gaps = 30/199 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E+FL++EY + G L D++ +R   RL+E E +    Q+ +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K N+  KI DFG  +           LQ   + +L+ +     Y SPE++    Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA-----------LQ-TSNKLLETSCGSPHYASPEIVMGKTY 234

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  +L   + +Y+ P     S   + L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQDL 288

Query: 276 IHAMLMENPHQRPNIYQVI 294
           I  +L+ +P++R  I  ++
Sbjct: 289 ISRILVVDPNKRITINDIL 307

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 89/184 (48%), Gaps = 23/184 (12%)

Query: 116  GLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G ID  +    ++ +TESE   I  QV  GI  +H     ++HRD+K ENV++      K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRGLPIDEKSDIWAI 232
            + DFGS + +   P           DV   T   Y +PE++    Y G P     DIWAI
Sbjct: 1257 LIDFGSAAYVNSGP----------FDVFVGTI-DYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 233  GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
            G+ LY + +   PF  N  E  IL A  +  N    S+    LI  +L +NP++RP I +
Sbjct: 1302 GILLYTIMFKENPF-YNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDE 1358

Query: 293  VIEE 296
            ++ +
Sbjct: 1359 IVND 1362

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 98/195 (50%), Gaps = 19/195 (9%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +       + ES+V  I     +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +L++   + K+ DFG VSG IR     +   +V        T  + +PE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATM--KRGTFVG-------TPYWMAPEVIN-KQCKGYN 192

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPI----YSERLKHLIHAML 280
           EK+DIW++G+  Y+L     P  K      +L+     P  P     YSE+ K+ +   L
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKP--PKLHGQYSEKAKYFVSLCL 250

Query: 281 MENPHQRPNIYQVIE 295
           +++P QRP+I  ++E
Sbjct: 251 IKDPKQRPSIEALLE 265

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 94/195 (48%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L + +   + +R+   E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGL 221
           N+L+ K+   K+ DF    G  R   +   L+ +        T  Y +PE+I    Y G 
Sbjct: 158 NILLDKNGNAKLTDF----GFTRECVSKSSLETI------CGTTVYMAPELIQRQAYDGF 207

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAM 279
            I    DIW++GV LY +   T PF+++           ++PNF     S   K LI  +
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRL 263

Query: 280 LMENPHQRPNIYQVI 294
           L + P +RP + Q++
Sbjct: 264 LAKCPSERPTMEQIL 278

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 100/204 (49%), Gaps = 40/204 (19%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V++ +EYC    L +++   ++ R+   E   + SQ+   +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISKSNQYKICDFG-----SVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF-- 217
           +L+ K  Q K+ DFG     +  GI+              + +  TT  Y +PE+I+   
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIERKP 203

Query: 218 YRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYE-YPNFPIYSERL---- 272
           Y G  I    D W++G+ LY + +   PF+    E   +  +Y    N P Y +      
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFD----EEDDIKTKYRIVNNEPFYDDNFIDAN 255

Query: 273 -KHLIHAMLMENPHQRPNIYQVIE 295
            K LI  +L ++P QRP++ QV++
Sbjct: 256 GKDLIMQLLQKDPSQRPSLTQVLQ 279

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 97/198 (48%), Gaps = 28/198 (14%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D + ++  +RL   E   + +Q+   +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRGL 221
           NVL+ K+   K+ DF    G  R       L+ V        T  Y +PEMI    Y G 
Sbjct: 163 NVLLDKNGNAKLTDF----GFTRESMTKAVLETVCG------TTVYMAPEMIQHKPYDGF 212

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERL-----KHLI 276
            +    DIW++GV LY L     PF+++     +L+ +    + P+  ER+     ++LI
Sbjct: 213 KV----DIWSLGVILYTLLCGCLPFDEDDD---LLTKQKIINDTPVIDERITIPEAQNLI 265

Query: 277 HAMLMENPHQRPNIYQVI 294
             +L ++P +RPN   ++
Sbjct: 266 EQLLSKDPTERPNTSAIL 283

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 111/213 (52%), Gaps = 34/213 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ +R   +L E E +    Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNT--TAQYRSPEMI--DFY 218
           N+L+ K N+  KI DFG ++ +  P           + +LK +  +  Y SPE++    Y
Sbjct: 244 NLLLDKKNKKIKIADFG-MAALELP-----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYP-NFPIYSERLKH 274
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P N  + +   ++
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMNLSLEA---RN 344

Query: 275 LIHAMLMENPHQRPNIYQVIEE--ISKMQNVPC 305
           LI  +L+ +P +R    +++E   I K  N+P 
Sbjct: 345 LISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 136/304 (44%), Gaps = 46/304 (15%)

Query: 5   KIDTYHP---GTILPVGSHQVRIIKY-ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60
           K DT  P   G+ L VGS    ++ Y  T G  A +  +  S  ++   + I      ++
Sbjct: 10  KGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVL 69

Query: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120
           P       +  E+  MKLL N+ +V+   D   +       S ++++++EY E+G L + 
Sbjct: 70  P-----YGIEREIIIMKLL-NHPNVLRLYDVWET-------SKDLYMVLEYVEKGELFNL 116

Query: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180
           +  R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+L+      K+ DFG 
Sbjct: 117 LVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGM 172

Query: 181 VSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVFL 236
            +                 D L  T+     Y +PE++    GLP    +SD+W+ GV L
Sbjct: 173 AA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVIL 216

Query: 237 YKLCYYTTPFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIY 291
           Y L     PF++  G        + S ++E P     S   + LI  +L  +P QR    
Sbjct: 217 YALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTR 276

Query: 292 QVIE 295
           ++++
Sbjct: 277 EILK 280

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 100/199 (50%), Gaps = 30/199 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E+FL++EY + G L D++ +R   RL E E +    Q+ +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K N+  KI DFG  +           LQ   + +L+ +     Y SPE++    Y
Sbjct: 187 NLLLDKKNKRIKIADFGMAA-----------LQ-TSNKLLETSCGSPHYASPEIVMGKNY 234

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  +L   + +Y+ P     S   + L
Sbjct: 235 NGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS--VSSGAQDL 288

Query: 276 IHAMLMENPHQRPNIYQVI 294
           I  +L+ +P +R +I +++
Sbjct: 289 ISRILVVDPDKRISINEIL 307

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 132/298 (44%), Gaps = 43/298 (14%)

Query: 9   YHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNI-ACLKRVIVPDKPSLN 67
           +  G  L +GS     + Y +S G  Q   +++     F + N  A    ++ PD     
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNNDNANASDSALLTPDSLPYG 77

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN 127
             R E+  MKLL N+ +V+   D   + SN        ++++EY E+G L + +  R   
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETDSNL-------YMVLEYAEKGELFNLLVER--G 126

Query: 128 RLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRP 187
            L E+E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +     
Sbjct: 127 PLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA----- 179

Query: 188 PHNPQELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCYY 242
                       D L  T+     Y +PE+I    Y GL    ++D+W+ G+ L+ L   
Sbjct: 180 --------LETEDKLLETSCGSPHYAAPEIISGLPYHGL----ETDVWSCGIILFALLTG 227

Query: 243 TTPFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
             PF++  G        + S ++E P     S   + LI  +L  +P +R    ++++
Sbjct: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 106/225 (47%), Gaps = 37/225 (16%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLLR+  +V+S  D   + S       ++++++EY E+G L + +  R    L E
Sbjct: 80  EIIIMKLLRH-PNVLSLYDVWETNS-------KLYMILEYAEKGELFNLLVER--GPLPE 129

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +         
Sbjct: 130 KEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKLNIKIADFGMAA--------- 178

Query: 192 QELQYVQHDVLKNTTAQ--YRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCYYTTPFE 247
                 +  +L+ +     Y +PE++    Y G     +SD+W+ GV L+ L     PF+
Sbjct: 179 ---LETKDKMLETSCGSPHYAAPEIVSGVPYHGF----QSDVWSCGVILFALLTGRLPFD 231

Query: 248 KNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
           +  G        + S  YE P+    S+  + LI  +L  +P QR
Sbjct: 232 EEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQR 276

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 95/203 (46%), Gaps = 22/203 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V+L+MEY   G L   +  R      +        Q+A  +  +H  +  ++HRD+K EN
Sbjct: 227 VYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPEN 282

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +LI  +N  K+ DFG    II P       + V+   L  T   Y SPEMI   R    D
Sbjct: 283 ILIGFNNVLKLTDFG--WSIINP-------KGVKRKTLCGTI-DYLSPEMI---RSREYD 329

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLIHAMLM 281
           +  D+WA+GV  Y+L     PFE++  E     IL     +P     S+ ++ LI  +L 
Sbjct: 330 DTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFPG--TVSQDVRDLISRLLK 387

Query: 282 ENPHQRPNIYQVIEEISKMQNVP 304
            +P +R  + +V+     M+N P
Sbjct: 388 NDPKERILLKEVMVHPWIMRNKP 410

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 101/198 (51%), Gaps = 28/198 (14%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E+FL++EY + G L D++ +R   +L+E E +    Q+ +G++  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLISKS-NQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRG 220
           N+L+ K  N  KI DFG  +  +     P +L      V    +  Y SPE++    Y G
Sbjct: 249 NLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIVMGKSYHG 298

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYP-NFPIYSERLKHLI 276
            P    SD+W+ G+ L+ L     PF  +  +  +L   S +++ P N  + +E    LI
Sbjct: 299 SP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQNISLEAE---DLI 351

Query: 277 HAMLMENPHQRPNIYQVI 294
             +L+ +P +R  I  ++
Sbjct: 352 SRILVVDPEKRIQINDIL 369

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 102/221 (46%), Gaps = 42/221 (19%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++L++EY E+G L + +  R    L E E +    Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA----QYRSPEMIDFYRG 220
           +L+      K+ DFG              +  +Q D     T+     Y +PE++    G
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKH 274
           LP +   SD+W+ GV L+ L     PF++  G    L       ++E P+    S+  + 
Sbjct: 201 LPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQD 260

Query: 275 LIHAMLMENPHQRPNI-----------YQVIEEISKMQNVP 304
           LI  +L+ +P QR  I           YQ I++   ++++P
Sbjct: 261 LISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLP 301

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/337 (21%), Positives = 141/337 (41%), Gaps = 67/337 (19%)

Query: 25  IKYITSGGF-------AQIYTVEISPPDSFCDSNIACLKRVIVP--DKPSLNTLRAEVDA 75
           +K +TSG         + + T  ++  D + +     +++++ P  D  S++    E+D 
Sbjct: 51  VKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTDMVVRQIMCPFGDIESVSNALKEIDN 110

Query: 76  MKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN--RLTESE 133
            +  ++  +++  +DS   +    +GS  V +L+ Y   G L D ++  L +  R++ESE
Sbjct: 111 YRYFKS-PYIMQCLDSQVIQRR--DGSKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESE 167

Query: 134 VLSITSQVAQGI--------------------------------AAMHALQPPL------ 155
           V+ +     +G+                                AAM     P       
Sbjct: 168 VIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLS 227

Query: 156 ---------LHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTT 206
                     H +IK  N+L S      I + GS+  +     N + L+ ++    ++ T
Sbjct: 228 SHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCT 287

Query: 207 AQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGG------EAAILSARY 260
             Y  PE+++   G  +D   DIW++G  LY L +  +PF++         +  I  ARY
Sbjct: 288 VYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARY 347

Query: 261 EYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
            +P   +YS++L  +I   L  NP  RP + +++ ++
Sbjct: 348 SFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 93/187 (49%), Gaps = 15/187 (8%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +    +  L E++   IT +V +G+  +H  +   +HRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +L++     K+ DFG VSG I+          ++ D     T  + +PE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKAT--------LKKDTFVG-TPYWMAPEVVKKDES-GYN 192

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSA-RYEYPNF-PIYSERLKHLIHAMLME 282
           EK+DIW++G+ +Y+L     P  K      ++S  +   P     YSE  K  I   L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 283 NPHQRPN 289
           +P+ RPN
Sbjct: 253 DPNARPN 259

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L + +      R++  E   + +Q+   I   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL--LALKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K    K+ DFG     +            Q D +  TT  Y +PE+ +   Y G 
Sbjct: 158 NILLDKKGNAKLTDFGFTRECVSKS---------QLDTICGTTV-YMAPELTERKSYDGF 207

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP--NFPIYSERLKHLIHAM 279
            I    DIWA+GV LY +   + PF+++           E P  N  + S   K LI  +
Sbjct: 208 KI----DIWALGVILYTMINGSMPFDEDDEAKTKWKIVNEMPEINEDLVSPDAKDLIEQL 263

Query: 280 LMENPHQRPNIYQVI 294
           L ++P++RP+I +++
Sbjct: 264 LAKDPNERPSIEKIL 278

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 19/195 (9%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  M  +    L+E       +Q+   I  +H  +  ++HRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM--KRFGTLSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHN-PQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLP 222
           +L+ K+ + K+ DFG+   I R   N P +L       +   TA+Y SPE++ D Y    
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY---- 385

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHA 278
           +D + DIWA G  L+++     PF+          ++  +Y +   FP+    L+ LI  
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQ 442

Query: 279 MLMENPHQRPNIYQV 293
           +L++ P QR  I Q+
Sbjct: 443 LLVKKPEQRLTILQI 457

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 96/195 (49%), Gaps = 22/195 (11%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V++ +EYC    L D++   L+ R+   E   + +Q+   +   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLP 222
           +L+ K+    + DF    G  R      +L+ V        T  Y +PE+I  + Y G  
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAML 280
           +    D W++G+ LY + +   PF+++      L   +E P       S + K LI  +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 281 MENPHQRPNIYQVIE 295
            +N  QRPN+ +V++
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 100/197 (50%), Gaps = 24/197 (12%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D++   +  R+   E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGL 221
           N+L+      K+ DF    G  R      +L+ +        T  Y +PE++  D Y G 
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETIC------GTTVYMAPELLRRDTYDGF 207

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNG---GEAAILSARYEYPNFPIYSERLKHLIHA 278
            I    DIW++GV LY L   + PF++      E  I++   +Y N  I++     LI +
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY-NEKIFNANSIELIKS 262

Query: 279 MLMENPHQRPNIYQVIE 295
           +L+++P +RP++ ++++
Sbjct: 263 LLIKDPKKRPSMTEILK 279

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 42/282 (14%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLN--------TLRAEVDAMKLL 79
            I  G F  +Y        +     +  +K+V VP   S N         LR+EV  +K L
Sbjct: 1184 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL 1238

Query: 80   RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
             ++ ++V Y+        F N +    L +EY   G +   +  R+  R  ES +  +T+
Sbjct: 1239 -DHLNIVQYL-------GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTT 1288

Query: 140  QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
            QV +G+A +H+    +LHRD+K +N+L+ +    KI DF    GI R   +     Y   
Sbjct: 1289 QVLKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNS 1338

Query: 200  DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL--- 256
            D+    T  + +PEM+D  +G     K DIW++G  + ++     P+      AA+    
Sbjct: 1339 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIG 1396

Query: 257  SARYEYP----NFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
             ++   P      P+ S+  +  + A    NP +RP   +++
Sbjct: 1397 KSKSAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 108/212 (50%), Gaps = 34/212 (16%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +L E E +    Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPE 243

Query: 164 NVLISKSN-QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT--TAQYRSPEMI--DFY 218
           N+L+ K N + KI DFG ++ +  P           + +LK +  +  Y SPE++    Y
Sbjct: 244 NLLLDKKNRKIKIADFG-MAALELP-----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYP-NFPIYSERLKH 274
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P N    S   + 
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMNL---SAEARD 344

Query: 275 LIHAMLMENPHQRPNIYQVIEE--ISKMQNVP 304
           LI  +L+ NP +R    +++    I K  N+P
Sbjct: 345 LISKILVINPEKRITTQEILNHPLIKKYDNLP 376

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 87/185 (47%), Gaps = 22/185 (11%)

Query: 111  YCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKS 170
            + E G +  F    L+  +TE E   +  QVA G+  +H  +  ++HRDIK ENV++   
Sbjct: 1087 HGETGSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNR 1144

Query: 171  NQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSD 228
             + KI DFGS + + R P           DV   T   Y +PE++  D Y G P     D
Sbjct: 1145 GRVKIIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QD 1189

Query: 229  IWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRP 288
            +WA+GV LY + Y   PF  N  E  IL          + SE    LI  +L  + ++RP
Sbjct: 1190 VWAVGVLLYTIIYKENPF-YNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRP 1246

Query: 289  NIYQV 293
             +  +
Sbjct: 1247 TVDDI 1251

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 87/186 (46%), Gaps = 23/186 (12%)

Query: 114  RGGLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQ 172
              G ID  +    +  +TE E   I  QVA G+  +H+L   ++HRDIK ENV+I     
Sbjct: 1129 ESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGY 1186

Query: 173  YKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIW 230
             KI DFGS + +   P           DV   T   Y +PE++  + Y G P     DIW
Sbjct: 1187 VKIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVLAGNPYEGKP----QDIW 1231

Query: 231  AIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNI 290
            A+G+ LY + +   PF  N  E  I+     + N    +     LI  ML++   +RP+I
Sbjct: 1232 ALGILLYTIIFKENPF-YNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDI 1288

Query: 291  YQVIEE 296
             +V  +
Sbjct: 1289 NEVFSD 1294

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 110/236 (46%), Gaps = 37/236 (15%)

Query: 69  LRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D   + +N       +++++EY E+G L + +  +    
Sbjct: 90  IEREIIIMKLL-NHTNVLRLYDVWETNNN-------LYMVLEYAEKGELFNLLVEK--GP 139

Query: 129 LTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPP 188
           L E+E +    Q+  G++  HAL   ++HRD+K EN+L+   +  KI DFG  +      
Sbjct: 140 LAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA------ 191

Query: 189 HNPQELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKLCYYTT 244
                      D L  T+     Y +PE++    GLP +  ++DIW+ GV L+ L     
Sbjct: 192 -------LETEDKLLETSCGSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRL 241

Query: 245 PFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           PF++  G        +    +E P     S   + LI  +L  NP QR    ++++
Sbjct: 242 PFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILK 297

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 97/195 (49%), Gaps = 19/195 (9%)

Query: 105 VFLLMEYCERGGLIDFMNT-RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           ++ L+EY   G   DF++  +    L +   +  ++Q+   I  +H  Q  ++HRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLP 222
           N+L+ K  + K+ DFG+   ++      Q    ++       TA+Y SPE++ D Y    
Sbjct: 292 NILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY---- 346

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHA 278
           +D K DIWA G  L+++     PF+          ++  +Y +   FP+    ++ LI  
Sbjct: 347 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLIKQ 403

Query: 279 MLMENPHQRPNIYQV 293
           +L++NP QR +  QV
Sbjct: 404 ILVKNPEQRLDTLQV 418

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 118/256 (46%), Gaps = 32/256 (12%)

Query: 101 GSY----EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLL 156
           GSY    +++++MEYC  G L   +      ++ E  +  I  ++    A MH  +  ++
Sbjct: 83  GSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVI 137

Query: 157 HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ---YRSPE 213
           HRDIK  NVLI+     K+CDFG  +            Q  Q  + + T A    + +PE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF-EKNGGEAAILSARYEYPNFPI--YSE 270
           +I    G+  D K DIW++G+  Y++     P+ E     A  L  + + P      +S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 271 RLKHLIHAMLMENPHQRPNIYQVIEE--ISKMQNVPCPIVNFYLVTQQQKHKMVQLQPIP 328
            LK +I   L E+P +RP+   +++   I   +NVP  I+   L+++   H+  + Q   
Sbjct: 244 ALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILK-ELISRYLLHRDKRSQRES 302

Query: 329 VNTLNVSQTHPILQDG 344
           V++  +    P   DG
Sbjct: 303 VSSSALEDDEPHRTDG 318

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 108/235 (45%), Gaps = 32/235 (13%)

Query: 66   LNTLRAEVDAMKLLR--NNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMN- 122
            L T+ +E+  M  L   +NK+++S +D       F +  Y  ++      + G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDF------FEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 123  TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVS 182
               +  +TE E   I  Q+  GI+ +H  +  ++HRDIK ENV++      K+ DFGS +
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 183  GIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAIGVFLYKLC 240
             +   P           DV   T   Y SPE++  + Y G P     DIWA+G+ LY + 
Sbjct: 1160 YVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIV 1204

Query: 241  YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
            +   PF  N  E  IL    ++P     S     LI  +L  +  +RP+I  + E
Sbjct: 1205 FKENPF-YNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 127/290 (43%), Gaps = 45/290 (15%)

Query: 9   YHPGTILPVGS-HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLN 67
           +  G  L +GS  +V++    T+G  A I  +      S  ++N A    +  PD     
Sbjct: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAIKVIS----KSVFNNNSAQSSSLTTPDALPYG 73

Query: 68  TLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN 127
             R E+  MKLL N+ +V+   D   + SN       +++++EY E+G L + +  +   
Sbjct: 74  IER-EIIIMKLL-NHPNVLRLYDVWETNSN-------LYMVLEYAEKGELFNLLVEK--G 122

Query: 128 RLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRP 187
            L E E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +     
Sbjct: 123 PLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA----- 175

Query: 188 PHNPQELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCYY 242
                       D L  T+     Y +PE++    Y G      SD+W+ GV L+ L   
Sbjct: 176 --------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----SDVWSCGVILFALLTG 223

Query: 243 TTPFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
             PF++  G        + S  +E P+    S   + L+  +L  +P +R
Sbjct: 224 RLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKR 273

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 29/201 (14%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           ++++++EY E+G L + +  R    L E+E +    Q+  GI+  HAL   ++HRD+K E
Sbjct: 102 DLYMVLEYVEKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPE 157

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDFYRG 220
           N+L+      K+ DFG  +                 D L  T+     Y +PE++    G
Sbjct: 158 NLLLDHKFNIKLADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVS---G 201

Query: 221 LPIDE-KSDIWAIGVFLYKLCYYTTPFEKNGGE-----AAILSARYEYPNFPIYSERLKH 274
           LP    +SD+W+ GV LY L     PF++  G        + S +YE P     S   + 
Sbjct: 202 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARD 261

Query: 275 LIHAMLMENPHQRPNIYQVIE 295
           LI  +L   P QR    ++++
Sbjct: 262 LIVQILTVEPEQRIKTREILK 282

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 39/234 (16%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLLR+  +V+S  D   + SN       +++++EY E+G L + +  +    L E
Sbjct: 84  EIIIMKLLRH-ANVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEK--GPLPE 133

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
            E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +         
Sbjct: 134 KEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 182

Query: 192 QELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
                   D L  T+     Y +PE++    Y G     +SD+W+ GV L+ L     PF
Sbjct: 183 ----LETEDKLLETSCGSPHYAAPEIVSGIPYHGF----ESDVWSCGVILFALLTGRLPF 234

Query: 247 EKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           ++  G        + S ++E P+    S   + LI  +L  +P +R    ++++
Sbjct: 235 DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 98/197 (49%), Gaps = 21/197 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +       L E +V  IT  V +G+  +H  +   +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT---TAQYRSPEMIDFYRGL 221
           VL++     K+ DFG VSG +R                +NT   T  + +PE+I      
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAK------------RNTFVGTPYWMAPEIIS-NSSH 195

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEK-NGGEAAILSARYEYPNFPI-YSERLKHLIHAM 279
             +EK+DIW++G+ +Y+L     P+ K + G+      +    +  + +S+  K  I A 
Sbjct: 196 GYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISAC 255

Query: 280 LMENPHQRPNIYQVIEE 296
           L+++P +RP   +++++
Sbjct: 256 LIKDPDERPTATELLQQ 272

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 144/323 (44%), Gaps = 76/323 (23%)

Query: 7   DTYHP---GTILPVGSH-QVRIIKYITSGGFAQIYTV----------EISPPDSFCDSNI 52
           DT  P   G  L  GS  +VR+ K + +G  A I  V          + SP  S   S  
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSS-- 125

Query: 53  ACLKRVIVPDKP----------SLNT--LRAEVDAMKLLRNNKHVVSYIDSHASKSNFNN 100
                   PDKP          S N+  +  E+  MKL+ ++ +V+   +   +KS    
Sbjct: 126 --------PDKPYTTHSNETNPSNNSYGIEREIVIMKLI-SHPNVMGLYEVWENKS---- 172

Query: 101 GSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDI 160
              E++L++EY + G L D++ +R   +L E E +    Q+ QG+A  HA    + HRD+
Sbjct: 173 ---ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDL 225

Query: 161 KIENVLISKSNQ-YKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMI- 215
           K EN+L+ K N+  KI DFG  +  +              D L +T+     Y SPE++ 
Sbjct: 226 KPENLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIVM 272

Query: 216 -DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSER 271
              Y G P    +D+W+ G+ L+ L     PF  +  +  +L   S  Y  P+    S  
Sbjct: 273 GKSYHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPS--DLSPD 326

Query: 272 LKHLIHAMLMENPHQRPNIYQVI 294
            K LI  +L+ +P +R    +++
Sbjct: 327 AKDLISKILVVDPDKRLTTTEIL 349

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 93/194 (47%), Gaps = 16/194 (8%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++M+YC  G   D +     N + E +V  I   V  G+  +H  +   +HRDIK  N
Sbjct: 87  MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHEQKK--IHRDIKAAN 144

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +L++   Q K+ DFG VSG I+          ++ D    T   + +PE+I+       D
Sbjct: 145 ILLTDDGQVKLGDFG-VSGQIKAT--------LKRDTFVGT-PYWMAPEVINKEINNGYD 194

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP---NFPIYSERLKHLIHAMLM 281
           EK DIW++G+  Y+L     P  K      + S     P   + P Y++  K  I   L+
Sbjct: 195 EKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGP-YNDFTKSFISFCLI 253

Query: 282 ENPHQRPNIYQVIE 295
           ++P  RPN+  +++
Sbjct: 254 KDPKLRPNVQNLLK 267

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 128/305 (41%), Gaps = 64/305 (20%)

Query: 5   KIDTYHPGTILPVGS------------HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNI 52
           KI  +  G  L +GS            +Q   IK I+      I+ V+     S  DS++
Sbjct: 16  KIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA----IFNVK----GSVKDSSV 67

Query: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYC 112
           A       PD       R E+  MKLL N+ +V+   D   + SN       +++++EY 
Sbjct: 68  AA----STPDSLPYGIER-EIIIMKLL-NHPNVLRLYDVWETNSN-------LYMVLEYA 114

Query: 113 ERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQ 172
           ++G L + +  R    L E E +    Q+  GI+  HAL   ++HRD+K EN+L+     
Sbjct: 115 QKGELFNLLVER--GPLPEKEAIRFFRQIVIGISYCHALG--IVHRDLKPENLLLDHKFN 170

Query: 173 YKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKS 227
            KI DFG  +                 D L  T+     Y +PE++    Y G      S
Sbjct: 171 IKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----S 213

Query: 228 DIWAIGVFLYKLCYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLME 282
           D+W+ GV L+ L     PF+   G    L     S RYE P     S   + LI  +L  
Sbjct: 214 DVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTV 273

Query: 283 NPHQR 287
           +P QR
Sbjct: 274 DPEQR 278

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 139/332 (41%), Gaps = 74/332 (22%)

Query: 13  TILPVGSHQVRIIKYITSGGFAQIYTVEISPP----------DSFCDSNIACLKRVIVP- 61
           T + VGS +  + K I  G FA ++   +  P          DS   +N  C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGL 117
               +K  L  L  E+  +K + ++ H+V  ID       F   S + +L+MEYC  G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLTESEVLSITSQVAQGIAAMHALQPPL 155
              +  R Q                      N L ++ +L+   Q++  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 LHRDIKIENVLISK-----SNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ-- 208
           +HRDIK +N+L+S      ++     D G V     P     +  + +   L NT+    
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAET 256

Query: 209 ------YRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEY 262
                 Y +PE++++ +    + K+D+W++G  LY++CY   PF+        L  + + 
Sbjct: 257 LCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFK--ASNHLELYKKIKK 311

Query: 263 PN----FPIYSE---RLKHLIHAMLMENPHQR 287
            N    FP Y E    LK LI  +L  +P +R
Sbjct: 312 ANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 95/200 (47%), Gaps = 24/200 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  +  +    L E       SQ+   + ++HA+   ++HRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQ-----YVQHDVLKNTTAQYRSPEMI-DFY 218
           +L+ K  + K+ DFG+   +   P N  + +     Y +       TA+Y SPE++ D Y
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGE----AAILSARYEY-PNFPIYSERLK 273
                D + DIWA G  LY++     PF K   E      ++  +Y +   FP+ +   K
Sbjct: 314 ----TDSRCDIWAFGCILYQMVAGKPPF-KAANEYLTFQKVMKIQYAFTAGFPLIA---K 365

Query: 274 HLIHAMLMENPHQRPNIYQV 293
            L+  +L+  P+ R  + Q+
Sbjct: 366 DLVKKLLVREPNDRLTVEQI 385

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 131/278 (47%), Gaps = 29/278 (10%)

Query: 21  QVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPS-LNTLRAEVDAMKLL 79
           Q  I++ I  G F  +Y            + I  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKARY-----LATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
           R+      YI ++ +    +     ++++MEYC  G   + +    +++LTE +   I S
Sbjct: 74  RS-----PYITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVS 125

Query: 140 QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
           +V  G+  +H+ +   +HRDIK  N+L++ +   K+ DFG VSG        Q +   + 
Sbjct: 126 EVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRKR 174

Query: 200 DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSA- 258
           D    T   + +PE+ID  +    +E +DIW++G+ + +L     P +K     A+++  
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 259 RYEYPNF-PIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           + + P     +S   K  +   L+++P QRP   ++++
Sbjct: 233 KRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 115/282 (40%), Gaps = 32/282 (11%)

Query: 26  KYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHV 85
           K +  G F ++Y V   P    C       K +I  +       R EV+    LR+    
Sbjct: 112 KILGKGKFGKVYCVRHIPSGFICALKAMEKKEIIQYNIEK--QFRREVEIQSSLRHPNLT 169

Query: 86  VSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGI 145
             Y   H  K         V+L+MEY   G L   +  R  N  ++        Q+A  +
Sbjct: 170 QLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYVYQMAGAL 219

Query: 146 AAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT 205
             MH  +  +LHRDIK EN++I  +N  K+ DFG  S I       + L           
Sbjct: 220 DYMH--ERNILHRDIKPENIIIGFNNVIKLTDFG-WSVINSKGFKRKTLC---------G 267

Query: 206 TAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY 262
           T  Y SPE+I   +    DEK D+WA+GV  Y+L   + PFE+   E     IL     +
Sbjct: 268 TVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLVF 324

Query: 263 PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVP 304
           P+      R  HLI  +L  +P  R  +  V      ++N P
Sbjct: 325 PDHIDPDAR--HLISRLLEYDPANRIALKDVRGHSWILKNQP 364

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 97/205 (47%), Gaps = 29/205 (14%)

Query: 101 GSY----EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLL 156
           GSY    E++++MEYC  G L   +      ++ E  +  I  ++   IA MH  +  ++
Sbjct: 83  GSYLNNTELWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--IALMHIHKDGVI 137

Query: 157 HRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ---YRSPE 213
           HRDIK  NVLI+     K+CDFG  +            Q  Q  + + T A    + +PE
Sbjct: 138 HRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAGTPYWMAPE 185

Query: 214 MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF-EKNGGEAAILSARYEYPNFPI--YSE 270
           +I    G+  D K DIW++G+  Y++     P+ +     A  L  + + P      +S 
Sbjct: 186 VI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSS 243

Query: 271 RLKHLIHAMLMENPHQRPNIYQVIE 295
            LK  I   L E+P +RP+  ++++
Sbjct: 244 ALKEFIALCLDEDPKERPSAEELLK 268

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 113/271 (41%), Gaps = 40/271 (14%)

Query: 24  IIKYITSGGFAQIYTVEISPPDSFCDSNIAC-LKRVIVPDKPSLNT---LRAEVDAMKLL 79
           I K +  G F ++Y V         +S   C LK +   D    N     R EV+    L
Sbjct: 111 IGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSL 164

Query: 80  RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
           R+      Y   H  K         V+LLMEY   G L   +  R  +   +        
Sbjct: 165 RHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVY 214

Query: 140 QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
           Q+A  +  MH  +  +LHRDIK EN++I  +N  K+ DFG    +I P  + ++      
Sbjct: 215 QMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKTLC--- 267

Query: 200 DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---IL 256
                 T  Y SPE+I   R    +EK D+WA+GV  Y+L   + PFE+   E     IL
Sbjct: 268 -----GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRIL 319

Query: 257 SARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
                +P+        +HLI  +L  +P  R
Sbjct: 320 KRNLIFPDH--VDTEARHLISRLLEYDPGDR 348

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 87/184 (47%), Gaps = 21/184 (11%)

Query: 116  GLIDFMNT-RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G +D  +    ++ +TE E   I  Q+  GI  +H     ++HRDIK ENV++      K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKS-DIWAIG 233
            + DFGS + +   P           DV   T   Y +PE++    G P + KS DIWAIG
Sbjct: 1096 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
            + LY L Y   PF  N  E  IL     + +    S+  K LI  +L     +RP I ++
Sbjct: 1142 ILLYTLIYKENPF-YNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEI 1198

Query: 294  IEEI 297
             +++
Sbjct: 1199 CQDV 1202

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 93/203 (45%), Gaps = 22/203 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V+LLMEY   G L   +  R +  L +        Q+A  +  MH  Q  ++HRD+K EN
Sbjct: 182 VYLLMEYLVNGELYKLL--RAKGPLDDIFASHYVYQMADALDYMH--QRNIIHRDVKPEN 237

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +LI   N  K+ DFG    II P    ++            T  Y SPE+I        D
Sbjct: 238 ILIGFDNTVKLTDFG--WSIINPRGTKRKTMC--------GTLDYLSPELI---ASKEYD 284

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLIHAMLM 281
           +K D+WA+GV  ++L   + PFE++  E     I+    ++PN    S   + LI  +L 
Sbjct: 285 DKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFPNH--ISSDAQDLITKLLR 342

Query: 282 ENPHQRPNIYQVIEEISKMQNVP 304
            N   R ++ +V +     +N P
Sbjct: 343 HNSKDRISLREVKQHPWITKNRP 365

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 109/212 (51%), Gaps = 32/212 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +L E E +    Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNT--TAQYRSPEMI--DFY 218
           N+L+ K N+  KI DFG ++ +  P           + +LK +  +  Y SPE++    Y
Sbjct: 244 NLLLDKKNRRIKIADFG-MAALELP-----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P+    S   + L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LSSEARDL 345

Query: 276 IHAMLMENPHQRPNIYQVIEE--ISKMQNVPC 305
           I  +L+ +P +R    ++++   I K  ++P 
Sbjct: 346 ISKILVIDPEKRITTQEILKHPLIKKYDDLPV 377

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 92/197 (46%), Gaps = 25/197 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  I  QV  G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEM----IDFYRG 220
           +L+++    K+ DFG VSG IR           + D     T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP---NFPIYSERLKHLIH 277
              +EK+DIW++G+  Y+L     P  K      + +     P     P +SE  K  + 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSEAAKEFVA 250

Query: 278 AMLMENPHQRPNIYQVI 294
             L++ P  RP+ Y ++
Sbjct: 251 GCLVKTPADRPSAYDLL 267

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 92/196 (46%), Gaps = 23/196 (11%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  I  QV  G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEM----IDFYRG 220
           +L+++    K+ DFG VSG IR          ++ D     T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHA 278
              +EK+DIW++G+  Y+L     P  K      + +     P      +SE  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAG 246

Query: 279 MLMENPHQRPNIYQVI 294
            L++ P  RP+ Y ++
Sbjct: 247 CLVKAPADRPSAYDLL 262

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 96/192 (50%), Gaps = 30/192 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ +R   +L E E +    Q+ QG++  H+    + HRD+K E
Sbjct: 216 ELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN--ICHRDLKPE 271

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNT--TAQYRSPEMI--DFY 218
           N+L+ K N+  KI DFG  +              V + +L+ +  +  Y SPE++    Y
Sbjct: 272 NLLLDKKNKSIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIVMGRPY 319

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHL 275
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S ++  P     S   K L
Sbjct: 320 HGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQN--LSAEAKDL 373

Query: 276 IHAMLMENPHQR 287
           +  +L+ NP +R
Sbjct: 374 MSKILVVNPFKR 385

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 94/195 (48%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D + +   +R++  E   + +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K+   K+ DF    G  R       L+ V        T  Y +PE+I    Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETVCG------TTVYMAPELIGRKTYDGF 211

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAM 279
            I    D W++GV LY L   + PF+ +           E P +   +  +  K LI  +
Sbjct: 212 KI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPDDAKDLISRL 267

Query: 280 LMENPHQRPNIYQVI 294
           L +NP +RP++ QV+
Sbjct: 268 LAKNPGERPSLPQVL 282

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 109/233 (46%), Gaps = 37/233 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D   + S+        +L++EY E+G L + +  R    L E
Sbjct: 79  EIIIMKLL-NHPNVLRLFDVWETNSDL-------YLVLEYAEKGELFNMLVER--GPLPE 128

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
           +E +    Q+  GI+  H+L   ++HRD+K EN+L+      KI DFG  +         
Sbjct: 129 NEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA--------- 177

Query: 192 QELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKLCYYTTPFE 247
                   D L  T+     Y +PE+I    GLP +   SD+W+ GV L+ L     PF+
Sbjct: 178 ----LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFD 230

Query: 248 KNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           +  G        +    +E P+    ++  + L+  +L  +P +R  I ++++
Sbjct: 231 EEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 136/301 (45%), Gaps = 43/301 (14%)

Query: 5   KIDTYHPGTILPVGS-HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDK 63
           +I  +  G  L VGS  +V + + + +G  A +  +  S  ++   + +      ++P  
Sbjct: 16  RIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLP-- 73

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
                +  E+  MKLL N+ +V+   D   +       S ++++++EY E+G L + +  
Sbjct: 74  ---YGIEREITIMKLL-NHPNVLRLYDVWET-------STDLYMVLEYVEKGELFNLLIE 122

Query: 124 RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
           R    L E+E +    Q+  GI+  HAL   ++HRD+K EN+L+      K+ DFG  + 
Sbjct: 123 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA- 177

Query: 184 IIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKL 239
                           D L  T+     Y +PE++    GLP    +SD+W+ GV LY L
Sbjct: 178 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 222

Query: 240 CYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
                PF+++ G    L     S  +E P+    S   + LI  +L  +P  R    +++
Sbjct: 223 LTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREIL 282

Query: 295 E 295
           +
Sbjct: 283 K 283

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 91/196 (46%), Gaps = 20/196 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ ++EY   G L+  +  R    L+ +      +Q+   I A+H++   ++HRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKN--TTAQYRSPEMIDFYRGLP 222
           VL+    + K+ DFG+ + +   P     L+ V   V  +   TA+Y  PE++       
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA-- 329

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLIHAM 279
            D   D+WA    +++L     PF+          +++ RY YP  P +   LK L+  +
Sbjct: 330 -DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRV 386

Query: 280 LMENPHQR---PNIYQ 292
           L   P QR   P I Q
Sbjct: 387 LRHEPRQRLLQPQITQ 402

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 97/195 (49%), Gaps = 19/195 (9%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +    +  LTE +V  IT ++ +G+  +H+ +   +HRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +L++   + K+ DFG VSG        Q +   + D    T   + +PE+I        +
Sbjct: 163 ILLTDDGKVKLGDFG-VSG--------QMMATRRRDTFVGTPF-WMAPEVIARSE-QGYN 211

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAM----L 280
           EK+DIW++G+ +++L     P  ++     ++S     P  P   +R  H I       L
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRP--PKLEDRYSHAIREFVSLCL 269

Query: 281 MENPHQRPNIYQVIE 295
            ++P +RP   ++++
Sbjct: 270 NKDPAKRPTASELLK 284

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 101/216 (46%), Gaps = 32/216 (14%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  IT ++ +G+  +H  +   +HRDIK  N
Sbjct: 93  MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKK--IHRDIKAAN 150

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEM----IDFYRG 220
           +L+++    K+ DFG VSG         +L+          T  + +PE+    I+ Y  
Sbjct: 151 ILLTEEGHVKLGDFG-VSG---------QLKSTLRRGTIVGTPYWMAPEVASQNIEGY-- 198

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILS-ARYEYPNF-PIYSERLKHLIHA 278
              DEK DIW++G+ +++L     P  K      + + +R   P     YS+  K  +  
Sbjct: 199 ---DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVAL 255

Query: 279 MLMENPHQRPNIYQVIEEISKMQNVPCPIVNFYLVT 314
            L++NP++RP    +++          P V F  VT
Sbjct: 256 CLIKNPNERPAAVDLLK---------FPFVRFITVT 282

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 91/195 (46%), Gaps = 17/195 (8%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR   R+TE +     S+V   +  +H L    ++RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 450

Query: 165 VLISKSNQYKICDFG-SVSGIIRPPHNPQELQYVQHDVLKN--------TTAQYRSPEMI 215
           +L+ +S    + DF  S+          ++  Y+   V  +         T +Y +PE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 216 DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGE---AAILSARYEYPNFPIYSERL 272
              RG       D W +G+ +Y++ +  TPF+ +      + IL+   ++P+    S+  
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKHC 567

Query: 273 KHLIHAMLMENPHQR 287
           K LI  +L +N  +R
Sbjct: 568 KDLIKRLLNKNESKR 582

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 87/182 (47%), Gaps = 28/182 (15%)

Query: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176
           L DF+  +  +++ E E   I  Q+  GI  +H L   ++HRDIK EN++I      ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEK-SDIWAIGVF 235
           DFGS +     P        V H      T  Y SPE++   +G P + K  D+WA+G+ 
Sbjct: 822 DFGSAAYATNGPFQ------VFH-----GTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERL----KHLIHAMLMENPHQRPNIY 291
           LY + +  TPF      A I+    E    P +SE +    + LIH ML +    RP I 
Sbjct: 868 LYIITFKQTPF---NSVAEIIENELEID--PAHSENVSDQCRVLIHKMLDKKAWARPKIS 922

Query: 292 QV 293
           ++
Sbjct: 923 EI 924

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 24/195 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V++++EYC    L + +    + RL+  E   + SQ+A  +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHL--LKEQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGLP 222
           VL+  +   K+ DF    G  R      +L+ +        T  Y +PE+I+   Y G  
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETIC------GTTVYMAPELIERKCYDGFK 208

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGG---EAAILSARYEYPNFPIYSERLKHLIHAM 279
           +    DIW++G+ LY +     PF+++     +  I++   ++ N    S+    LI  M
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGM 263

Query: 280 LMENPHQRPNIYQVI 294
           L +NP++R ++ QV+
Sbjct: 264 LRKNPNERISLAQVL 278

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 125/282 (44%), Gaps = 42/282 (14%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLN--------TLRAEVDAMKLL 79
            I  G F  +Y        +     +  +K+V VP   S N         LR+EV  +K L
Sbjct: 1181 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1235

Query: 80   RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
             ++ ++V Y+        F N +    L +EY   G +   +  R+  R  E  +  +T+
Sbjct: 1236 -DHLNIVQYL-------GFENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTT 1285

Query: 140  QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
            QV +G+A +H+    +LHRD+K +N+L+ +    KI DF    GI R   +     Y   
Sbjct: 1286 QVLKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNS 1335

Query: 200  DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL--- 256
            D+    T  + +PEM+D  +G     K DIW++G  + ++     P+      AA+    
Sbjct: 1336 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIG 1393

Query: 257  SARYEYP----NFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
             ++   P      P+ S+  ++ + A    NP +RP   +++
Sbjct: 1394 KSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 137/298 (45%), Gaps = 44/298 (14%)

Query: 27   YITSGGFAQIYT-VEISPPDSFCDSNIACLKRVIVPDKPSLN----TLRAEVDAMKLLRN 81
            +I SG F  +Y+ V +   D      I  +K + + D  S+     +L+ E+  M++L N
Sbjct: 1264 FIGSGSFGTVYSAVNLDTGD------ILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-N 1316

Query: 82   NKHVVSY--IDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSI-T 138
            + ++V Y  ++ H  K N         + ME+CE   L   +      R+ +  V  + T
Sbjct: 1317 HPNIVQYYGVEVHRDKVN---------IFMEFCEGSSLASLLE---HGRIEDEMVTQVYT 1364

Query: 139  SQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSV-----SGIIRPPHNPQE 193
             Q+ +G+A +H  Q  ++HRDIK EN+L+ ++   K  DFG+      +G  R   +   
Sbjct: 1365 LQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANN 1422

Query: 194  LQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA 253
                  D++   T  Y +PE +   +G       DIW++G  + ++     P+     E 
Sbjct: 1423 KSTGGKDMIG--TPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEW 1479

Query: 254  AIL--SARYEYPNFPIYSE---RLKHLIHAMLMENPHQRPNIYQVIEE--ISKMQNVP 304
            AI+   A    P FP  SE     +  I   L+++ ++R    +++ +  IS+++N+ 
Sbjct: 1480 AIMYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELLLDPWISQIRNIA 1537

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 102/205 (49%), Gaps = 42/205 (20%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTE-SEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           V++ +EYC    L +++  +    L E SE+ S   Q+   +   H+++   +HRD+K+E
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSELFS---QIVGAVYYAHSMK--CVHRDLKLE 157

Query: 164 NVLISKSNQYKICDFG-----SVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF- 217
           N+L+ K    K+ DFG     +  GI+              + +  TT  Y +PE+I+  
Sbjct: 158 NILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERK 202

Query: 218 -YRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF-PIYSERL--- 272
            Y G  I    D W++G+ LY + + T PF+    E   +  +Y+  ++ P Y       
Sbjct: 203 PYEGYKI----DTWSLGIILYTMIHGTMPFD----EVDEVKTKYKIVHYNPTYDNDYIDS 254

Query: 273 --KHLIHAMLMENPHQRPNIYQVIE 295
             K LI  +L ++P+QRP++ QV++
Sbjct: 255 NGKELISQLLEKDPNQRPSLTQVLQ 279

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 108/238 (45%), Gaps = 34/238 (14%)

Query: 66   LNTLRAEVDAMKLLRNNKH----VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFM 121
            L T+ +E+  M +L  NKH    ++  +D       F +  Y       + E G +  F 
Sbjct: 1024 LGTIPSEIQIMAVL--NKHPDENILRLLDF------FEDDDYYYIETPVHGETGSIDLFD 1075

Query: 122  NTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSV 181
               L+  +TE E   I  QV  GI  +H  +  ++HRDIK ENV++      K+ DFGS 
Sbjct: 1076 LIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFGSA 1133

Query: 182  SGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAIGVFLYKL 239
            + +   P           DV   T   Y +PE++  + Y G P     DIWA+G+ LY +
Sbjct: 1134 AYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAVGILLYTI 1178

Query: 240  CYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
             +   PF  N  E  I+    ++      SE   +LI  +L +N  +RP I  + +++
Sbjct: 1179 VFKENPF-YNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 123/282 (43%), Gaps = 42/282 (14%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLN--------TLRAEVDAMKLL 79
            I  G F  +Y        +     +  +K+V VP   S N         LR+EV  +K L
Sbjct: 1181 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1235

Query: 80   RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
             ++ ++V Y+        F N      L +EY   G +   +  R+  R  E  +  +T+
Sbjct: 1236 -DHLNIVQYL-------GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTT 1285

Query: 140  QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
            QV +G+A +H+    +LHRD+K +N+L+ +    KI DF    GI R   +     Y   
Sbjct: 1286 QVLKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNS 1335

Query: 200  DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL--- 256
            D+    T  + +PEM+D  +G     K DIW++G  + ++     P+      AA+    
Sbjct: 1336 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIG 1393

Query: 257  SARYEYP----NFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
             ++   P      P+ S+  +  + A    NP +RP   +++
Sbjct: 1394 KSKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 113/232 (48%), Gaps = 33/232 (14%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E + ++ L+N K ++S   +   +S+       ++ L+EY   G L+  M  R    + E
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDESS-------LYFLLEYAPNGDLLSLM--RKHGSVNE 253

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
                  +Q+   +  MH     ++HRD+K EN+L+    + K+ DFG+    +    + 
Sbjct: 254 KCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTAR--LLDSTSE 309

Query: 192 QELQYVQHDVLKNT-----TAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
            +L+Y   D+L  +     TA+Y SPE++ D Y    +D + DIWA G  L+++     P
Sbjct: 310 DDLKY---DLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPP 362

Query: 246 FEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
           F+ N        ++  ++ +   FP+    ++ L+  +L++NP +R  I Q+
Sbjct: 363 FKANNEYLTFQKVMKVQFAFTAGFPMT---VRDLVKNILIKNPERRLLINQI 411

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 116/247 (46%), Gaps = 30/247 (12%)

Query: 65   SLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTR 124
            +++ LR EV  +K L ++ ++V Y+   A      NG Y +FL  EY   G +   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYLGFEA-----KNGIYSLFL--EYVAGGSVGSLI--R 1235

Query: 125  LQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGI 184
            +  R  +  +  +T QV QG++ +H+    +LHRD+K +N+L+ +    KI DF    GI
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GI 1289

Query: 185  IRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTT 244
             R  ++     Y   ++    T  + +PEM+D  +G     K DIW++G  + ++     
Sbjct: 1290 SRKSND----IYSNSEMTMKGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKR 1343

Query: 245  P---FEKNGGEAAILSARYEYP----NFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE- 296
            P   FE       I  A+   P      P+ SE  K  +      +P +RP   +++   
Sbjct: 1344 PWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLLSHP 1403

Query: 297  ISKMQNV 303
             SK+ N+
Sbjct: 1404 FSKVNNL 1410

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 97/200 (48%), Gaps = 24/200 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  +  +    L E+      SQ+   + ++H +   ++HRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQ-----YVQHDVLKNTTAQYRSPEMI-DFY 218
           +L+ K+ + K+ DFG+   +   P N  + +     Y +       TA+Y SPE++ D Y
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG-TAEYVSPELLNDNY 313

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGE----AAILSARYEY-PNFPIYSERLK 273
                D + DIWA G  LY++     PF K   E      ++  +Y +   FP   + +K
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPF-KAANEYLTFQKVMKIQYAFTAGFP---QIVK 365

Query: 274 HLIHAMLMENPHQRPNIYQV 293
            L+  +L+ +P+ R  I Q+
Sbjct: 366 DLVKKLLVRDPNDRLTIKQI 385

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 97/198 (48%), Gaps = 26/198 (13%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           ++FL++EY + G L D++ ++   +L E E +    Q+ +G+A  H+    + HRD+K E
Sbjct: 189 DLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN--ICHRDLKPE 244

Query: 164 NVLISKSNQ-YKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRG 220
           N+L+ K N+  KI DFG  +  +  P+   E            +  Y SPE++    Y G
Sbjct: 245 NLLLDKKNKIIKIADFGMAA--LELPNKLLETSC--------GSPHYASPEIVMGKPYHG 294

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLKHLIH 277
            P    SD+W+ G+ L+ L     PF  +     +L   S R+  P     S   + LI 
Sbjct: 295 GP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPRN--ISLEAQDLIA 348

Query: 278 AMLMENPHQRPNIYQVIE 295
            +L+ NP QR  I  +++
Sbjct: 349 KILVVNPRQRIKISDILK 366

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 91/201 (45%), Gaps = 29/201 (14%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIK 161
           S   ++L EY   G L+D++       L E      T  +A  +  +HA    ++HRD+K
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLK 229

Query: 162 IENVLISKSNQYKICDFGSVSGIIRPPHNPQ----ELQYVQHDVLKNTTAQYRSPEMIDF 217
           IEN++IS S + KI DFG +S +             L +   ++LK   + Y  PE+   
Sbjct: 230 IENIMISTSGEIKIIDFG-LSNLFDKSKQLHTFCGSLYFAAPELLK--ASPYTGPEV--- 283

Query: 218 YRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA---AILSARYEYPNFPIYSERLKH 274
                     D+W+ GV LY L     PF+          I   + EYP     S  +  
Sbjct: 284 ----------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVIS 331

Query: 275 LIHAMLMENPHQRPNIYQVIE 295
           L+  ML+ +PH+R ++ QV+E
Sbjct: 332 LLSKMLVVDPHRRASLKQVVE 352

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 93/195 (47%), Gaps = 22/195 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D + +  +  L E   L   +Q++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLSLRRISLLECGEL--FAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K+   K+ DF    G  R       L+ V        T  Y +PE+I+   Y G 
Sbjct: 162 NILLDKNGNAKLTDF----GFTRECMTKTTLETVCG------TTVYMAPELIERRTYDGF 211

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHAM 279
            I    DIW++GV LY L     PF+ +           E P +   +  +  + LI  +
Sbjct: 212 KI----DIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRL 267

Query: 280 LMENPHQRPNIYQVI 294
           L +NP +RP++ QV+
Sbjct: 268 LAKNPGERPSLSQVL 282

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 92/199 (46%), Gaps = 22/199 (11%)

Query: 98   FNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLH 157
            F +  Y    L  + E G +  F    L+  +TE E   I  Q+  GI  +H     ++H
Sbjct: 870  FEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVH 927

Query: 158  RDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI-- 215
            RDIK ENV++  +   K+ DFGS +     P       +V        T  Y +PE++  
Sbjct: 928  RDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFEV----FVG-------TIDYAAPEILGG 976

Query: 216  DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHL 275
            + Y+G P     DIWA+GV LY L Y   PF  N  E  IL  +  +      ++    L
Sbjct: 977  NPYKGKP----QDIWALGVLLYTLIYKENPF-YNVDE--ILEGQLRFDGTCNVTQDCIDL 1029

Query: 276  IHAMLMENPHQRPNIYQVI 294
            I  +L ++ + RP+I +++
Sbjct: 1030 IRWILTKSVNDRPSIDEIV 1048

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 122/282 (43%), Gaps = 42/282 (14%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLN--------TLRAEVDAMKLL 79
            I  G F  +Y        +     +  +K+V VP   S N         LR+EV  +K L
Sbjct: 1187 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1241

Query: 80   RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
             ++ ++V Y+        F N +    L +EY   G +   +  R+  R  ES +  +T+
Sbjct: 1242 -DHLNIVQYL-------GFENKNSIYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTT 1291

Query: 140  QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
            QV +G+A +H+    +LHRD+K +N+L+ +    KI DF    GI R   +     Y   
Sbjct: 1292 QVLRGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKD----IYSNS 1341

Query: 200  DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSAR 259
            D+    T  + +PEM+D  +G     K DIW++G  + ++     P+      AA+    
Sbjct: 1342 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIG 1399

Query: 260  YEYPNFPIYSERL-------KHLIHAMLMENPHQRPNIYQVI 294
                  PI  + L       +  + A    +P +RP   +++
Sbjct: 1400 KSKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 96/196 (48%), Gaps = 22/196 (11%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L D +      R+  +E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLE 161

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMID--FYRGL 221
           N+L+ K  + K+ DF    G  R       L+ V        T  Y +PE+I+   Y G 
Sbjct: 162 NILLDKHGRAKLTDF----GFTRECMTRSTLETVC------GTTVYMAPELIERKSYDGF 211

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFP--IYSERLKHLIHAM 279
            I    DIWA+GV LY + Y   PF+++           E P+F   I S  +K LI  +
Sbjct: 212 KI----DIWALGVILYTMIYGAMPFDEDDEVKTKWKIVNEDPDFTNNISSNDVKDLIKKL 267

Query: 280 LMENPHQRPNIYQVIE 295
           L ++P +RP I ++++
Sbjct: 268 LKKDPTERPTIREILK 283

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 101/232 (43%), Gaps = 30/232 (12%)

Query: 66   LNTLRAEVDAMKLLRNNKH--VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
            L T+ +E+  M  L    H  +++ +D       F +  Y       + E G +  F   
Sbjct: 1061 LGTIPSEIQIMATLNKKPHENILTLLDF------FEDDDYYYIETPMHGETGSIDLFDLI 1114

Query: 124  RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
             L+  +TE E   I  QVA GI  +H     ++HRDIK EN+++      K+ DFGS + 
Sbjct: 1115 ELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY 1172

Query: 184  IIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAIGVFLYKLCY 241
            +   P           DV   T   Y +PE++  D Y G P     DIWAIGV LY + +
Sbjct: 1173 VKSGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIF 1217

Query: 242  YTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
               PF  N  E  IL       +    SE    LI  +L  +  +RP I ++
Sbjct: 1218 KENPF-YNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 88/195 (45%), Gaps = 36/195 (18%)

Query: 101  GSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDI 160
            GS ++F L+E+              +  +TE E   +  QV  G+  +H     ++HRDI
Sbjct: 1168 GSIDLFDLIEF--------------KTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDI 1211

Query: 161  KIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--Y 218
            K EN+++      KI DFGS + +   P           DV   T   Y +PE++    Y
Sbjct: 1212 KDENIIVDSQGFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGSPY 1260

Query: 219  RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHA 278
             G P     DIWAIG+ LY + +   PF  N  E  IL    ++ +  + SE+   LI  
Sbjct: 1261 EGKP----QDIWAIGILLYTIVFKENPF-YNIDE--ILEGELKFNSSELVSEQCTTLIAK 1313

Query: 279  MLMENPHQRPNIYQV 293
            +L  N  +RP I  +
Sbjct: 1314 ILNRNVQKRPTIDDI 1328

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 115/267 (43%), Gaps = 33/267 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  M  +    L E       +Q+  GI  +H  +  ++HRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLPI 223
           +L+ KS + K+ DFG+   + R     +E            TA+Y SPE++ D +    +
Sbjct: 334 ILLDKSMKVKLTDFGTAKLLNR-KDGTEEYDLTTRSKSFVGTAEYVSPELLNDSW----V 388

Query: 224 DEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAM 279
           D K DIWA G  L+++     PF+          ++  +Y +   FP+    ++ L+  +
Sbjct: 389 DHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRDLVKQI 445

Query: 280 LMENPHQRPNIYQVIEEI---------SKMQNVPCPIVNFYLVTQQQKHKMVQLQPIPVN 330
           L++ P  R  I Q+ + +           + +   P +  Y VT +       +Q IP  
Sbjct: 446 LVKKPEHRLTIPQIEKHLFFSDINFRDGSLWSAAAPEIAPYKVTAK------AMQSIPAL 499

Query: 331 TLNVSQTHP-ILQDGKQRILEQHSSSP 356
               +   P +L D + +     S  P
Sbjct: 500 KDKANNIKPMVLADSRGQTTASKSGGP 526

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 103/236 (43%), Gaps = 34/236 (14%)

Query: 66   LNTLRAEVDAMKLLRNNKH--VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
            L T+ +E+  M  L    H  ++S +D       F +  Y       + E G +  F   
Sbjct: 1169 LGTIPSEIQIMATLNKKPHDNILSLLDF------FEDDDYYYIETPVHGETGCIDLFDLI 1222

Query: 124  RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
              +  +TE E   I  Q+  GI  +H     ++HRDIK ENV++      KI DFGS + 
Sbjct: 1223 EFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY 1280

Query: 184  IIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKLCY 241
            +   P           DV   T   Y +PE++    Y G P     DIWAIG+ LY + +
Sbjct: 1281 VKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVF 1325

Query: 242  YTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
               PF  N  E  IL    ++ N    SE    LI  +L+ +  +RP    +IEEI
Sbjct: 1326 KENPF-YNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRP----LIEEI 1374

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 87/181 (48%), Gaps = 23/181 (12%)

Query: 116  GLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G ID  +   ++  +TE E + I  Q+A GI  +H     ++HRDIK ENV++  +   K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAI 232
            I DFGS + +   P           DV   T   Y +PE++  + Y G P     DIWAI
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 233  GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
            GV LY + Y   PF  N  E  IL A     +    S+    LI  +L  +  +RP+I +
Sbjct: 1148 GVLLYTIIYKENPF-YNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDE 1204

Query: 293  V 293
            +
Sbjct: 1205 I 1205

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 110/240 (45%), Gaps = 37/240 (15%)

Query: 66   LNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL 125
            L  LR+EV  +K L ++ ++V Y+        F N +Y   L +EY   G +   +  RL
Sbjct: 1193 LEALRSEVATLKDL-DHTNIVQYL-------GFENKNYVYSLFLEYVAGGSVGSLI--RL 1242

Query: 126  QNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGII 185
              +  E+ +  +  QV +G++ +H+ +  +LHRD+K +N+L+      KI DF    GI 
Sbjct: 1243 YGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDF----GIS 1296

Query: 186  RPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
            +  +N     Y   D+    T  + +PEM+D  +G     K DIW++G  + ++     P
Sbjct: 1297 KKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1350

Query: 246  FEKNGGEAAILSARYEYPNF-----------PIYSERLKHLIHAMLMENPHQRPNIYQVI 294
            +        +++A ++   F            I S   K  + A    NP +RP   +++
Sbjct: 1351 W----SNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 143/314 (45%), Gaps = 63/314 (20%)

Query: 7   DTYHP---GTILPVGSH-QVRIIKYITSGGFAQI---------------YTVEISPPDSF 47
           DT  P   G  L  GS  +VR+ K I +G  A I                 V      S 
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 48  CDSNIACLKRVIVP--------DKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFN 99
            +SNI+ L     P        ++P+   +  E+  MKL+ ++ +V++  +   +KS   
Sbjct: 156 SNSNISTL--ATSPPMNNGSEKNQPNPYGIEREIVIMKLI-SHPNVMALYEVWENKS--- 209

Query: 100 NGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRD 159
               E++L++EY + G L D++ ++   +L+E E +    Q+ QG++  H+    + HRD
Sbjct: 210 ----ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRD 261

Query: 160 IKIENVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--D 216
           +K EN+L+ K N+  KI DFG  +  +     P +L           +  Y SPE++   
Sbjct: 262 LKPENLLLDKKNKSIKIADFGMAALEL-----PNKLLQTSCG-----SPHYASPEIVMGK 311

Query: 217 FYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYPNFPIYSERLK 273
            Y G P    SD+W+ G+ L+ L     PF  +  +  +L   + ++  P+    S   +
Sbjct: 312 SYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQ 365

Query: 274 HLIHAMLMENPHQR 287
            LI  +L+ +P +R
Sbjct: 366 DLISRILVIDPSKR 379

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 90/196 (45%), Gaps = 18/196 (9%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  M  +    L E       +Q+   I  MH     ++HRDIK EN
Sbjct: 244 LYFLLEYAPNGDFLSVM--KKYGSLNEECACYYGAQILDAIGFMHTRG--IIHRDIKPEN 299

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKN--TTAQYRSPEMI-DFYRGL 221
           +L+ K  + KI DFG+   +    +   +  Y      K+   TA+Y SPE++ D Y   
Sbjct: 300 ILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSFVGTAEYVSPELLNDNYS-- 357

Query: 222 PIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIH 277
             D + DIWA G  LY++     PF+          ++  +Y +   FP     ++ LI 
Sbjct: 358 --DSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTI---IRDLIK 412

Query: 278 AMLMENPHQRPNIYQV 293
            +L++ P QR  I Q+
Sbjct: 413 RILLKVPEQRLTIGQI 428

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 93/197 (47%), Gaps = 25/197 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  I  +V  G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEM----IDFYRG 220
           +L+++    K+ DFG VSG IR          ++ D     T  + +PE+    +D Y  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYP---NFPIYSERLKHLIH 277
              +EK+DIW++G+  Y+L     P  K      + +     P     P +S+  K  + 
Sbjct: 195 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSDAAKDFVA 250

Query: 278 AMLMENPHQRPNIYQVI 294
             L++ P  RP+ Y ++
Sbjct: 251 GCLVKTPADRPSAYNLL 267

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 131/278 (47%), Gaps = 29/278 (10%)

Query: 21  QVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPS-LNTLRAEVDAMKLL 79
           Q  I++ I  G F  +Y            + I  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
           R+      YI ++ +    +     ++++MEYC  G   + +    ++++TE +   I S
Sbjct: 74  RS-----PYITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
           +V  G+  +H+ +   +HRDIK  N+L++ +   K+ DFG VSG        Q +   + 
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG--------QMMVTRKR 174

Query: 200 DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSA- 258
           D    T   + +PE+ID  +    +E +DIW++G+ + +L     P +K     A+++  
Sbjct: 175 DTFVGTPF-WMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 259 RYEYPNF-PIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           + + P     +S   +  +   L+++P QRP   ++++
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 96/200 (48%), Gaps = 24/200 (12%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  +  +    L E       SQ+   + ++H++   ++HRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQ-----YVQHDVLKNTTAQYRSPEMI-DFY 218
           +L+ K  + K+ DFG+   +   P N  + +     Y +       TA+Y SPE++ D Y
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVG-TAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGE----AAILSARYEY-PNFPIYSERLK 273
                D + DIWA G  LY++     PF K   E      ++  +Y +   FP   + +K
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPF-KAANEYLTFQKVMKIQYAFTAGFP---QIVK 365

Query: 274 HLIHAMLMENPHQRPNIYQV 293
            L+  +L+ +P+ R  I Q+
Sbjct: 366 DLVKKLLVRDPNDRLAIEQI 385

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 108/213 (50%), Gaps = 34/213 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++ ++   +L E E +    Q+ +G++  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISKSNQY-KICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMI--DFY 218
           N+L+ K N+  KI DFG ++ +  P           + +LK +     Y SPE++    Y
Sbjct: 244 NLLLDKKNRRIKIADFG-MAALELP-----------NKLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYP-NFPIYSERLKH 274
            G P    SD+W+ G+ L+ L     PF  +  +  +L   S +Y+ P N    S   + 
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMNL---SAEARD 344

Query: 275 LIHAMLMENPHQRPNIYQVIEE--ISKMQNVPC 305
           LI  +L+ +P +R    ++++   I K  ++P 
Sbjct: 345 LISKILVIDPAKRITTQEILKHPLIKKYDDLPV 377

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 97/195 (49%), Gaps = 19/195 (9%)

Query: 105 VFLLMEYCERGGLIDFMNT-RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           ++ L+EY   G   DF++  +    L++   +  ++Q+   I  +H     ++HRDIK E
Sbjct: 232 LYFLLEYAPNG---DFLSVIKKFGSLSQECAVYYSAQILDAIDYLH--HKGIVHRDIKPE 286

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI-DFYRGLP 222
           N+L+ K  + K+ DFG+   I+      Q    ++       TA+Y SPE++ D Y    
Sbjct: 287 NILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY---- 341

Query: 223 IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHA 278
           +D K DIWA G  L+++     PF+          ++  +Y +   FP+    ++ LI  
Sbjct: 342 VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLIKK 398

Query: 279 MLMENPHQRPNIYQV 293
           +L+++P QR +  Q+
Sbjct: 399 ILVKSPEQRLDASQI 413

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 92/208 (44%), Gaps = 30/208 (14%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
            V+LLMEY   G L  + + R+     +       +Q+A  +  MH     +LHRDIK E
Sbjct: 212 RVYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMHDRN--VLHRDIKPE 267

Query: 164 NVLISKSNQYKICDFG----SVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYR 219
           N+LI   N  K+ DFG    S +G  R                   T  Y SPE++ +  
Sbjct: 268 NILIGFQNTLKLTDFGWSVISTTGAKRKTLC--------------GTLDYLSPELVKYRE 313

Query: 220 GLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYSERLKHLI 276
               DEK D+WA+GV  Y+L   T PFE+   E     I+     +P+    S   + LI
Sbjct: 314 ---YDEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMSIDARDLI 368

Query: 277 HAMLMENPHQRPNIYQVIEEISKMQNVP 304
             +L  +P  R ++  V+     ++N P
Sbjct: 369 GRLLENDPSTRISLKDVLSHPWIVKNKP 396

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 137/279 (49%), Gaps = 35/279 (12%)

Query: 22  VRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRN 81
           V +IK I  G    +YT      D   ++++A +K++    +P    +  E+  MK  R+
Sbjct: 566 VNLIK-IGQGASGGVYTAT----DVNTEASVA-IKKMNFEKQPKKELIVNEILVMKASRH 619

Query: 82  NKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQV 141
            +++V++IDS+     F NG+  ++++MEY + G L D +   +   LTE ++ ++T + 
Sbjct: 620 -ENIVNFIDSY-----FLNGN--LWVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRET 668

Query: 142 AQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDV 201
             G+  +H+    ++HRDIK +NVL+S S   K+ DFG  + I        E+   +  +
Sbjct: 669 LNGLRFLHSKG--VIHRDIKSDNVLLSLSGDIKLTDFGFCAQI-------NEINLKRTTM 719

Query: 202 LKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF-EKNGGEAAILSARY 260
           +   T  + +PE++      P   K DIW++G+ + ++     P+  +    A  L A  
Sbjct: 720 VG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 774

Query: 261 EYPNFP---IYSERLKHLIHAMLMENPHQRPNIYQVIEE 296
             P        SE LK  +   L  +PH+R +  +++ +
Sbjct: 775 GTPELKDPDSLSECLKAFLDWCLKVDPHERASATELLND 813

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 122/284 (42%), Gaps = 36/284 (12%)

Query: 26  KYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHV 85
           + +  G F ++Y V        C   +  +++  +     L  L+ EVD    + +   +
Sbjct: 104 RKLGKGKFGKVYCVRHKKSGFICA--LKAIEKNEILQFNLLKQLKREVDIQLGMDHPNII 161

Query: 86  VSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLS--ITSQVAQ 143
             Y   H  K         V+LLME+   G L       L+N    ++VL+     Q+A 
Sbjct: 162 KLYAHFHDEK--------RVYLLMEHSINGELY----KSLKNNGPFNDVLASHYIYQIAD 209

Query: 144 GIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLK 203
            +  MH  +  ++HRD+K ENVLI   N  K+ DFG    I+ P  + ++          
Sbjct: 210 ALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFGW--SILNPEGSKRKTLC------- 258

Query: 204 NTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARY 260
             T  Y SPEMI        DE+ D+WA+GV  Y+L     PFE+N  E     IL    
Sbjct: 259 -GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDL 314

Query: 261 EYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVP 304
            +P     S+  K LI  +L+ +  QR ++  V      ++N P
Sbjct: 315 NFPES--ISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKP 356

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 95/201 (47%), Gaps = 22/201 (10%)

Query: 98  FNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLH 157
           F + S  V+L+MEY   G L   +  +      +    +   Q+   I  +H  +  ++H
Sbjct: 192 FFHDSKRVYLIMEYIYNGELYSIL--KKNGPFNDIVASNFVFQLTNAIRYLH--KKRIIH 247

Query: 158 RDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF 217
           RD+K EN+LI  +N  KI DFG    +     N ++            T  Y SPE+I+ 
Sbjct: 248 RDLKPENILIDFNNVIKITDFG--WSVYNEAGNKRKTLC--------GTIDYLSPELINS 297

Query: 218 --YRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIY-SERLKH 274
             Y GL      D+WA+G+  Y+L   T PFE++  E      +    NFP + S+  K+
Sbjct: 298 KEYDGLI-----DVWALGIIAYELIVGTPPFEEDTKELTYKRIKNCDLNFPAHVSQDAKN 352

Query: 275 LIHAMLMENPHQRPNIYQVIE 295
           LI ++L  NP +R  +  V++
Sbjct: 353 LISSLLKLNPSERITLTDVLK 373

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 112/233 (48%), Gaps = 36/233 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E++A+KLL ++ ++V   D         N  Y + +++EY   G    ++  +   RL E
Sbjct: 112 EINALKLL-SHPNIVKLEDV------LQNSKY-IGIVLEYASGGEFYKYLQRK--KRLKE 161

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
               S  +Q+  G+A +H+    L+HRD+K+EN+L+ K +   I DFG V+ I       
Sbjct: 162 PLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDKHSNLVITDFGFVNEI------- 212

Query: 192 QELQYVQHDVLKNTTAQ--YRSPEMIDFYRGLPID-EKSDIWAIGVFLYKLCYYTTPFEK 248
                  + ++K       Y +PE++   +  P D  K+DIW+ GV LY +     P++ 
Sbjct: 213 ----STNNKLMKTPCGSPCYAAPELVLSTK--PYDARKADIWSAGVILYAMLAGYLPWDD 266

Query: 249 N--GGEAAILSARYEYPN-----FPIYSERL-KHLIHAMLMENPHQRPNIYQV 293
           +    + + +   YEY       FP Y E L + LI  +L+  P  R NI QV
Sbjct: 267 DPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRKILVIQPKSRLNIVQV 319

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 128/281 (45%), Gaps = 43/281 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E +A++ L N++ ++    +   +++       ++ L+EY   G  +  M  +    L E
Sbjct: 218 EKNALQRLNNSRGIIRLYFTFQDEAS-------LYFLLEYAPNGDFLSIM--KKYGSLNE 268

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
                 ++Q+   I  +H  Q  ++HRDIK EN+L+ K  + K+ DFG+   ++      
Sbjct: 269 ECTCYYSAQIIDAIKFLH--QRGIIHRDIKPENILLDKEMKVKLTDFGTAK-LLDGKSQA 325

Query: 192 QELQYVQHDVLKN--TTAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK 248
               Y  H   K+   TA+Y SPE++ D +    +D + DIWA G  ++++     PF+ 
Sbjct: 326 SGETYDLHTRSKSFVGTAEYVSPELLNDNW----VDYRCDIWAFGCIVFQMIAGKPPFKA 381

Query: 249 NGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE-ISKMQNV 303
                    ++  +Y +   FP+    ++ L+  +L+  P QR +I Q+      + +N 
Sbjct: 382 TNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLRQPDQRLSIPQIERHYFYRDKNF 438

Query: 304 --------PCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQ 336
                   P P V  Y VT +       +QPIP   LN +Q
Sbjct: 439 RDGSIWFEPAPEVQPYRVTAK------SMQPIPA--LNTNQ 471

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 126/293 (43%), Gaps = 42/293 (14%)

Query: 6   IDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRV--IVPDK 63
           I  +  G  L +GS     ++   +G   Q   V++     F   N++    V    PD 
Sbjct: 16  IGPWKLGETLGLGS--TGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73

Query: 64  PSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
                 R E+  MKLL N+ +V+   D   + ++       ++L++EY E+G L + +  
Sbjct: 74  LPYGIER-EIIIMKLL-NHPNVLRLYDVWETNTD-------LYLVLEYAEKGELFNLLVE 124

Query: 124 RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
           R    L E E +    Q+  G++  HAL   ++HRD+K EN+L+      KI DFG  + 
Sbjct: 125 R--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA- 179

Query: 184 IIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMIDF--YRGLPIDEKSDIWAIGVFLYKL 239
                         +  +L+ +     Y +PE++    Y+G      SD+W+ GV L+ L
Sbjct: 180 -----------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFAL 224

Query: 240 CYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
                PF++  G    L        +E P+    S   + LI  +L  +P +R
Sbjct: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERR 277

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 96/210 (45%), Gaps = 29/210 (13%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNR------LTESEVLSITSQVAQGIAAMHALQPPL 155
           S +V+L++EYC RG +      +L+ +      LT  +   I S V  G+  +H+    +
Sbjct: 128 STKVYLVLEYCSRGPVKWCPENQLEIKAVGPSILTFEQARKIVSDVVSGLEYLHSQG--I 185

Query: 156 LHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT---TAQYRSP 212
            HRDIK  N+LIS +   KI DFG VS  I        +Q  Q  + K+    T  + +P
Sbjct: 186 THRDIKPSNLLISSNGAVKISDFG-VS--ILTTTGSTNIQSSQEQISKSKTLGTPAFFAP 242

Query: 213 EMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYS 269
           E+             DIW++GV LY + + T PF  N        I+S    +P++   S
Sbjct: 243 ELCTADGDYRCSSAIDIWSLGVTLYCMLFGTLPFNANSALELFDNIISKPLSFPSYEQVS 302

Query: 270 ER------------LKHLIHAMLMENPHQR 287
           +R             K +++ +L +NP +R
Sbjct: 303 KRGHPNLAREEYNDAKDILNRLLKKNPSER 332

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 100/232 (43%), Gaps = 30/232 (12%)

Query: 66   LNTLRAEVDAMKLLRNNKH--VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNT 123
            L T+ +E+  M  L+   H  ++  +D       F +  Y       + E G +  F   
Sbjct: 1112 LGTIPSEIQIMATLQKKPHENIMKLLDF------FEDDQYYYIESPMHGETGSIDLFDLI 1165

Query: 124  RLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSG 183
             L+  +TE E   +  Q+  G+  +H     ++HRDIK ENV++      K+ DFGS + 
Sbjct: 1166 ELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVKLIDFGSAAY 1223

Query: 184  IIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLPIDEKSDIWAIGVFLYKLCY 241
            + R P           DV   T   Y +PE++  D Y G P     DIWAIGV LY + Y
Sbjct: 1224 VKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAIGVLLYTIIY 1268

Query: 242  YTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQV 293
               PF  N  E  IL          I SE    LI  +L  +  +RP +  +
Sbjct: 1269 KENPF-YNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 109/231 (47%), Gaps = 31/231 (13%)

Query: 75  AMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEV 134
           A++ L N+  VV    +   +S+       ++ L+EY   G  +  M  +    L E+  
Sbjct: 234 ALQKLNNSHSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKYGSLDENCA 284

Query: 135 LSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQEL 194
               SQ+   I  +H     ++HRDIK EN+L+    + K+ DFG+   ++ P +N    
Sbjct: 285 CYYGSQIIDAIDHLHV--SGIIHRDIKPENILLDGEMRIKLTDFGTAK-LLEPTNNSSSK 341

Query: 195 QYVQHDVLKNT-----TAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK 248
              ++D+   +     TA+Y SPE++ D +     D + DIWA G  L+++     PF+ 
Sbjct: 342 S--KYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPPFKA 395

Query: 249 NGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
                    ++  +Y + P FP+    ++ L+  +L++N  QR  I Q+ E
Sbjct: 396 TNEYLTFQKVMKVQYAFTPGFPLI---IRDLVKKILIKNLDQRLTINQIKE 443

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 93/198 (46%), Gaps = 23/198 (11%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIK 161
           S   ++L EY   G L+D++       L E         VA  +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 252

Query: 162 IENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGL 221
           IEN++IS S + KI DFG +S +        + +   H      +  + +PE++   +  
Sbjct: 253 IENIMISTSGEIKIIDFG-LSNVF-------DTRKQLHTFC--GSLYFAAPELL---KAN 299

Query: 222 P-IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA---AILSARYEYPNFPIYSERLKHLIH 277
           P I  + DIW+ GV LY L     PF+          I   + EYPN    S  +  L+ 
Sbjct: 300 PYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLS 357

Query: 278 AMLMENPHQRPNIYQVIE 295
            ML+ +P +R N+ +VIE
Sbjct: 358 KMLVVDPLKRANLTKVIE 375

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 100/198 (50%), Gaps = 26/198 (13%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQ-NRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKI 162
           +V++ +EYC    L D +   LQ  R+   E + + SQ+   +   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRG 220
           EN+L+ K    K+ DFG            + ++ V  + +  TT  Y +PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFG---------FTRECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNG---GEAAILSARYEYPNFPIYSERLKHLIH 277
             I    DIW++GV LY +   + PF+++     +  I++   EY N    +   + L+ 
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY-NSKFMTAEGEDLVR 270

Query: 278 AMLMENPHQRPNIYQVIE 295
            +L ++ + RP++ ++++
Sbjct: 271 KLLQKDSNLRPSVREILQ 288

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 109/231 (47%), Gaps = 25/231 (10%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E  A++ L N+  VV    +   +S+       ++ L+EY   G  +  M  +    L E
Sbjct: 229 EKTALQKLNNSHSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKNGSLDE 279

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
           +      +Q+   I  +H+    ++HRDIK EN+L+ +  + K+ DFG+   +     + 
Sbjct: 280 NCACYYGAQIIDAIDYLHS--NGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSST 337

Query: 192 QELQYVQHDVLKN--TTAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEK 248
            + +Y      K+   TA+Y SPE++ D +     D + DIWA G  L+++     PF+ 
Sbjct: 338 SKQKYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPPFKA 393

Query: 249 NGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
                    ++  +Y + P FP+    ++ L+  +L++N  QR  I Q+ E
Sbjct: 394 TNEYLTFQKVMKVQYAFTPGFPLI---IRDLVKKILIKNLDQRLTISQIKE 441

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 92/196 (46%), Gaps = 23/196 (11%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E +V  I  QV  G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEM----IDFYRG 220
           +L+++    K+ DFG VSG +R          ++ D     T  + +PE+    +D Y  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNF--PIYSERLKHLIHA 278
              +EK+DIW++G+  Y+L     P  K      + +     P      +S+  K  +  
Sbjct: 190 ---NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAG 246

Query: 279 MLMENPHQRPNIYQVI 294
            L++ P  RP+ Y ++
Sbjct: 247 CLVKVPADRPSAYDLL 262

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 103/227 (45%), Gaps = 35/227 (15%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPS--------LNTLRAEVDAMKLL 79
            I  G F  +Y        +     +  +K+V VP+  S        +  L++EV  +K L
Sbjct: 1044 IGKGSFGAVYLAL-----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL 1098

Query: 80   RNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITS 139
             N+ ++V Y+          NG Y +FL  EY   G +   +  R+  R  +  +  +T 
Sbjct: 1099 -NHVNIVQYLGFEE-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTK 1148

Query: 140  QVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQH 199
            QV +G+A +H+    +LHRD+K +N+L+      KI DF    GI R  +N     Y   
Sbjct: 1149 QVLEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNS 1198

Query: 200  DVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
            D+    T  + +PEM+D   G     K DIW++G  + ++     P+
Sbjct: 1199 DMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPW 1243

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 133/294 (45%), Gaps = 44/294 (14%)

Query: 6   IDTYHPGTILPVGS-HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRV--IVPD 62
           I  +  G  L +GS  +V++ +  ++G   Q   V++     F   N++    V  I PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNAGNMSGTSIVGSITPD 72

Query: 63  KPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMN 122
                  R E+  MKLL N+ +V+   D   + ++       ++L++EY E+G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNTD-------LYLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVS 182
            R    L E+E +    Q+  G++  HAL   ++HRD+K EN+L+      KI DFG  +
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183 GIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMIDF--YRGLPIDEKSDIWAIGVFLYK 238
                          +  +L+ +     Y +PE++    Y+G      SD+W+ GV L+ 
Sbjct: 180 ------------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFA 223

Query: 239 LCYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
           L     PF++  G    L       ++E P+    S   + LI  +L  +P +R
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRR 277

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 29/247 (11%)

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLRNNKH--VVSYIDSHASKSNFNNGSYEVFLLMEY 111
           C K+ I+ ++  +  +  E D + LL    H  VV    +     N       ++ ++E+
Sbjct: 42  CSKKHIIRER-KVKYVTVEKDLLNLLAGGGHPGVVRLFCTFHDTDN-------LYYVLEF 93

Query: 112 CERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSN 171
              G L+  +  R   RL E     I SQ+   +  MHA    ++HRD+K ENVL+S+  
Sbjct: 94  VSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPENVLLSQEG 149

Query: 172 QYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWA 231
           +  I DFG+          P         V    TA+Y SPE++   +       SD+WA
Sbjct: 150 RIVITDFGAACCASEGGSAPGAADRAASFV---GTAEYVSPELLLHSQ---CSFGSDVWA 203

Query: 232 IGVFLYKLCYYTTPFEKNG-----GEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQ 286
           +G  +Y+L     PF  +       +   L  R+ Y   P+    +  L+ ++L+ +P Q
Sbjct: 204 LGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQSILVLDPLQ 259

Query: 287 RPNIYQV 293
           RP+  Q+
Sbjct: 260 RPSAKQL 266

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 131/294 (44%), Gaps = 44/294 (14%)

Query: 6   IDTYHPGTILPVGS-HQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRV--IVPD 62
           I  +  G  L +GS  +V++ +  ++G   Q   V++     F   N++    V    PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKTVFNTGNVSGTSIVGSTTPD 72

Query: 63  KPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMN 122
                  R E+  MKLL N+ +V+   D   + ++       ++L++EY E+G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLL-NHPNVLRLYDVWETNAD-------LYLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVS 182
            R    L E+E +    Q+  G++  HAL   ++HRD+K EN+L+      KI DFG  +
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA 179

Query: 183 GIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMIDF--YRGLPIDEKSDIWAIGVFLYK 238
                          +  +L+ +     Y +PE++    Y+G      SD+W+ GV L+ 
Sbjct: 180 ------------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVILFA 223

Query: 239 LCYYTTPFEKNGGEAAIL-----SARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
           L     PF++  G    L        +E P+    S   + LI  +L  +P +R
Sbjct: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERR 277

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 105/225 (46%), Gaps = 37/225 (16%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E+  MKLL N+ +V+   D   + S+       +++++EY E+G L + +  R    L E
Sbjct: 87  EIIIMKLL-NHPNVLRLYDVWETNSS-------LYMVLEYVEKGELFNLLVDR--GPLPE 136

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
           +E +    Q+  GI+  HAL   ++HRD+K EN+L+      KI DFG  +         
Sbjct: 137 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 185

Query: 192 QELQYVQHDVLKNTTA---QYRSPEMIDFYRGLPIDE-KSDIWAIGVFLYKLCYYTTPFE 247
                   D L  T+     Y +PE++    GLP    +SD+W+ G+ L+ L     PF+
Sbjct: 186 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRLPFD 238

Query: 248 KNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
           +  G        + S ++E P+    S   + LI  +L  +P  R
Sbjct: 239 EEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAAR 283

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 83/180 (46%), Gaps = 22/180 (12%)

Query: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176
           L DF++ R  + +++ E   I  Q+   I  +H     ++HRDIK EN+++      ++ 
Sbjct: 204 LFDFIDIR--DEVSDWECKLIIKQLVSAIKYLH--DRDIVHRDIKDENIIMDARGHIQLI 259

Query: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEK-SDIWAIGVF 235
           DFGS +  +R P                 T  Y  PE+    RG P   K  DIWA+G+ 
Sbjct: 260 DFGSATNAVRGPFRTF-----------LGTIDYEPPEVA---RGEPFLGKPQDIWALGIL 305

Query: 236 LYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           LY L +   PF     + AIL+   ++P     +     LI+A+L     +RP I  ++E
Sbjct: 306 LYILRFKEPPFLD---QKAILTGDLKFPQGTSVNTDCIDLINAILSPRVDERPTIDDIVE 362

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 116/270 (42%), Gaps = 51/270 (18%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++ ++EY   G L+  +  RL  RLTE     IT+Q+   +  MH+    ++HRD+K EN
Sbjct: 87  LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVDYMHS--KGVIHRDLKPEN 142

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           VL+S+  +  I DFG+           ++ +  +       TA+Y SPE++   +     
Sbjct: 143 VLLSQEGRVVITDFGAACTAA-----DRKFENTKRTASFVGTAEYVSPELLLHSQ---CG 194

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAI--------LSARYEYPNFP---------I 267
             SDIWA+G  +Y+L     PF    GE  +        L  ++ + N P         +
Sbjct: 195 FSSDIWALGCIIYQLNQGKPPFR---GENELQTFEKIVALDYKWLFSNSPQVVSIVQSIL 251

Query: 268 YSERLKHLIHAMLMENP-------HQRPNIYQVIEEISKMQNVPCPIVNFYLVTQQQKHK 320
            ++ LK    A L +NP         R ++++ I E++    VP           QQ H 
Sbjct: 252 VTDPLKRPSAAQLKQNPWFASIDWDNRSSLWKGIWELAGKNTVP--------RGAQQSHT 303

Query: 321 MVQLQPIPVNTLNVSQTHPILQDGKQRILE 350
                 +P   L +++  P+   G   I E
Sbjct: 304 ----NGVPAGGLRITRRKPVQATGTTAIAE 329

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 87/194 (44%), Gaps = 23/194 (11%)

Query: 106  FLLMEYCERGGLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
            +L  E     G ID  +   L+  +TE E   +  QVA GI  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 165  VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRGLP 222
            V++      K+ DFGS + +   P           DV   T   Y +PE++  + Y G P
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP 1157

Query: 223  IDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLME 282
                 DIWAIGV LY + Y   PF  N  E  IL       +    S     LI  +L  
Sbjct: 1158 ----QDIWAIGVLLYTIIYKENPF-YNIDE--ILDGDLRIQSTHEVSAECVALIRKILNR 1210

Query: 283  NPHQRPNIYQVIEE 296
            +  +RP I  ++E+
Sbjct: 1211 SVSKRPTIDDIMED 1224

>YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}
           TOS3Protein kinase, related to and functionally
           redundant with Elm1p and Sak1p for the phosphorylation
           and activation of Snf1p; functionally orthologous to
           LKB1, a mammalian kinase associated with Peutz-Jeghers
           cancer-susceptibility syndrome
          Length = 560

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 83/190 (43%), Gaps = 14/190 (7%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLS------ITSQVAQGIAAMHALQPPL 155
           S +V+L++EYC RG +      +++ +     +L+      +   V  G+  +H+    +
Sbjct: 128 STKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLHS--QGI 185

Query: 156 LHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKN---TTAQYRSP 212
            HRDIK  N+LIS +   KI DFG          N   +Q     +LK+    T  + +P
Sbjct: 186 THRDIKPSNLLISSNGTVKISDFGVAMSTATGSTN---IQSSHEQLLKSRALGTPAFFAP 242

Query: 213 EMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERL 272
           E+    +        DIW++GV +Y L +   PF  N G     S   +   FP Y E L
Sbjct: 243 ELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFPSYEEML 302

Query: 273 KHLIHAMLME 282
                 + ME
Sbjct: 303 NGATSGITME 312

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 89/191 (46%), Gaps = 18/191 (9%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           V+L+MEY   G L  +    +      +   +   Q+A  I  +H  Q  ++HRDIK EN
Sbjct: 186 VYLIMEYMLYGEL--YKTLEIHGPFENAVATNYVYQIASAILYLH--QRHIIHRDIKPEN 241

Query: 165 VLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPID 224
           +LI   NQ K+ DFG    II    NP+ L+          T  Y SPE++D+      D
Sbjct: 242 ILIGPHNQLKLTDFG--WSII----NPKGLRRRTF----CGTIDYLSPEIVDYKE---YD 288

Query: 225 EKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPI-YSERLKHLIHAMLMEN 283
              DIWA+G+  Y+L   + PFE+N  +      R     FP   +   +  I  +L+  
Sbjct: 289 HNVDIWALGIVAYELLVGSPPFEENTKDLTYERIRRGDIVFPKQVTPEARDFIERILVLE 348

Query: 284 PHQRPNIYQVI 294
           P +R  + +++
Sbjct: 349 PKKRMTLKEIM 359

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 81/181 (44%), Gaps = 23/181 (12%)

Query: 116  GLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G ID  +    +  +TE E   I  QV  GI  +H     ++HRDIK ENV++      K
Sbjct: 1192 GCIDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1249

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRGLPIDEKSDIWAI 232
            I DFGS + +   P           DV   T   Y +PE++    Y G P     DIWAI
Sbjct: 1250 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QDIWAI 1294

Query: 233  GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
            G+ LY + +   PF  N  E  IL    ++ N    SE    LI ++L     +RP I  
Sbjct: 1295 GILLYTVVFKENPF-YNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDD 1351

Query: 293  V 293
            +
Sbjct: 1352 I 1352

>KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {ON}
           Anc_6.371 YCR091W
          Length = 908

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 87/198 (43%), Gaps = 20/198 (10%)

Query: 105 VFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR    + E +    TS+V   +  +H L    ++RD+K EN
Sbjct: 569 LYLCMEYCLGGEFFRALQTRQTKCICEEDARFYTSEVIAALEYLHLLG--FIYRDLKPEN 626

Query: 165 VLISKSNQYKICDFG----SVSGIIRPPHNPQELQYVQHDVLKNT--------TAQYRSP 212
           +L+ +S    + DF     +V+    P     +   +   V  +         T +Y SP
Sbjct: 627 ILLHRSGHIMLSDFDLSIQAVTNTKSPVVTTAQKSLIDTKVFSDGFRTNSFVGTEEYISP 686

Query: 213 EMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---ILSARYEYPNFPIYS 269
           E+I   +G       D W +G+ LY++ Y  TPF+ N  +     IL     +PN    S
Sbjct: 687 EVI---KGNGHTAAVDWWTLGILLYEMLYGFTPFKGNDTKETFVHILKKDVTFPNSNDVS 743

Query: 270 ERLKHLIHAMLMENPHQR 287
              K L+  +L +N  +R
Sbjct: 744 RTCKDLMKKLLNKNESKR 761

>NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652
          Length = 505

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 102/215 (47%), Gaps = 34/215 (15%)

Query: 98  FNN-GSYEVFLLMEYCERGGLIDFMNTRLQ--NRLTESEVLSITSQVAQGIAAMHALQPP 154
           FN+  S  +++ MEY     L       L    R++E  +  I+  V +G++ +H  +  
Sbjct: 276 FNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHEQK-- 333

Query: 155 LLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNT-TAQYRSPE 213
           ++HRDIK +N+L ++  Q K+CDFG VSG           + V       T T+ Y +PE
Sbjct: 334 VIHRDIKPQNILFNEKGQVKLCDFG-VSG-----------EAVNSLATTFTGTSFYMAPE 381

Query: 214 MIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAA---------ILSARYEYPN 264
            I   +G P     DIW++G+ + ++     PF  +   A          IL+   E  +
Sbjct: 382 RI---QGQPYSVTCDIWSLGLTILEVAQGRFPFGSDKITATIAPIELLVLILTFNPELKD 438

Query: 265 FP----IYSERLKHLIHAMLMENPHQRPNIYQVIE 295
            P     +S+  K  IH  L ++PH+RP+  Q+I+
Sbjct: 439 EPELNITWSKAFKSFIHFCLKKDPHERPSPRQMID 473

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 123/274 (44%), Gaps = 40/274 (14%)

Query: 28   ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVS 87
            +T+G    +  VE+ P  S  D NI            ++  LR+EV  +K L ++ ++V 
Sbjct: 1116 VTTGEMMAVKQVEV-PKYSSQDENIIS----------TVEALRSEVSTLKDL-DHLNIVQ 1163

Query: 88   YIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAA 147
            Y+        F N      L +EY   G +   +  R+  R  E+ +  +T QV +G++ 
Sbjct: 1164 YL-------GFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVLRGLSY 1214

Query: 148  MHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA 207
            +H+    +LHRD+K +N+L+ +    KI DF    GI R  ++     Y   D+    T 
Sbjct: 1215 LHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSND----IYSNSDMTMRGTV 1264

Query: 208  QYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAIL---SARYEYP- 263
             + +PEM+D  +G     K DIW++G  + ++     P+      AA+     ++   P 
Sbjct: 1265 FWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPI 1322

Query: 264  ---NFPIYSERLKHLIHAMLMENPHQRPNIYQVI 294
                 P+ S+  +  + +    +P  RP   +++
Sbjct: 1323 PEDTLPLISQDGRQFLDSCFEIDPESRPTADKLL 1356

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 29/193 (15%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIE 163
           +++L++EY E+G L + +  R    L E+E +    Q+  G++  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 164 NVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQ--YRSPEMIDF--YR 219
           N+L+      KI DFG  +               +  +L+ +     Y +PE++    Y+
Sbjct: 161 NLLLDHKYNIKIADFGMAA------------LETEGKLLETSCGSPHYAAPEIVSGIPYQ 208

Query: 220 GLPIDEKSDIWAIGVFLYKLCYYTTPF-EKNGGEAAIL----SARYEYPNFPIYSERLKH 274
           G      SD+W+ GV L+ L     PF E++G   A+L       +E P+    S   + 
Sbjct: 209 GFA----SDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQD 264

Query: 275 LIHAMLMENPHQR 287
           LI  +L  +P +R
Sbjct: 265 LISKILTVDPERR 277

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 127/277 (45%), Gaps = 44/277 (15%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E +A++ L N++ +V    +   +++       ++ L+EY   G  +  +  +    + E
Sbjct: 259 EKNALQKLNNSRGIVRLFFTFQDEAS-------LYFLLEYAPNGDFLSLI--KKFGSMNE 309

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
                 ++Q+   I  +H+    ++HRDIK EN+L+    + K+ DFG+   I+ P  + 
Sbjct: 310 DCASYYSAQIIDAIHFVHSRG--IIHRDIKPENILLDSEMKVKLTDFGTAK-ILEPKSSS 366

Query: 192 QELQYVQHDVLKNT-----TAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
              ++  +D+L  +     TA+Y SPE++ D Y     D + DIWA G  ++++     P
Sbjct: 367 SSSKHETYDLLTRSKSFVGTAEYVSPELLNDSY----ADSRCDIWAFGCIVFQMIAGKPP 422

Query: 246 FEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE------ 295
           F+          ++  +Y +   FP+    ++ L+  +L++ P QR  I Q+ +      
Sbjct: 423 FKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKRILIKAPEQRLTISQIKKHHFLSD 479

Query: 296 ---EISKMQNVPCPIVNFYLVTQQQKHKMVQLQPIPV 329
                  + N+  P +  Y V+ +       +QP+P 
Sbjct: 480 RNFSDGSVWNLAAPELQPYRVSAK------SMQPVPA 510

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 107/224 (47%), Gaps = 40/224 (17%)

Query: 28  ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVS 87
           I  G    +YT      +    + +  +K++ +  +P    +  E+  MK  R+N +VV+
Sbjct: 523 IGQGASGGVYTA-----NQVKSNELVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVVN 576

Query: 88  YIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAA 147
           +I++H SK N       ++++MEY E G L D +   L   L+E ++ ++  +  +G+  
Sbjct: 577 FINAHLSKGN-------LWIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKF 626

Query: 148 MHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTA 207
           +H+    ++HRDIK +NVL+S     K+ DFG  + I              +D+  N T 
Sbjct: 627 LHS--KGVIHRDIKSDNVLLSMKGDIKLTDFGFCAQI--------------NDIDLNRTT 670

Query: 208 Q-----YRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
                 + +PE++      P   K DIW++G+ + ++     P+
Sbjct: 671 MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 711

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 83/184 (45%), Gaps = 23/184 (12%)

Query: 116  GLIDFMN-TRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYK 174
            G ID  +    +  +TE E   I  QV  GI  +H     ++HRDIK ENV++      K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  ICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDF--YRGLPIDEKSDIWAI 232
            I DFGS + +   P           DV   T   Y +PE++    Y G P     DIWA+
Sbjct: 1301 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 233  GVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQ 292
            G+ LY + +   PF  N  E  IL    ++ +    +E    LI  +L+     RP I +
Sbjct: 1346 GILLYTIVFKENPF-YNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDE 1402

Query: 293  VIEE 296
            + ++
Sbjct: 1403 IFDD 1406

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 112/234 (47%), Gaps = 31/234 (13%)

Query: 72  EVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLTE 131
           E  A++ L N+  VV    +   +S+       ++ L+EY   G  +  M  +    L E
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM--KKYGSLDE 277

Query: 132 SEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNP 191
           +      +Q+   I  +H+    ++HRDIK EN+L+    + K+ DFG+   ++ P +N 
Sbjct: 278 TCARYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGTAK-LLNPTNN- 333

Query: 192 QELQYVQHDVLKNT-----TAQYRSPEMI-DFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
             +   ++D+   +     TA+Y SPE++ D +     D + DIWA G  L+++     P
Sbjct: 334 -SVSKPEYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPP 388

Query: 246 FEKNGGEAA---ILSARYEY-PNFPIYSERLKHLIHAMLMENPHQRPNIYQVIE 295
           F+          ++  +Y + P FP+    ++ L+  +L++N  +R  I Q+ E
Sbjct: 389 FKATNEYLTFQKVMKVQYAFTPGFPLI---IRDLVKKILVKNLDRRLTISQIKE 439

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 107/230 (46%), Gaps = 29/230 (12%)

Query: 66   LNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRL 125
            +  LR+EV  +K L ++ ++V Y+        F N +    L +EY   G +   +  RL
Sbjct: 1221 VEALRSEVSTLKNL-DHLNIVQYL-------GFENKNSIYSLFLEYVAGGSVGSLI--RL 1270

Query: 126  QNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGII 185
              R  ES +  +T QV +G++ +H+    +LHRD+K +N+L+      KI DF    GI 
Sbjct: 1271 YGRFDESLIRFLTVQVLRGLSYLHSRG--ILHRDMKADNLLLDLDGVCKISDF----GIS 1324

Query: 186  RPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTP 245
            R  ++     Y   D+    T  + +PEM+D  +G     K DIW++G  + ++     P
Sbjct: 1325 RKSND----IYCNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRP 1378

Query: 246  FEKNGGEAAIL---SARYEYP----NFPIYSERLKHLIHAMLMENPHQRP 288
            +      AA+     ++   P      P+ S+  +  + A    +P +RP
Sbjct: 1379 WSNLEVVAAMFKIGKSKTAPPIPEDTLPLISKEGREFLDACFEIDPERRP 1428

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 114/235 (48%), Gaps = 38/235 (16%)

Query: 73  VDAMKLLRNNKH--VVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQNRLT 130
           ++ + +++ +KH  +V++IDS+       +G  +++++MEY E G L D +   +   LT
Sbjct: 670 INEILVMKGSKHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 ESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHN 190
           E ++ ++  +   G+  +H+    +LHRDIK +N+L+S +   K+ DFG  +        
Sbjct: 720 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFGFCA-------- 769

Query: 191 PQELQYVQHDVLKNTTA----QYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPF 246
                 V    LK TT      + +PE++      P   K DIW++G+ + ++     P+
Sbjct: 770 -----QVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 821

Query: 247 -EKNGGEAAILSARYEYPNFP---IYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297
             +    A  L A    P        S+ LKH +   L  NP QR +  +++E++
Sbjct: 822 LNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 94/199 (47%), Gaps = 28/199 (14%)

Query: 104 EVFLLMEYCERGGLIDFMNTRLQN-RLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKI 162
           +V++ +EYC    L D++   LQ  R+   E   + +Q+   +   H+LQ   +HRD+K+
Sbjct: 102 KVWMALEYCPGNELYDYL---LQKQRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKL 156

Query: 163 ENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMI--DFYRG 220
           EN+L+ K     + DF    G  R      +L+ +        T  Y +PE+I  + Y G
Sbjct: 157 ENILLDKQGYAMLTDF----GFTRECATKTQLETI------CGTTVYMAPELIKRESYDG 206

Query: 221 LPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSE----RLKHLI 276
             +    D W++G+ LY + +   PF++       L    E P  PI         K LI
Sbjct: 207 YKV----DTWSLGIILYTMLHGFMPFDEEDPTLTGLKIMNEMP--PIVDAYTNVHAKDLI 260

Query: 277 HAMLMENPHQRPNIYQVIE 295
             +L + P +RP++ +V+E
Sbjct: 261 LKLLRKTPSERPSLNKVLE 279

>KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.192
           YGR052W
          Length = 384

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 139/330 (42%), Gaps = 58/330 (17%)

Query: 28  ITSGGFAQIYTVEISPPDSFCDSNIACLKRVIVPDKPSLNTLRAEVDAMKLL-RNNKHVV 86
           I SG F+ +Y    S  + +         +VI   K S   +  E   MKLL RN+ ++ 
Sbjct: 8   IQSGSFSTVYKAWSSTLEQYV------ALKVIPKKKYSSEGMDNEYKIMKLLGRNHPNIC 61

Query: 87  SYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDFMNTRLQN------RLTESEVLSITSQ 140
           S +D +   S +        +++EYCE G L DF++   +        L + +  ++ +Q
Sbjct: 62  SMLDFYEDDSYY-------VVVLEYCECGDLYDFLDIAKKQGDPYSPALIQLDFRNLINQ 114

Query: 141 VAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGSVSGIIRPPHNPQELQYVQHD 200
           +   I   H+L   + HRDIK EN+L++K    K+ D+G         H   + +  ++ 
Sbjct: 115 LFSAINYAHSLG--IAHRDIKPENILLTKDGNIKLADWG---------HATTDAKSKEYH 163

Query: 201 VLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLCYYTTPFE----KNG--GEAA 254
           +    T  YR PE  +         KSD W+IGV +  L +   PF+     NG   E  
Sbjct: 164 I---GTDNYRGPETFNGTESYDT-IKSDYWSIGVTMLYLIFGQCPFKCAAFSNGDVSETE 219

Query: 255 ILSARYE-YPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKMQNVPCPIVNFYLV 313
           IL      YP       R  +  +   +ENPH       +   IS ++N      N Y  
Sbjct: 220 ILGGNDRVYP-------RCNNFTN--FLENPHGFVFTSYLAPSISIIEN------NDYKW 264

Query: 314 TQQQKHKMVQLQPIPVNTLNVSQTHPILQD 343
           +   K  +   Q + V+  +VSQ   I+ D
Sbjct: 265 SGNGKPALYVWQDL-VDIYDVSQLCRIIVD 293

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 95/213 (44%), Gaps = 29/213 (13%)

Query: 102 SYEVFLLMEYCERGGLIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIK 161
           S   ++L EY   G L+D++       L E         VA  +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 259

Query: 162 IENVLISKSNQYKICDFG--SVSGIIRPPHN-PQELQYVQHDVLKNTTAQYRSPEMIDFY 218
           IEN++IS S + KI DFG  +V    +  H     L +   ++LK     Y  PE+    
Sbjct: 260 IENIMISNSGEIKIIDFGLSNVYDTRKQLHTFCGSLYFAAPELLK--AHPYTGPEV---- 313

Query: 219 RGLPIDEKSDIWAIGVFLYKLCYYTTPFEKNGGEA---AILSARYEYPNFPIYSERLKHL 275
                    D+W+ GV LY L     PF+          I   + EYP     S  +  L
Sbjct: 314 ---------DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQH--LSIEVMSL 362

Query: 276 IHAMLMENPHQRPNIYQVIEE--ISKMQNVPCP 306
           +  ML+ +P +R ++ QV+E   ++K  + P P
Sbjct: 363 LSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAP 395

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 109/238 (45%), Gaps = 40/238 (16%)

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLID 119
            PD  S    R E+  MKLL N+ +V+   D   + +N        ++++EY E+G L +
Sbjct: 68  TPDSLSYGIER-EIIIMKLL-NHPNVLRLYDVWETNNNL-------YMVLEYAEKGELFN 118

Query: 120 FMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFG 179
            +  +    L E+E +    Q+  G++  HAL   ++HRD+K EN+L+      KI DFG
Sbjct: 119 LLVEK--GPLPENEAIRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKLNIKIADFG 174

Query: 180 SVSGIIRPPHNPQELQYVQHDVLKNTTA---QYRSPEMIDF--YRGLPIDEKSDIWAIGV 234
             +                 D L  T+     Y +PE++    Y GL    ++D+W+ GV
Sbjct: 175 MAA-------------LETEDKLLETSCGSPHYAAPEIVSGLPYHGL----ETDVWSCGV 217

Query: 235 FLYKLCYYTTPFEKNGGE-----AAILSARYEYPNFPIYSERLKHLIHAMLMENPHQR 287
            L+ L     PF++  G        +    +E P     S+  + L++ +L+ +P +R
Sbjct: 218 ILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKR 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,223,726
Number of extensions: 1850071
Number of successful extensions: 8578
Number of sequences better than 10.0: 1863
Number of HSP's gapped: 7160
Number of HSP's successfully gapped: 1917
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)