Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H033202.285ON70270236880.0
Smik_14.3102.285ON70669628270.0
YNL021W (HDA1)2.285ON70667228100.0
NDAI0G006502.285ON68970228060.0
Suva_14.3262.285ON70668528040.0
Skud_14.3082.285ON70669327860.0
TDEL0G021602.285ON71469827850.0
ZYRO0A01870g2.285ON70770227750.0
CAGL0J03454g2.285ON69369127660.0
NCAS0G038002.285ON72670827600.0
KNAG0H020102.285ON69367427460.0
SAKL0E07700g2.285ON71270126670.0
KLTH0G10340g2.285ON70867626500.0
Kwal_27.115372.285ON70868626410.0
Ecym_33242.285ON70667426300.0
KLLA0E08383g2.285ON70467425620.0
ADL216C2.285ON70569725560.0
TPHA0C033902.285ON70167724950.0
Kpol_1039.322.285ON65965824780.0
TBLA0B069502.285ON79547619420.0
Kpol_1003.372.285ON57830013690.0
TPHA0H003208.153ON4503253473e-34
SAKL0H25124g8.153ON4483373454e-34
NCAS0B054808.153ON4513373421e-33
TBLA0D021408.153ON4563433412e-33
KAFR0C029208.153ON4533373384e-33
Kpol_246.58.153ON4533253368e-33
Skud_7.798.153ON4523233351e-32
KLTH0E06446g8.153ON4493243341e-32
CAGL0A03322g8.153ON4503253322e-32
YGL194C (HOS2)8.153ON4523233322e-32
NDAI0B027108.153ON4533223323e-32
Ecym_23468.153ON4853383323e-32
KLLA0F09119g8.153ON4523253314e-32
Smik_7.798.153ON4523233304e-32
TDEL0B045808.153ON4463253304e-32
KNAG0G013508.153ON4513283296e-32
Kwal_55.207908.153ON4493253271e-31
Suva_14.113.8ON4333243251e-31
Kpol_1038.113.8ON4333243252e-31
KLTH0F19668g3.8ON4323243242e-31
NDAI0G037403.8ON4333243242e-31
Skud_14.113.8ON4333243233e-31
KNAG0A011603.8ON4333243233e-31
Suva_7.718.153ON4523463233e-31
AFR172C8.153ON4493253225e-31
TBLA0I005603.8ON4333243216e-31
Kwal_55.221423.8ON4323243206e-31
ZYRO0G19316g8.153ON4483493216e-31
CAGL0B01441g3.8ON4333243206e-31
NCAS0C043203.8ON4343243207e-31
Ecym_20103.8ON4333233207e-31
KLLA0E01981g3.8ON4323243208e-31
KAFR0A086303.8ON4333243199e-31
ZYRO0C03498g3.8ON4333243199e-31
AGR395W3.8ON4333243199e-31
SAKL0C13706g3.8ON4333243181e-30
Smik_14.23.8ON4333243172e-30
YNL330C (RPD3)3.8ON4333243172e-30
TDEL0A002703.8ON4333243144e-30
TPHA0A003003.8ON4333243144e-30
TBLA0B023903.362ON5791771904e-14
Suva_16.3963.362ON4771771851e-13
Skud_16.3533.362ON4711761842e-13
NCAS0A111803.362ON4902441832e-13
TDEL0C050403.362ON4542761822e-13
SAKL0B07854g3.362ON4891761813e-13
KAFR0H008903.362ON4742111813e-13
KLTH0F10582g3.362ON4742401795e-13
CAGL0D01430g3.362ON4452111787e-13
YPR068C (HOS1)3.362ON4701771771e-12
Smik_16.3093.362ON4701761761e-12
NDAI0A051203.362ON5082341743e-12
Kwal_23.37243.362ON4731771733e-12
ADL339W3.362ON4372061681e-11
Kpol_376.153.362ON5181761672e-11
TDEL0A055208.607ON6743191672e-11
Ecym_34653.362ON4451781643e-11
Ecym_82908.607ON7092911663e-11
KNAG0H006303.362ON4561811601e-10
YPL116W (HOS3)8.607ON6973201602e-10
ZYRO0C16390g3.362ON4361781582e-10
Suva_16.1948.607ON6993201592e-10
KLLA0B09394g3.362ON4411771572e-10
KLTH0D09592g8.607ON7052501574e-10
Smik_6.3158.607ON6973201565e-10
KAFR0H027908.607ON7171021548e-10
TPHA0A011208.607ON6983041541e-09
Kwal_26.85058.607ON7081371531e-09
Kpol_479.68.607ON6882541521e-09
KLLA0F00858g8.607ON715651512e-09
TBLA0E040808.607ON6943141485e-09
SAKL0H08338g8.607ON6901341451e-08
Skud_16.1648.607ON6971381441e-08
TPHA0M015903.362ON4941891431e-08
NCAS0C017608.607ON7001071432e-08
ZYRO0F10780g8.607ON6682911432e-08
NDAI0E024808.607ON684981422e-08
ADL265W8.607ON694581423e-08
CAGL0J06974g8.607ON6783231413e-08
KNAG0J013008.607ON6771031342e-07
Kwal_55.206504.25ON204110751.3
KNAG0F003101.54ON60299771.4
TBLA0G014004.133ON352152742.6
KAFR0B069704.383ON79558733.8
NCAS0G024802.152ON59664715.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03320
         (702 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1425   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1093   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1087   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1085   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1084   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1077   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1077   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1073   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1070   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1067   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1062   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1031   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1025   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1021   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1017   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   991   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   989   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   965   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   959   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   752   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   531   0.0  
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   138   3e-34
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   137   4e-34
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   136   1e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   135   2e-33
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   134   4e-33
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   134   8e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   133   1e-32
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   133   1e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   132   2e-32
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   132   2e-32
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    132   3e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   132   3e-32
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   132   4e-32
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   131   4e-32
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   131   4e-32
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   131   6e-32
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   130   1e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   129   1e-31
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   129   2e-31
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   129   2e-31
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   129   2e-31
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   129   3e-31
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   129   3e-31
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   129   3e-31
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   128   5e-31
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   128   6e-31
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   127   6e-31
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   128   6e-31
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   127   6e-31
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      127   7e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   127   7e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   127   8e-31
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   127   9e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   127   9e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   127   9e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   127   1e-30
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   126   2e-30
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   126   2e-30
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   125   4e-30
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   125   4e-30
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    78   4e-14
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    76   1e-13
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    75   2e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    75   2e-13
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    75   2e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   3e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    74   3e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    74   5e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    73   7e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    73   1e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    72   1e-12
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    72   3e-12
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    71   3e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    69   1e-11
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    69   2e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    69   2e-11
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    68   3e-11
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    69   3e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    66   1e-10
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    66   2e-10
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    65   2e-10
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    66   2e-10
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    65   2e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    65   4e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    65   5e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    64   8e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    64   1e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    64   1e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    63   1e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    63   2e-09
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    62   5e-09
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    60   1e-08
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    60   1e-08
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    60   1e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    60   2e-08
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    60   2e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    59   2e-08
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    59   3e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   3e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    56   2e-07
Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W...    33   1.3  
KNAG0F00310 Chr6 (36504..38312) [1809 bp, 602 aa] {ON} Anc_1.54 ...    34   1.4  
TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {O...    33   2.6  
KAFR0B06970 Chr2 (1449791..1452178) [2388 bp, 795 aa] {ON} Anc_4...    33   3.8  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    32   5.9  

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1425 bits (3688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/702 (97%), Positives = 686/702 (97%)

Query: 1   MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60
           MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY
Sbjct: 1   MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60

Query: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA
Sbjct: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120

Query: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180
           DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV
Sbjct: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH
Sbjct: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240

Query: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300
           GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD
Sbjct: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300

Query: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360
           AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG
Sbjct: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360

Query: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYW 420
           NLVVVLEGGYNLDSIAISALSVAKTLIG                ALEMIYKVIKIQSKYW
Sbjct: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYW 420

Query: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD 480
           KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD
Sbjct: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD 480

Query: 481 LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI 540
           LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI
Sbjct: 481 LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI 540

Query: 541 IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH 600
           IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH
Sbjct: 541 IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH 600

Query: 601 LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK 660
           LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK
Sbjct: 601 LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK 660

Query: 661 PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE
Sbjct: 661 PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/696 (72%), Positives = 592/696 (85%), Gaps = 8/696 (1%)

Query: 11  EGSTKRKQEE--ENLESLNVVP--KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFT 66
           +G+ KR+ EE  E+  SL+     KRQVIVP   P++HY PLKTGLCYDVRMRYHAKIFT
Sbjct: 15  DGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFT 74

Query: 67  SYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEV 126
           SYFEYIDPHPEDPRRIYRIYKILAENGLIND  LSGVDD+GD+MLKIPVR AT++EILEV
Sbjct: 75  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEV 134

Query: 127 HSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVK 186
           H++EHLEF+EST  M+RE LLKETEKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VK
Sbjct: 135 HTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVK 194

Query: 187 NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQK 246
           N+LAVVRPPGHH+EP+++GGFCLFSNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK
Sbjct: 195 NSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQK 254

Query: 247 AFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWA 306
           +FYQD++VLYVSLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWA
Sbjct: 255 SFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWA 314

Query: 307 FEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVL 366
           FEQ+VMPMGREF+PDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVL
Sbjct: 315 FEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL 374

Query: 367 EGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRR 426
           EGGYNLD+IA SALSVAK LIG                 +EMI KVI++QSKYW CF+RR
Sbjct: 375 EGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRR 434

Query: 427 HGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSP 486
           H N   NF+E  +D++ +K FPLQ AIRQQQ + L  E++ V  P  N+ LPD+ +LC+P
Sbjct: 435 HANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTP 494

Query: 487 NIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIP 546
           N++ + T++++VHDT  IW ++++IS T+D  SS+IID+ LDF+KW  +RKYGIIDVNIP
Sbjct: 495 NVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIP 554

Query: 547 QSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRD 606
            SL      PDNYS +I +QE+L++LWDN+IK+   V KIAF+G+GDS SG+VHLLGHRD
Sbjct: 555 LSLF----EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRD 610

Query: 607 TKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYG 666
           T+   K VINF+ DKQLKPLVPLVDE+LS+WYFKNSL+FSN +H CW + E++KPRKK+G
Sbjct: 611 TRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFG 670

Query: 667 RVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           RVLRCDTDGLN+TIEERF+EATDFILDSFEEWSD E
Sbjct: 671 RVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/672 (74%), Positives = 579/672 (86%), Gaps = 4/672 (0%)

Query: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90
           KRQVIVP   P++HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150
           ENGLIND  LSGVDD+GD+MLKIPVR AT++EILEVH++EHLEF+EST  M+RE LLKET
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKET 158

Query: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210
           EKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VKN+LAVVRPPGHH+EP+++GGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270
           SNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK+FYQD++VLYVSLHRFE GKYYPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330
           T+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ+VMPMGREF+PDLVIISSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXX 390
           AADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVLEGGYNLD+IA SALSVAK LIG  
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 391 XXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450
                          +EMI KVI++QSKYW CF+RRH N   NF+E  +D++ +K FPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510
            AIRQQQ + L  E++FV  P  ++ LPD+ +LC+PNI  + T+II+VHDT  IW ++++
Sbjct: 459 KAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNV 518

Query: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570
           IS T+D  SS+IID++LDF+KW  +RKYGIIDVNIP +L      PDNYS +I +QE+L+
Sbjct: 519 ISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLF----EPDNYSGMITSQEVLI 574

Query: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630
           +LWDN+IK+   V KIAFIG+GDS SG+VHLLGHRDT+   K VINF+ DKQLKPLVPLV
Sbjct: 575 YLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLV 634

Query: 631 DESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDF 690
           DE+LS+WYFKNSL+FSN +H CW + E++KPRKK+GRVLRCDTDGLN+ IEERF+EATDF
Sbjct: 635 DETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDF 694

Query: 691 ILDSFEEWSDSE 702
           ILDSFEEWSD E
Sbjct: 695 ILDSFEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/702 (72%), Positives = 589/702 (83%), Gaps = 13/702 (1%)

Query: 1   MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60
           M    T+S  +   KRK + E+         RQ+IVP +  Q+HY PLKTGLCYDVRMRY
Sbjct: 1   MNGGETTSNNDTIKKRKIDPES---------RQIIVPPRDAQIHYTPLKTGLCYDVRMRY 51

Query: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSG+DDIGD+MLKIPVREAT+
Sbjct: 52  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATS 111

Query: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180
           +EILEVHS+EHL+F+EST+ MNRE LLK TE GDSVYFN+DSY SAKL  GGAIEACKAV
Sbjct: 112 EEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAV 171

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VEG+VKNALAVVRPPGHH+EPE++GGFCLFSNVA+AAKNILKNYPESVRKI+ILDWDIHH
Sbjct: 172 VEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHH 231

Query: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300
           GNGTQKAFY D+R+LYVSLHRF+ GKYYPGT+ G+YDQ GEGKGEGFNCNITWP GGVGD
Sbjct: 232 GNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGD 291

Query: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360
           AEYMWAFEQIVMPMGREFQPDLVIIS+GFDAADGD IGQCHVTPSCYGHMTHMLKSLARG
Sbjct: 292 AEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARG 351

Query: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYW 420
           N+ VVLEGGYNLDSIAISALSVAK LIG                 +EMI KV++IQSKYW
Sbjct: 352 NMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYW 411

Query: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD 480
           KCFK + GN   +F E  ++++ATK FPLQ+AIRQQQ  NL KE++F + P    +LP+D
Sbjct: 412 KCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPED 471

Query: 481 LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI 540
            ILCS NI+ + T+II VHDTP+IW ++D I  T+DP SSII+DS+LD +KWA  RKYG+
Sbjct: 472 TILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGV 531

Query: 541 IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH 600
           ID+NIPQ+L+      +NY S+I AQE+L+ LWDN++K+   VNKIAF+G+GD+ SG+VH
Sbjct: 532 IDINIPQNLL----EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVH 587

Query: 601 LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK 660
           LLGHRDT+  VKAVINF+  KQLKPLVPLVDESL +WYFKNSLVFSN+ H  WGDKENKK
Sbjct: 588 LLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKK 647

Query: 661 PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           PRKKYGRVLRCDTDG+++ +EERF+EATDFILDSFEEWSDSE
Sbjct: 648 PRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/685 (72%), Positives = 587/685 (85%), Gaps = 4/685 (0%)

Query: 18  QEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPE 77
           +EE+N  S     KRQVIVP   P++HY PL+TGLCYDVRMRYHAKIFTSYFEYIDPHPE
Sbjct: 26  KEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPE 85

Query: 78  DPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLES 137
           DPRRIYRIYKILAENGLIND  LSGVDD+GD+MLKIPVR AT++EILEVH++EHLEF+ES
Sbjct: 86  DPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIES 145

Query: 138 TTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGH 197
           T  M+RE LLKETEKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VKN+LAVVRPPGH
Sbjct: 146 TEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGH 205

Query: 198 HSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYV 257
           H+EP+++GGFCLFSNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK+FYQD++VLY+
Sbjct: 206 HAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYI 265

Query: 258 SLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGRE 317
           SLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ+VMPMGRE
Sbjct: 266 SLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGRE 325

Query: 318 FQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAI 377
           F+PDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVLEGGYNLD+IAI
Sbjct: 326 FKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAI 385

Query: 378 SALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEV 437
           SALSVAK LIG                 +EMI KV+++QSKYW CF+RRH N   NF+E 
Sbjct: 386 SALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEP 445

Query: 438 ASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIII 497
            +D++ +K FPLQ AIRQQQ + L  E++FV  P  N++LPD+++LC+PN+  + T++++
Sbjct: 446 INDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVV 505

Query: 498 VHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPD 557
           VHDT  +W ++++IS T+D  SS++ID+ LDF+KW  +RKYGIIDVNIP +L       D
Sbjct: 506 VHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLF----EAD 561

Query: 558 NYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINF 617
           NYS +I +QE+L++LWDN+IK+   V KIA+IG+GDS SG+VHLLGHRDT+   K VINF
Sbjct: 562 NYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINF 621

Query: 618 MADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLN 677
           + DKQLKPLVPLVDE+L++WYFKNSLVF+N +H CW + E++KPRKK+GRVLRCDTDGL+
Sbjct: 622 LGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLS 681

Query: 678 STIEERFDEATDFILDSFEEWSDSE 702
           +T+EERF+EATDFILDSFEEWSD E
Sbjct: 682 NTVEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/693 (72%), Positives = 584/693 (84%), Gaps = 4/693 (0%)

Query: 10  MEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYF 69
           ++ + +  +E++N  S     KRQVIVP   P++HY PLKTGLCYDVRMRYHAKIFTSYF
Sbjct: 18  LKRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYF 77

Query: 70  EYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSR 129
           EYIDPHPEDPRRIYRIYKILAENGLIND  LSGVDDIGD+MLKIPVR AT++EILEVH++
Sbjct: 78  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTK 137

Query: 130 EHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNAL 189
           EHLEF+EST  M+RE LLKETEKGDSVYFNNDSY SA+L CGGAIEACKAVVEG+VKN+L
Sbjct: 138 EHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSL 197

Query: 190 AVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFY 249
           AVVRPPGHH+EP+++GGFCLFSNVAVAAKNILKNYPESVR+IMILDWDIHHGNGTQK+FY
Sbjct: 198 AVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFY 257

Query: 250 QDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQ 309
           QD++VLYVSLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ
Sbjct: 258 QDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 317

Query: 310 IVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGG 369
           +VMPMGREF+PDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARGNL VVLEGG
Sbjct: 318 VVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGG 377

Query: 370 YNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGN 429
           YNLD+IA SALSVAK LIG                 +EMI KVI++QSKYW CF+RRH N
Sbjct: 378 YNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHAN 437

Query: 430 YNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIH 489
              NF+E  +D++ +K FPLQ AIRQQQ   L  E+ FV  P  N+ LPD+  LC+PN+ 
Sbjct: 438 SGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVF 497

Query: 490 TAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSL 549
            +  ++++VHDT  +W ++++IS T+D  SS+IID+ +DF+KW  +RKYGIIDVNIP +L
Sbjct: 498 ESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTL 557

Query: 550 IYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKE 609
                  DNYS +I +QE+L++LWDN+IK+   V KIAFIG+GDS SG+VHLLGHRDT+ 
Sbjct: 558 F----EADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRA 613

Query: 610 RVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVL 669
             K VINF+ DKQLKPLVPLVDE+LS+WYFKNSL+FSN +H CW + E++KPRKK+GRVL
Sbjct: 614 VTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVL 673

Query: 670 RCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           RCDTDGL++TIEERF+EATDFILDSFEEWSD E
Sbjct: 674 RCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1077 bits (2785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/698 (71%), Positives = 579/698 (82%), Gaps = 14/698 (2%)

Query: 15  KRKQEEEN----------LESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKI 64
           KRK EE+N            + N    ++VIVP   P +HY PLKT LCYDVRMRYHAKI
Sbjct: 21  KRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKI 80

Query: 65  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEIL 124
           FTSYFEYIDPHPEDPRRIYR+YKILAENGLIND  LSG+D+IGD+MLKIPVREAT +EIL
Sbjct: 81  FTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEIL 140

Query: 125 EVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGK 184
           EVHS+E+LEF+E ++ M RE LLKETEKGDSVYFNNDSY+SAKLSCGG I+ACKAVVEG+
Sbjct: 141 EVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGR 200

Query: 185 VKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGT 244
           VKNALAVVRPPGHH+EPE+ GGFCLFSNVAVAA+NILK YPESVR+I+ILDWDIHHGNGT
Sbjct: 201 VKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGT 260

Query: 245 QKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYM 304
           QKAFY D RVLY+SLHRFE GKYYPGT+ G+YDQ GEGKGEGFNCNITWP GGVGDAEYM
Sbjct: 261 QKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 320

Query: 305 WAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVV 364
            AFEQIVMPM REFQPDLVIISSGFDAADGD IGQCHVTPSCYG MTHMLKSLARGNL V
Sbjct: 321 LAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCV 380

Query: 365 VLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFK 424
            LEGGYNLD+IAISALSVAK LIG                A+EMI  VI  QSKYWKCF+
Sbjct: 381 ALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQ 440

Query: 425 RRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILC 484
           R+ GN   NFSE  ++T+ +K+FPLQTAIRQ+Q+  L KEY FV  P + L++PDD +LC
Sbjct: 441 RKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLC 500

Query: 485 SPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVN 544
           SP +    T++IIVHDTP+IW ++D+I+  +DP +SII+DS LDF KW  NRKYG+IDVN
Sbjct: 501 SPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVN 560

Query: 545 IPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGH 604
           IPQSL       DNYS++I +QE+LL++WDN+IK+   + K+AF+G GD+ +G+VHLLGH
Sbjct: 561 IPQSLF----EQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGH 616

Query: 605 RDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKK 664
           RDT+  VKAV++F+  KQLKPLVPLVDESLSDWYFKNSL+F+++ HPCW D E+KKPRKK
Sbjct: 617 RDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKK 676

Query: 665 YGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           +GRVLRCDTDGLNS +EERF+EATDFILD FEEWSDSE
Sbjct: 677 FGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/702 (72%), Positives = 586/702 (83%), Gaps = 16/702 (2%)

Query: 11  EGSTKRKQEEE---------NLESL-NVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60
           EGS KRK EE          N+ S+ N   KRQ+IVP  +P++HY PLKTGLCYDVRMRY
Sbjct: 12  EGS-KRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRY 70

Query: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIND  LSG DDIG++MLKIPVREAT 
Sbjct: 71  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREATV 130

Query: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180
           +E+L+VH++EHLEF+E T+ MNRE LLKETE GDSVYFN+DSY +AKL CGGAIEACKAV
Sbjct: 131 EELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAV 190

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VEG+VKNALAV+RPPGHH+EPE +GGFCLFSNVAVAA+NILKNYPESVR+I+ILDWDIHH
Sbjct: 191 VEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDIHH 250

Query: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300
           GNGTQKAFY D+RVLY+SLHRFE GKYYPGT+ GQYDQ GEGKGEGFNCNITWP GGVGD
Sbjct: 251 GNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGD 310

Query: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360
           AEYM AFEQIVMPM RE++PDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARG
Sbjct: 311 AEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARG 370

Query: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYW 420
           NL V LEGGYNLD+IA SALSVAK LIG                A+EMI KVI +QSKYW
Sbjct: 371 NLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYW 430

Query: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD 480
           KCF RR GN   NF E  +++L TK FPLQ AIRQ+Q++ L KEY FV  P   L+LP+D
Sbjct: 431 KCF-RRLGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPED 489

Query: 481 LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI 540
            +LCSP++    TVII VHDTP+IW ++D+I+  +DP +SI +DS LDF+KW+  RKYG+
Sbjct: 490 TVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGV 549

Query: 541 IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH 600
           IDVNIPQSL       DNYS++I +QE+L++LWDN +K+   ++K+AF+GVGD+ SG+VH
Sbjct: 550 IDVNIPQSLF----EQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVH 605

Query: 601 LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK 660
           LLGHRDT+  VKAVINF+  KQLKPLVPLVDESL DWYFKNSLVFS+R +PCW D ENKK
Sbjct: 606 LLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKK 665

Query: 661 PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           PR+K+GRVLRC++DG+N+ +EERFDEATDFILDSFEEWSDSE
Sbjct: 666 PRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/691 (70%), Positives = 589/691 (85%), Gaps = 7/691 (1%)

Query: 12  GSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEY 71
           G +KRK E+ ++ S +V  KR VIVPT+K Q+HY PLKTG+CYDVRMRYHAKIFTSYFEY
Sbjct: 10  GESKRKLED-DVASQDV--KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEY 66

Query: 72  IDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREH 131
           IDPHPEDPRRIYRIYKILAENGLIND  LSGV+DIGD+MLKIP+R ATA+EILEVHS+EH
Sbjct: 67  IDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEH 126

Query: 132 LEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAV 191
           LEF+E T  MNRE LLKETEKGDSVYFNNDSY +++L CGGAIEACKAVVEG+VKN+LAV
Sbjct: 127 LEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAV 186

Query: 192 VRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQD 251
           VRPPGHH+EPE++GGFCLFSNVAVAAKNILKNYPESVR+I+ILDWD+HHGNGTQKAFY D
Sbjct: 187 VRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDD 246

Query: 252 ERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIV 311
           +RVLY+SLHRFE GKYYPGT+QGQYDQ GEGKG+GFNCNITWP GGVGDAEYMWAFEQ+V
Sbjct: 247 DRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVV 306

Query: 312 MPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYN 371
           MPMGREFQPDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVLEGGYN
Sbjct: 307 MPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYN 366

Query: 372 LDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYN 431
           LD+IAISALSVAK LIG                ALE+I KVI +QSKYWKCF +R+GN  
Sbjct: 367 LDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLG 426

Query: 432 INFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTA 491
           +    V    + +K+FPLQTAIRQ+Q++ L +++ FV  P  N+++P D ++CSPN+   
Sbjct: 427 LPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNE 486

Query: 492 ETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIY 551
            T++++VHDTP+IW ++++I+ T+DP +S+++DS  +F+KW   RKYGI+D+NIPQSL  
Sbjct: 487 TTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLF- 545

Query: 552 GDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERV 611
                +NY++++ +QEIL+++WDN++KF   + K+AFIG+GD+ +G+VHLLGHRDT+  V
Sbjct: 546 ---EQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVV 602

Query: 612 KAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRC 671
           K+V++F+  K LKPLVPLV+ESL DWYFKNSLVF++ +H CWGD EN+KPRKK+GRVLRC
Sbjct: 603 KSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRC 662

Query: 672 DTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           D +G+N+ IEER +E+TDFILDSFEEWSDSE
Sbjct: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1067 bits (2760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/708 (69%), Positives = 592/708 (83%), Gaps = 10/708 (1%)

Query: 1   MQSNMTSSAMEGSTKRK----QEEENLESLNV--VPKRQVIVPTKKPQVHYIPLKTGLCY 54
           +Q+N   +  + + KR     +EE  L+   +  V +R VIVP +  ++ Y PLKTGLCY
Sbjct: 23  LQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCY 82

Query: 55  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIP 114
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSG++DIGD+MLKIP
Sbjct: 83  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIP 142

Query: 115 VREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAI 174
           VR+AT +EILEVHS+EH +F+E T+TMNRE LLK TEKGDSVYFNNDS+ SAKL  GG+I
Sbjct: 143 VRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSI 202

Query: 175 EACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMIL 234
           EACKAVVEG+VKN+LAVVRPPGHH+EP+++GGFCLFSNVA+AAKNILKNYPESVR+IMIL
Sbjct: 203 EACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMIL 262

Query: 235 DWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWP 294
           DWDIHHGNGTQKAFY D+RVLY+SLHRFE GKYYPGT+ GQYDQ GEGKGEGFNCNITWP
Sbjct: 263 DWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWP 322

Query: 295 TGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHML 354
            GGVGDAEY+WAFEQ+VMPM REFQPDLVIISSGFDAADGD IGQCHVTPSCYGHMTHML
Sbjct: 323 VGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHML 382

Query: 355 KSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIK 414
           KSLA+GNL VVLEGGYNLD+IA SALSVAK LIG                A+E+I KVI+
Sbjct: 383 KSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIR 442

Query: 415 IQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTAN 474
           +QSKYWKCFKRR+GN   NF +  +++L +K FPLQ AIR+QQ   L +++ F   P   
Sbjct: 443 LQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLK 502

Query: 475 LKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH 534
            +LP D +LCSPN++ ++TVII  HDTP+IW ++D+I  T+DP SSII+DSTLDF+KWA+
Sbjct: 503 PELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWAN 562

Query: 535 NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS 594
            +KYG+ID+NIPQ+L       +NYS+++ +QE+L ++WDN++K+   V K+AFIG+GD+
Sbjct: 563 EKKYGVIDINIPQNLF----EQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDA 618

Query: 595 VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG 654
            SG+VHLLGHRDT+  VK+VINF+A KQL+ LVPLVDESLSDWYFKNSLVFS+++H  WG
Sbjct: 619 YSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWG 678

Query: 655 DKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           DKENKKPRKKYGR+LRC+TDG+N+ +EERF+EATDFILDSFEEWSDSE
Sbjct: 679 DKENKKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/674 (72%), Positives = 570/674 (84%), Gaps = 6/674 (0%)

Query: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90
           KRQ+IV    P++ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83

Query: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150
           ENGLI D MLSG+DDIGD+MLKIPVREAT+ E+LEVHS+EHLEF+ES T M+ + LLK T
Sbjct: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143

Query: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210
           E GDSVYFNNDS  SAKLSCGGAIEACKAVVEG+VKNA AVVRPPGHHSEPES+GGFCLF
Sbjct: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203

Query: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270
           SNVAVA+KNIL+NYPESVR+IMILDWDIHHGNGTQKAFY D+RVLY+SLHRFE GKYYPG
Sbjct: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263

Query: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330
           T QG YD+ GEGKGEGFNCNITWP GGVGDAEYMWAFEQ+VMPM REF+PDLVIIS+GFD
Sbjct: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323

Query: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXX 390
           AADGD IGQCHV+PSCYGHMTHMLKSLA GNL VVLEGGYNLD+IA SALSVAK LIG  
Sbjct: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383

Query: 391 XXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450
                         A+E+I KVI++QSKYWKCF+RRHGN    F +  +++++T  FPLQ
Sbjct: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443

Query: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510
           +AIRQQQ+  L KE+ FVKFP   +KL DD ++CSP ++  +T+II+V DTP+IW ++D+
Sbjct: 444 SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDV 503

Query: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570
           I  T+DP +SII D+ L F+KWA  R YG+IDVNIPQSL       DNYS++I AQE++ 
Sbjct: 504 IQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLF----EQDNYSAMITAQEVMS 559

Query: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630
           F+WDN+I+F    +KIAF+GVGD+ SG+VHLLGHRDT+ +VK+VINF+A K LKPL+PLV
Sbjct: 560 FMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLV 619

Query: 631 DESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688
           DE+L DWYFKNSLVFS++ H CWGD   ENKKPRKK+GRVLRC++DGL + IEERF+EAT
Sbjct: 620 DETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEAT 679

Query: 689 DFILDSFEEWSDSE 702
           DF+LDSFEEWS+S+
Sbjct: 680 DFMLDSFEEWSESD 693

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/701 (69%), Positives = 567/701 (80%), Gaps = 15/701 (2%)

Query: 10  MEGSTKRK------QEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAK 63
           ME S KRK      + E    S   +P   VIVP   P++HY  LKTGLCYDVRMRYHAK
Sbjct: 19  MEDSLKRKVDTMEDEVESRKRSTGTLP---VIVPEVPPRIHYTQLKTGLCYDVRMRYHAK 75

Query: 64  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEI 123
           I+TSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSGVD+IG++MLKIPVREATA+EI
Sbjct: 76  IYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEI 135

Query: 124 LEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEG 183
           L+VH++EHL FLE T  M RE LLKETE GDSVYFNNDS +SAKLSCGGAIEACKAVVEG
Sbjct: 136 LQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEG 195

Query: 184 KVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNG 243
           +VKNALAV+RPPGHH+EPE +GGFCLFSNVAVAA+NILKNYPESVR+IMILDWDIHHGNG
Sbjct: 196 RVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNG 255

Query: 244 TQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEY 303
           TQKAFY D RVLYVSLHR+E GKYYPGTV G Y+Q GEGKGEGFNCNI WP GG+GDAEY
Sbjct: 256 TQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEY 315

Query: 304 MWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLV 363
           MWAF+Q+VMPMGREFQPDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARGNL 
Sbjct: 316 MWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLC 375

Query: 364 VVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCF 423
           VVLEGGYNLDSIA SAL VAK LIG                A+E I  VI+ QSKYW CF
Sbjct: 376 VVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCF 435

Query: 424 KRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLIL 483
           K  H N   NF E  +++  +K FPLQ AIRQ+Q   L +++ FV  P  N+++P D ++
Sbjct: 436 KSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVI 495

Query: 484 CSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDV 543
           CSPNI+ AETV++ VHDTP+IW +++ I+ T+DP +SII+D+TLD +KW+  RKY +IDV
Sbjct: 496 CSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDV 555

Query: 544 NIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLG 603
           NIPQSL       DNYS++I +QE+L+++WDN++K+   + K+AFIGVGD+ SG+VHLLG
Sbjct: 556 NIPQSLF----EQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLG 611

Query: 604 HRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKP 661
           HRDT+  VKA ++F+  K LK LVPLVDESL +WYFKNSLVF+++ H CWG    ENKKP
Sbjct: 612 HRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKP 671

Query: 662 RKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           RK++GRVL+CDT G+N+ +EERF EATDFILDSFEEWSDSE
Sbjct: 672 RKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/676 (69%), Positives = 560/676 (82%), Gaps = 7/676 (1%)

Query: 29  VPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 88
           V KR  IVP  +P++HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI
Sbjct: 38  VAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 97

Query: 89  LAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLK 148
           LAENGLI+D  LSGVD IGD+MLKIPVREAT +EIL+VH++EHLEF+  TT+M R+ LLK
Sbjct: 98  LAENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLK 157

Query: 149 ETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFC 208
           ETEKGDSVYFNNDSY+SAKLSCGGAIEACKAVVEG+VKNALAVVRPPGHH+EPE +GGFC
Sbjct: 158 ETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFC 217

Query: 209 LFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYY 268
           LFSNVAVAA+NILKNYPESVRKIM+LDWD+HHGNGTQKAFY D+RVLY+SLHR E GKYY
Sbjct: 218 LFSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYY 277

Query: 269 PGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSG 328
           PGT+ G  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQ++MPMGREF+PDLVIISSG
Sbjct: 278 PGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSG 337

Query: 329 FDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIG 388
           FDAADGD +GQCHVTPSCYGHMTHMLKSLARGNL  VLEGGY+LDSIA SAL+VAK LIG
Sbjct: 338 FDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIG 397

Query: 389 XXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFP 448
                           A+E+I  VIK QSKYWKCFK  HGN   +F E A+DT   K FP
Sbjct: 398 -EPPDELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFP 456

Query: 449 LQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEK 508
           LQ AIRQQQ   L  E+ FV  P    +LPDD  +CSPNI+ A  +I+ VHDTP IW ++
Sbjct: 457 LQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQR 516

Query: 509 DIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEI 568
              + T+DP +SII+D+TLD +KWA +R YG+ID+NIPQSL       DNYS++I AQE+
Sbjct: 517 SRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSL----HEQDNYSAVITAQEV 572

Query: 569 LLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVP 628
           L+ +WDN++K+   +N++AF+ +GD+ SGVVHLLGHRDT+  VK+ ++F+  + L+PL+P
Sbjct: 573 LVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIP 632

Query: 629 LVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDE 686
           LVDE+L+DWYFKNSLVF++  H CWG+   ENKKPRKK+GRVL+CD+DG+N+ +EERF+E
Sbjct: 633 LVDETLADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEE 692

Query: 687 ATDFILDSFEEWSDSE 702
           ATDFILD+FEEWSDSE
Sbjct: 693 ATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/686 (69%), Positives = 567/686 (82%), Gaps = 8/686 (1%)

Query: 19  EEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 78
           EEEN  S   V KR VIVP  + ++HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED
Sbjct: 29  EEENGGSETKV-KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPED 87

Query: 79  PRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLEST 138
           PRRIYRIYKILAENGLI D  LSGVDDIGD+MLKIP REAT +EIL+VH+ EHLEFL  T
Sbjct: 88  PRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKT 147

Query: 139 TTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHH 198
           T+M RE LLKETEKGDSVYFNNDSY+SAKLSCGGAIEAC+AVVEG+VKNALAVVRPPGHH
Sbjct: 148 TSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHH 207

Query: 199 SEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVS 258
           +EP+ +GGFCLFSNVAVAA+NILKNYPESV+KIMILDWD+HHGNGTQKAFY D+RVLYVS
Sbjct: 208 AEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVS 267

Query: 259 LHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREF 318
           LHR E GKYYPGT+ G  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQ+V+PMGREF
Sbjct: 268 LHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREF 327

Query: 319 QPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAIS 378
           QPDLVIISSGFDAADGD +GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA S
Sbjct: 328 QPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKS 387

Query: 379 ALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVA 438
           AL VAK LIG                A+E+I  VIK+QS+YW+CFK  H N   +F E  
Sbjct: 388 ALGVAKVLIG-EPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPV 446

Query: 439 SDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIV 498
           ++TL  + FPLQTAIRQQQ   L  EY+FV  P    +LPDD  LCSPNI+ ++++I+ V
Sbjct: 447 TETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCV 506

Query: 499 HDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDN 558
           HDTP+IW ++   + T+DP +SII+D+TLD +KWA  R YG+ID+NIPQSL       DN
Sbjct: 507 HDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSL----HEQDN 562

Query: 559 YSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFM 618
           YS+++ AQE+L+++WD+++K+   ++K+AF+ +GD+ SGVVHLLGHRDT+  VKA I+F+
Sbjct: 563 YSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFI 622

Query: 619 ADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGL 676
             + L+PLVPLVDESL+DWYFKNSLVF++  H CWG+   ENKKPRKK+GRVL+C++DGL
Sbjct: 623 DQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGL 682

Query: 677 NSTIEERFDEATDFILDSFEEWSDSE 702
           N+ +EERF+EATDFILD+FEEWSDSE
Sbjct: 683 NNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/674 (69%), Positives = 559/674 (82%), Gaps = 6/674 (0%)

Query: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90
           KR +IVP  KP++HY+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96

Query: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150
           ENGLI D  LSGVDDIG++MLKIP+REAT DEIL VHS+EH+EFL++T TM+RE LLKET
Sbjct: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156

Query: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210
           E GDSVY+NNDS +SAKLSCGGAIEACKAVVEG+VKNALAVVRPPGHH+EPE +GGFCLF
Sbjct: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216

Query: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270
           SNVAVAA+NILKNYPESVRK+MILDWDIHHGNGTQ+AFY D RVLYVSLHR+E G+YYPG
Sbjct: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276

Query: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330
           T  G Y+Q GEGKGEGFNCNI W  GGVGDAEYMWAFEQIV+PMGREFQPDLVIISSGFD
Sbjct: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336

Query: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXX 390
           AADGD IGQCHV+P+CYGHMTHMLKSLA+GN+ VVLEGGYNLDSIA SAL V K LIG  
Sbjct: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396

Query: 391 XXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450
                         A+  I  VI+ Q+KYW CFK +HGN  +N+ E   ++L  K FPLQ
Sbjct: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456

Query: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510
           +A+RQ+Q+  L KEY FV  P  +++L  D I+CSPNIH  +T+II VHDTP++W +++ 
Sbjct: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516

Query: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570
           ++  +DP +SII+D+TL    WA  R YGIID+NIPQSL       DNYS+++ +QE+L 
Sbjct: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLF----ELDNYSAVLTSQEVLS 572

Query: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630
           +LWD+++KF  ++ ++AF+G+GD+ SG VHLLGHRDT+  VK  I+F   KQL+PLVPLV
Sbjct: 573 YLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLV 632

Query: 631 DESLSDWYFKNSLVFSNRTHPCWGDKEN--KKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688
           DES+SDWYFKNSL+F+++ H CWG + N  KKPRKK+GRVL+C++DG+N+ +EERF+EAT
Sbjct: 633 DESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEAT 692

Query: 689 DFILDSFEEWSDSE 702
           DFILDSFEEWSDSE
Sbjct: 693 DFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/674 (67%), Positives = 544/674 (80%), Gaps = 6/674 (0%)

Query: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90
           +R VIVP  KP++ Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILA
Sbjct: 35  QRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA 94

Query: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150
           ENGLI D  LSG D IGD+M+K+PVREA  +EIL+VHSR+HL+F+  T  + RE LLKET
Sbjct: 95  ENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKET 154

Query: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210
           E GDSVYFNNDSY+SAKLSCGGAIEACKAVVEG+VKN++AVVRPPGHH+EPE +GGFCLF
Sbjct: 155 EGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLF 214

Query: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270
           SNVAVAA N+LK+YPESVRKIMI+DWDIHHGNGTQKAFY D+RVLYVSLHR++ GKYYPG
Sbjct: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPG 274

Query: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330
           T+ G YDQ GEGKGEGFNCNITWPTGGVGDAEYMWAFEQ++MPMGREF+PDLV+ISSGFD
Sbjct: 275 TIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334

Query: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXX 390
           AADGD IGQCHVTP+CYGHMTHML SLA+GNL VVLEGGYNLDSIA SAL V K L+G  
Sbjct: 335 AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394

Query: 391 XXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450
                         A +MI  VI+ QSKYW CFK RHGN  INF +  + TL T+ FPLQ
Sbjct: 395 PDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQ 454

Query: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510
            AIR+ Q   L  +++FV+ P  +L LP + +LC+  I  +ET+++IVHDTP+IW E+D 
Sbjct: 455 NAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDT 514

Query: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570
            +  +DP SSII+D+ L  + WA +R+YGIID+NIPQ+L        NY  + ++QEIL+
Sbjct: 515 QTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLF----EHANYPGVASSQEILI 570

Query: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630
           +LWDN++KF   + K+AFIG+GD+  G+VHLLGHRDT+  VK  I+F+  K LK +VPL+
Sbjct: 571 YLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLI 630

Query: 631 DESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688
           DE+L DWYFKNSLVF++ TH CWG    ENKK RKKYGRVL+ D DG+ +  +ERF+EAT
Sbjct: 631 DETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEAT 690

Query: 689 DFILDSFEEWSDSE 702
           DFILDSFEEWS+SE
Sbjct: 691 DFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/697 (67%), Positives = 554/697 (79%), Gaps = 9/697 (1%)

Query: 11  EGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFE 70
           EGS   +          +V KR VIVP  +P++ Y+PLKTGLCYDVRMRYHAKIFTSYFE
Sbjct: 13  EGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFE 72

Query: 71  YIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSRE 130
           YIDPHPEDPRRIYRIYKILAENGLI D  LSG+D+IG++M KIPVREAT +EIL VHS+E
Sbjct: 73  YIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKE 132

Query: 131 HLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALA 190
           H+EFL++T TM+RE LLKETE GDSVY+NNDS +SA+LSCGGAIEACKAVVEG+VKNA+A
Sbjct: 133 HVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMA 192

Query: 191 VVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQ 250
           VVRPPGHH+EP  +GGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQKAFY 
Sbjct: 193 VVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYG 252

Query: 251 DERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQI 310
           D RVLYVSLHR+E GKYYPGT  G YDQCG+GKGEGFNCNI W   GVGDAEYMWAFEQ+
Sbjct: 253 DNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQV 312

Query: 311 VMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGY 370
           V+PMGREFQPDLVIISSGFDAADGD IGQCHV+P+CYGH+THMLKSLARGN+ VVLEGGY
Sbjct: 313 VIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGY 372

Query: 371 NLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMI-YKVIKIQSKYWKCFKRRHGN 429
           NLDSIA SAL VAK LIG                A+  I   ++K QSKYW CFK RHGN
Sbjct: 373 NLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGN 432

Query: 430 YNINFSEVA-SDTLATKTFPLQTAIR-QQQYYNLFKEYDFVKFPTANLKLPDDLILCSPN 487
             IN+ E A +D+L +K FPLQ       Q+  L KEY FV  P  N++LP D I+CSPN
Sbjct: 433 DGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPN 492

Query: 488 IHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQ 547
           IHT + +II VHDTP+IW ++D ++  +DP +SII+D+T+  + WA  R YG+ID+NIPQ
Sbjct: 493 IHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQ 552

Query: 548 SLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDT 607
           SL       DNYS+++++QE++ +LWD+++K    + ++AF+G+GD+ SG VHLLGHRDT
Sbjct: 553 SLF----EQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDT 608

Query: 608 KERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKEN--KKPRKKY 665
           +  VK  I F   KQL+PLVPLVDESL DWYFKNSLVF++  HPCWG   N  KKPRKK+
Sbjct: 609 RSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKF 668

Query: 666 GRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           GRVLR   DG+N+ +EER +EATDFILDSFEEWS+SE
Sbjct: 669 GRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/677 (65%), Positives = 548/677 (80%), Gaps = 6/677 (0%)

Query: 26  LNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 85
           + V+PKR VIVPT+KP +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 29  IQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 88

Query: 86  YKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREV 145
           YKILAENGLIND  L+GV DIGD+MLKIPVREAT +EIL+VH+ EH++FLEST  M RE 
Sbjct: 89  YKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREE 148

Query: 146 LLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSG 205
           LL +TEKGDSVY NNDSY+SA+LSCGGAIEACKAVVEG+VKNALA+VRPPGHH+EP+++G
Sbjct: 149 LLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAG 208

Query: 206 GFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAG 265
           GFCLFSNV+VAAK+ILK YPESVRKI+I+DWDIHHGNGTQKAFY+D+ VLY+SLHRFE G
Sbjct: 209 GFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELG 268

Query: 266 KYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVII 325
           K+YPG  +G YD+ G+GKG+GFNCNITWP  GVGD EY+WAFEQIV+PM REF+PDLVI+
Sbjct: 269 KFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIV 328

Query: 326 SSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKT 385
           SSGFDAA GD IGQCHVTP+CYG+MTHMLKSLARGNL VVLEGGYNLDSI+ SAL+VAK 
Sbjct: 329 SSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKI 388

Query: 386 LIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATK 445
           LIG                 LEMI KVI++QSKYWKCF+R+ GN+   + E A ++   K
Sbjct: 389 LIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPK 447

Query: 446 TFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIW 505
            FPLQ AIR  Q  + + ++  +     NL LP + I+CS N   A+++ +++HDTP++W
Sbjct: 448 MFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVW 507

Query: 506 LEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINA 565
             +DII+  +DP +SII DS+L F+ WA  R+  +ID+NIP+S        DNYSS + +
Sbjct: 508 GNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAF----EADNYSSNLLS 563

Query: 566 QEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKP 625
           Q++++ LWDNH K++  + K+ FIG+G++ SG+VHLLG RDT+   KA INF+    LKP
Sbjct: 564 QDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKP 623

Query: 626 LVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFD 685
           +VP +DESL DWYFKNSLVF++  H CW + + KKPRKKYGRVLRCDTDG+++ IEERF+
Sbjct: 624 IVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFE 682

Query: 686 EATDFILDSFEEWSDSE 702
           EATDFILD+F+EWSD+E
Sbjct: 683 EATDFILDAFDEWSDTE 699

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/658 (67%), Positives = 534/658 (81%), Gaps = 4/658 (0%)

Query: 43  VHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSG 102
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI D  LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 103 VDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDS 162
           +DDIGD+M KIPVREAT++EILEVH +E LE+LE T  +NR+ LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 163 YMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILK 222
           Y SAKLSCGGAIEACKA+V+GKVKN+LA+VRPPGHHSEPE +GGFCLFSNVAVA KNILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 223 NYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEG 282
           NYP+ V+K+MI+DWDIHHGNGTQKAFY D+RVLYVSLHRFE GKYYPGT+ GQYDQ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 283 KGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHV 342
           KGEGFNCNI W  GG+GDAEY+WAFEQIVMPMGREF+PDLVI+SSGFDAADGD IG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 343 TPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXX 402
           TPSCYGHMTHMLKSLA G L VVLEGGYNLD+IA SAL+VAK LIG              
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 403 XXALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLF 462
             A+EMI +VI ++SKYWKCFKR+  N N  +    S++   K FP+Q AIR QQ   L 
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 463 KEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSII 522
            +Y+ V  P  N  LP+D ++CS +I  +   II VHDTP+IW ++D I+  +D  +S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 523 IDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNE 582
           +D++L F  WA +R YGIIDVNIPQ+L       DNYS+ + AQE+L+ LWDN++K+   
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLY----EQDNYSASLTAQEVLIKLWDNNLKYFPN 540

Query: 583 VNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNS 642
           VNKIA+IGVG++ SG+VHLLGHRDT+  VK+VI F+  K LK LVPLV+ESL+DWYFK S
Sbjct: 541 VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS 600

Query: 643 LVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSD 700
           L+F+++ H CWG+ ++KKPRK+YGRVLRCD+DG+ S IEERF+EATDFI+DS +EW++
Sbjct: 601 LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/476 (73%), Positives = 395/476 (82%), Gaps = 11/476 (2%)

Query: 12  GSTKRKQEE-----ENLESLNVVPK------RQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60
           G  KR  EE     +N+ + N++ K      +Q+IVP + P++HY+PLKTGLCYDVRMRY
Sbjct: 10  GGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRY 69

Query: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIND  LSGVD+IGD+MLK+P+REAT 
Sbjct: 70  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATM 129

Query: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180
           +EILEVHS EH ++LE T+  NRE LLKETE GDSVYFNNDS+ SAKLSCGGAIEACKAV
Sbjct: 130 NEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAV 189

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VEG+VKNA+AVVRPPGHHSEPES+GGFCLFSNVAVA KNILKNYPESVRK++ILDWDIHH
Sbjct: 190 VEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHH 249

Query: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300
           GNGTQKAFY D+ VLY+SLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP G VGD
Sbjct: 250 GNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGD 309

Query: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360
           AEYMWAFEQ+VMPM REFQPDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARG
Sbjct: 310 AEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARG 369

Query: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYW 420
           NL VVLEGGYNLD+IA SALSV+K LIG                 +EMI K+I++QSKYW
Sbjct: 370 NLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQSKYW 429

Query: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLK 476
           KCF+RRHGN   NF E  +D+L +K FPLQTAIR  Q   LF E +F+  P  N +
Sbjct: 430 KCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ 485

 Score =  301 bits (770), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 182/235 (77%), Gaps = 8/235 (3%)

Query: 472 TANLK----LPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTL 527
           T N+K    L ++ ILCSP I  ++T++++VHD+P +W ++D+ +  VD  S+IIIDSTL
Sbjct: 565 TTNIKTISPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTL 624

Query: 528 DFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIA 587
           DF+KW+ +R YG+ID+NIPQ+L       DNYSS++ AQE LL  WDN++K+   + KI 
Sbjct: 625 DFIKWSLDRNYGVIDINIPQTLF----EQDNYSSILAAQETLLSFWDNYLKYFPYIEKIV 680

Query: 588 FIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSN 647
           FIG GD+ +G+VHLLGHRDT+  VK+VINF+  K LK LVPLVDE+LSDWYFKNSLVF++
Sbjct: 681 FIGFGDAHAGIVHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTD 740

Query: 648 RTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           + HP W D ENKKPRKK+GRVLR   DG+ + IEERFDEATDFILDSFEEWSD E
Sbjct: 741 KNHPFWADNENKKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/300 (78%), Positives = 275/300 (91%)

Query: 29  VPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 88
           +PKRQVIVP ++P++HY PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKI
Sbjct: 50  MPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKI 109

Query: 89  LAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLK 148
           LAENGLI D  LSG+DDIGDIMLKIPVR AT +EIL VH+REHL+F+E+  + +RE L+K
Sbjct: 110 LAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIK 169

Query: 149 ETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFC 208
            TEK DSVY+NNDSY SAKLSCGG IEAC+AVVEG+VKN+LA+VRPPGHH+EP+++GGFC
Sbjct: 170 LTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFC 229

Query: 209 LFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYY 268
           LFSNV+VAA++IL+ YPESVRKI+ILDWDIHHGNGTQKAFY+DE VLY+SLHR+E+  +Y
Sbjct: 230 LFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFY 289

Query: 269 PGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSG 328
           PGT+ G+YDQ GEGKGEGFNCNITWP GGVGDAEYMWAFE +VMP+GREF+PDLVI+SSG
Sbjct: 290 PGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  262 bits (670), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 170/228 (74%), Gaps = 4/228 (1%)

Query: 475 LKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAH 534
           +K  + L+L S  I  AET++I+VHDTP++W ++DII+  +DP +S++ID+++ F+KWA 
Sbjct: 353 MKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAA 412

Query: 535 NRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDS 594
           +R Y I+D+NIP+S +      + +SS   A EI+L LWDNH+++++ + KI FIG+G+S
Sbjct: 413 DRNYSILDINIPKSNL----EKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGES 468

Query: 595 VSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWG 654
             G+VHL+G RD +   KAVINF+ +  LK L    DE++ DWYFKNSLVF+N +H CW 
Sbjct: 469 YQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWK 528

Query: 655 DKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702
           + E K+PRKK+GRVL+ D+DG+ S I ERFDEATDFILD+FEEWSD E
Sbjct: 529 ESEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 161/325 (49%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S + Y   HP  P R      +++  GL N            IM
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IM 69

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET----EKGDSVYFNNDSYMSA 166
                REAT +E+L+ HS +++EFL   +  N   + + T      GD      + Y   
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYEYC 129

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
           KL  G +++A + ++  +  + +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 130 KLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP 187

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G YD+ G  +G+
Sbjct: 188 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEGK 240

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ ++ P+   F+P  +I   G D+   D +G  ++   
Sbjct: 241 HFAMNVPL-NDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNIK 299

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     ++S     +VVV  GGY
Sbjct: 300 AHGECVKFIRSFGIP-MVVVGGGGY 323

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 168/337 (49%), Gaps = 30/337 (8%)

Query: 40  KPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTM 99
           K +  Y+P + G  Y   + YH     S + Y   HP  P R+     +++  GL     
Sbjct: 9   KTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL----- 63

Query: 100 LSGVDDIGDIMLKIPVREATADEILEVHSREHLEFL-----ESTTTMNREVLLKETEKGD 154
                    IM     REAT DE+LE HS +++EFL     ++ + M R  L K     D
Sbjct: 64  -------HKIMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDD 116

Query: 155 SVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNV 213
              F    +  + L  G +++A + ++ G+  + +A+    G HH++     GFC  +++
Sbjct: 117 CPIFQG-IFEYSSLYAGASLDASRKLIAGQ--SEIAINWSGGLHHAKKAKPSGFCYVNDI 173

Query: 214 AVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQ 273
            +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  
Sbjct: 174 VLAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 226

Query: 274 GQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAAD 333
           G +D+ G  +G+ F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+  
Sbjct: 227 GDFDEIGCSRGKHFALNVPL-DDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG 285

Query: 334 GDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGY 370
            D +G  ++    +G     +KS     ++VV  GGY
Sbjct: 286 HDRLGCFNLNIRAHGECVKFVKSFGI-PMLVVGGGGY 321

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/337 (28%), Positives = 170/337 (50%), Gaps = 31/337 (9%)

Query: 39  KKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDT 98
           ++PQ  Y   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL    
Sbjct: 14  EQPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL---- 66

Query: 99  MLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GD 154
                     IM     REAT +E+ + HS++++EFL   T  N   + + T EK   GD
Sbjct: 67  --------HKIMDLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGD 118

Query: 155 SVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNV 213
                 + Y  + L  G +++A + ++  +  + +A+    G HH++  +  GFC  +++
Sbjct: 119 DCPIFQNIYDYSTLYTGASLDASRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 214 AVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQ 273
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  +S H+F  G+++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT-- 229

Query: 274 GQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAAD 333
           G +D+ G  KG+ F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+  
Sbjct: 230 GDFDEIGCAKGKHFAMNVPL-EDGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 334 GDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGY 370
            D +G  ++    +G     +KS     ++VV  GGY
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGY 324

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/343 (27%), Positives = 174/343 (50%), Gaps = 33/343 (9%)

Query: 40  KPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTM 99
           +PQ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D +
Sbjct: 15  QPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHL 60

Query: 100 LSGVDDIGDIMLKIPVREATADEILEVHSREHLEFL-----ESTTTMNREVLLKETEKGD 154
           +SG   +  IM     R+A+ DE+LE H+ +++ FL     ++   M R  L K     D
Sbjct: 61  VSGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDD 119

Query: 155 SVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNV 213
              F+N  Y  + L  G +++A + ++ G+  + +A+    G HH++  S  GFC  +++
Sbjct: 120 CPIFHN-LYEYSSLYTGASLDASRKLLNGQ--SDIAINWSGGLHHAKKTSPSGFCYINDI 176

Query: 214 AVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQ 273
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  
Sbjct: 177 VLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT-- 229

Query: 274 GQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAAD 333
           G YD+ G   G+ F  N+     G+ D  Y+  F+ I+ P+   + P ++I   G D+  
Sbjct: 230 GNYDETGCSNGKHFALNVPL-KDGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLG 288

Query: 334 GDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIA 376
            D +G  ++    +G     +KS     ++VV  GGY   +++
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPKNVS 330

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 169/337 (50%), Gaps = 33/337 (9%)

Query: 40  KPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTM 99
           KPQ   +    G  Y  R+ YH     S + Y   HP  P R+           ++ D +
Sbjct: 15  KPQFERV---FGSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRL-----------MLTDHL 60

Query: 100 LSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLE--STTTMN---REVLLKETEKGD 154
           +S    +  IM     REAT +E+ + HS ++L+FLE  S  T+N   R  L K     D
Sbjct: 61  VSSYG-LHKIMDLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSD 119

Query: 155 SVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNV 213
              F N  Y  + L  G +++A + ++ G+  + +A+    G HH++  +  GFC  +++
Sbjct: 120 CPIFEN-IYDYSTLYTGASLDASRKLINGQ--SEIAINWSGGLHHAKKNNPSGFCYINDI 176

Query: 214 AVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQ 273
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT-- 229

Query: 274 GQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAAD 333
           G YD+ G   G+ F  N+     G+ D  Y+  F+ I+ P+   +QP ++I   G D+  
Sbjct: 230 GNYDEIGCSGGKHFAMNVPL-NDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLG 288

Query: 334 GDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGY 370
            D +G  ++    +G     + S     ++VV  GGY
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVSSFGIP-MLVVGGGGY 324

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  134 bits (336), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 163/325 (50%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              IM
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIM 72

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSYMSA 166
                R AT DE+L+ HS +++ FL+  T  N   + + T EK   GD      + Y  +
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++  +  + +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 133 ALYAGASLDASRKLINNQ--SDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP 190

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G YD+ G  +G+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQGK 243

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 244 HFAMNVPL-EDGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNIK 302

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     ++S     ++VV  GGY
Sbjct: 303 AHGECVKFIRSFGIP-MLVVGGGGY 326

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 53  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLK 112
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              IM  
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 113 IPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEK----GDSVYFNNDSYMSAKL 168
              R AT DE+LE HS +++ FL   +  N   L + T +    GD      + Y    L
Sbjct: 71  YETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 169 SCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
             G +++A + ++  +  + +A+    G HH++  S  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 228 VRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGF 287
             +I+ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 288 NCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCY 347
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPL-EDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 348 GHMTHMLKSLARGNLVVVLEGGY 370
           G     +KS     ++VV  GGY
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGY 322

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 161/324 (49%), Gaps = 29/324 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y+  + YH     S F Y   HP  P R+     +++  GL              IM
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL------------HKIM 68

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSYMSA 166
                R AT +E+ E H+ +++EFL   +  N   L + T EK   GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++ G+  + +A+    G HH++  S  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPL-EDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 346 CYGHMTHMLKSLARGNLVVVLEGG 369
            +G     +KS   G  ++VL GG
Sbjct: 299 AHGECVRFVKSF--GIPMLVLGGG 320

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 166/325 (51%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S++ Y   HP  P R+           ++ D ++SG   +  IM
Sbjct: 21  GSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 68

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSYMSA 166
                R+ATA+E+ E HS +++ FL   T  N   L + T EK   GD      + +  +
Sbjct: 69  DLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPNIFQYS 128

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++  +  + +A+    G HH++  S  GFC  +++ +A  N+L+ +P
Sbjct: 129 SLYTGASLDASRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYHP 186

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G+ D+ G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADGK 239

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   F+P +++   G D+   D +G  ++   
Sbjct: 240 HFAMNVPL-EDGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNIK 298

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     ++S     ++VV  GGY
Sbjct: 299 AHGECVKFVRSFGIP-MLVVGGGGY 322

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 53  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLK 112
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              IM  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 113 IPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEK----GDSVYFNNDSYMSAKL 168
              R AT DE+L+ HS +++ FL   +  N   L + T +    GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 169 SCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
             G +++A + ++  +  + +A+    G HH++  S  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 228 VRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGF 287
             +I+ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 288 NCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCY 347
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPL-EDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 348 GHMTHMLKSLARGNLVVVLEGGY 370
           G     +KS     ++VV  GGY
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGY 322

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/322 (27%), Positives = 162/322 (50%), Gaps = 28/322 (8%)

Query: 54  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKI 113
           Y  R+ YH     S + Y   HP  P R+     +++  GL              IM   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDLY 75

Query: 114 PVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSYMSAKLS 169
             R AT +E+++ HS ++L+FL   T  N   + + T EK   GD      + Y  + L 
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYSTLY 135

Query: 170 CGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESV 228
            G +++A + ++  +  + +A+    G HH++  +  GFC  +++ ++  N+L+ +P   
Sbjct: 136 TGASLDATRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP--- 190

Query: 229 RKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFN 288
            +++ +D D+HHG+G Q+AFY  +RV  +S H+F  G+++PGT  G YD+ G  KG+ F 
Sbjct: 191 -RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHFA 246

Query: 289 CNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYG 348
            N+     G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  ++    +G
Sbjct: 247 MNVPL-EDGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGHG 305

Query: 349 HMTHMLKSLARGNLVVVLEGGY 370
                +KS     ++VV  GGY
Sbjct: 306 ECVKFIKSFGIP-MLVVGGGGY 326

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 171/338 (50%), Gaps = 32/338 (9%)

Query: 46  IPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLS--GV 103
           +P + G  Y  ++ YH     S + Y   HP  P R+           ++ D ++S  G+
Sbjct: 52  LPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRL-----------MLTDHLVSCYGL 100

Query: 104 DDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVL----LKETEKGDSVYFN 159
             I D+      REAT +E+LE H+ +++EFL   T  N   L    L++   GD     
Sbjct: 101 HKIMDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIF 157

Query: 160 NDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAK 218
              +  + L  G +++A + ++  +  + +A+    G HH++  +  GFC  +++ +A  
Sbjct: 158 QGMFDYSILYAGASLDAARKLINNQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLAII 215

Query: 219 NILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQ 278
           ++L+ +P    +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G  D+
Sbjct: 216 SLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDE 268

Query: 279 CGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIG 338
            G  KG+ F+ N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G
Sbjct: 269 IGCSKGKKFSLNVPL-QDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLG 327

Query: 339 QCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIA 376
             ++    +G     +KS     ++ V  GGY   +++
Sbjct: 328 CFNLNIKAHGECVKFVKSFGIP-ILCVGGGGYTPRNVS 364

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  132 bits (331), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 163/325 (50%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S + Y   HP  P R+           ++ D ++S    +  +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRL-----------MLTDHLVSAYG-LHKVM 71

Query: 111 LKIPVREATADEILEVHSREHLEFLESTT--TMNR--EVLLKETEKGDSVYFNNDSYMSA 166
                R AT DE+ + HS +++ FL   T  T+N+     L++   GD        +  A
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++ G+  + +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNGQ--SEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPL-QDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     +KS     ++VV  GGY
Sbjct: 302 AHGECVRFVKSFGV-PMLVVGGGGY 325

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 158/323 (48%), Gaps = 28/323 (8%)

Query: 53  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLK 112
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              IM  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 113 IPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEK----GDSVYFNNDSYMSAKL 168
              R AT DE+L+ HS +++ FL   +  N   L + T +    GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 169 SCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
             G +++A + ++  +  + +A+    G HH++  S  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 228 VRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGF 287
             +I+ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 288 NCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCY 347
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPL-EDGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 348 GHMTHMLKSLARGNLVVVLEGGY 370
           G     +KS     ++VV  GGY
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGY 322

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 166/325 (51%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S + Y   HP  P R+           L+ D ++S    +  IM
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYG-LHKIM 68

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSYMSA 166
                R AT++EI E H++++++FL   T  N   + + T EK   GD      + +   
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFNYC 128

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
           KL  G +++A + ++  +  + +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 129 KLYAGASLDAARKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G +D+ G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANGK 239

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D IG  ++T  
Sbjct: 240 HFAMNVPL-EDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTIK 298

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     ++S     ++VV  GGY
Sbjct: 299 GHGECVKFIRSFGIP-MLVVGGGGY 322

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 164/328 (50%), Gaps = 28/328 (8%)

Query: 48  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIG 107
            + G    +R+ YH     S++ Y   HP  P R+           ++ D ++SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 108 DIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-EK---GDSVYFNNDSY 163
            +M     R AT DE+ E H+ +++ FL+  +  N   L + T EK   GD      + Y
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 164 MSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILK 222
             A L  G +++A + ++ G+  + +A+    G HH++  S  GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLINGQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 223 NYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEG 282
            +P    +++ +D D+HHG+G Q+AFY  +RV  +S H++  G ++PGT  G  D+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 283 KGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHV 342
            GE F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPL-EDGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 343 TPSCYGHMTHMLKSLARGNLVVVLEGGY 370
               +G     +KS     ++VV  GGY
Sbjct: 297 NIKAHGECVKFVKSFGI-PMLVVGGGGY 323

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 159/325 (48%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  +   + YH     S F Y   HP  P R+     +++  GL              IM
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIM 68

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVL----LKETEKGDSVYFNNDSYMSA 166
                R AT +E+ E HS +++EFL   +  N   L    L++   GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++ G+  + +A+    G HH++  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPL-DDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     +KS     ++VV  GGY
Sbjct: 299 AHGECVKYVKSFGL-PMLVVGGGGY 322

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 160/324 (49%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +AV    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE +V  +   +QP  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     L+VV  GGY + ++A
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVA 319

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 159/324 (49%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + HS E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ D  Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVA 319

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +AV    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E+   +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 93/346 (26%), Positives = 166/346 (47%), Gaps = 31/346 (8%)

Query: 36  VPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI 95
           V TKK Q  +   +    Y  R+ YH     S++ Y   HP  P R+     +++  GL 
Sbjct: 9   VKTKKSQPSF---EFNSNYSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL- 64

Query: 96  NDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEK--- 152
                        IM     R AT DE+ E H+ +++ FL   +  N   L + T +   
Sbjct: 65  -----------HKIMDLYETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFN 113

Query: 153 -GDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLF 210
            GD      + Y    L  G  ++A + ++  +  + +A+    G HH++  S  GFC  
Sbjct: 114 IGDDCPIFQNLYDYTTLYTGATLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYV 171

Query: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270
           +++ ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PG
Sbjct: 172 NDIVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG 226

Query: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330
           T  G   + G  KG+ F  N+     G+ D  Y+  F+ IV P+   F+P +++   G D
Sbjct: 227 T--GDLTEIGCDKGKHFALNVPL-EDGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGAD 283

Query: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIA 376
           +   D +G  ++    +G     +KS     ++VV  GGY   +++
Sbjct: 284 SLGHDRLGCFNLNIKAHGECVKFVKSFGLP-MLVVGGGGYTPKNVS 328

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  128 bits (322), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 160/325 (49%), Gaps = 28/325 (8%)

Query: 51  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIM 110
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL------------HKVM 68

Query: 111 LKIPVREATADEILEVHSREHLEFLESTTTMNREVL----LKETEKGDSVYFNNDSYMSA 166
                R AT +E+L  H++++++FL      N   L    L++   GD        +  +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 167 KLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYP 225
            L  G +++A + ++ G+  + +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 226 ESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGE 285
               +++ +D D+HHG+G Q+AFY  +RV  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 286 GFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPS 345
            F+ N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++   
Sbjct: 240 HFSLNVPL-NDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIR 298

Query: 346 CYGHMTHMLKSLARGNLVVVLEGGY 370
            +G     +KS     ++ V  GGY
Sbjct: 299 AHGECVKFVKSFGIP-MLCVGGGGY 322

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  128 bits (321), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 159/324 (49%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ D+ Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVA 319

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  128 bits (321), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 93/349 (26%), Positives = 174/349 (49%), Gaps = 31/349 (8%)

Query: 33  QVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 92
           Q  + T+K Q  +   + G  Y  R+ YH     S + Y   HP  P R+     +++  
Sbjct: 5   QYDIKTEKEQPGF---QFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSY 61

Query: 93  GLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET-E 151
           GL              IM     R AT +E+   HS E+++F++  T  N   L + T E
Sbjct: 62  GL------------HKIMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLE 109

Query: 152 K---GDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGF 207
           K   GD      + Y  + L  G +++A + ++  +  + +A+    G HH++  +  GF
Sbjct: 110 KFNIGDDCPIFPNLYDYSSLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGF 167

Query: 208 CLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKY 267
           C  +++ +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  +RV  VS H++  G++
Sbjct: 168 CYVNDIVLATLNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEF 222

Query: 268 YPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISS 327
           +PGT  G +D+ G  +G+ F  N+     G+ D  Y+  F+ I+ P+   ++P +++   
Sbjct: 223 FPGT--GNHDEVGCARGKHFALNVPL-QDGIDDDSYINLFKSIIDPLITSYKPTVIVQQC 279

Query: 328 GFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIA 376
           G D+   D +G  ++    +G   + ++S     ++VV  GGY   +++
Sbjct: 280 GADSLGHDRLGCFNLNVKAHGECVNFVRSFGLP-MLVVGGGGYTPRNVS 327

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  127 bits (320), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 L-RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVA 320

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  127 bits (320), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 157/323 (48%), Gaps = 26/323 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMI 233
           +E    +  GK   A+       HH++   + GFC  +++ +    +L+ +P    +++ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 234 LDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITW 293
           +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 294 PTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHM 353
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 -RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 354 LKSLARGNLVVVLEGGYNLDSIA 376
           +KS     ++VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  127 bits (320), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     L++V  GGY + ++A
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVA 319

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     +++V  GGY + ++A
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVA 319

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 159/324 (49%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N  +  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 157/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +AV    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 157/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  +E+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +AV    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 157/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N E+  KE+ K   GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA +   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 57  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVR 116
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 117 EATADEILEVHSREHLEFLESTTTMNREVLLKETEK---GDSVYFNNDSYMSAKLSCGGA 173
            AT  E+ + H+ E+++FL   T  N ++  KE+ K   GD     +  +    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 174 IEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIM 232
           +E    +  GK    +A+    G HH++   + GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 233 ILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNIT 292
            +D D+HHG+G ++AFY  +RV+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 293 WPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTH 352
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 353 MLKSLARGNLVVVLEGGYNLDSIA 376
            +KS     ++VV  GGY + ++A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 93/177 (52%), Gaps = 13/177 (7%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HHS  + + GFC  +++ +    I K   +  RKI  LD+D+HHG+G +K+F   + +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPT-GGVGDAEYMWAFEQIVMPMG 315
           +S+H FE G ++P T         E    GFN  +  PT  G+ D    +   ++++P+ 
Sbjct: 356 ISVHLFEPG-FFPCT------GSLEETKHGFNI-VNIPTLHGLDDNYLTYLLNRVIIPLI 407

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVTPS-CYGHMTHMLKSLARGNLVVVLEGGYN 371
           ++ +P+ +++  G D   GD   +  +T S    ++  +L++    ++V++  GGYN
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+  + + GFC  ++V +  + + K     + K+  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYM-WAFEQIVMPMG 315
           +S+H +E G ++PGT  G  +    GK       +  P     D  Y+     +I+ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVTPSCYGH-MTHMLKSLARGNLVVVLEGGYN 371
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+  + + GFC  ++V +  + + K     + KI  +D+D+HHG+G ++AF   +++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
           +S+H +E G ++PGT  G  +   +GK      NI     G  D+       +I+ P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLKH-GCDDSYLDLVASKIISPLIK 321

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVTPSCYGH-MTHMLKSLARGNLVVVLEGGYN 371
              PD++II  G D   GD   +  +T       + +++K   R ++ ++  GGYN
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 115/244 (47%), Gaps = 20/244 (8%)

Query: 133 EFLESTTTMNREVLLKETEKGDSVYFNNDSY--MSAKLSCGGAIEACKAVVEGKVKNALA 190
           E LE    +   ++ +   +GD   F   SY  M  ++  G  +   K  ++   + ++A
Sbjct: 152 ETLEGNAEIKATLMKEHNLEGDCPLF---SYIPMYTQVVTGATLSLSK-FLQPNSERSIA 207

Query: 191 VVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFY 249
           +    G HH+    + GFC  +++ +  + I KN     + I  +D+D+HHG+G QKAF 
Sbjct: 208 INWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKNISYVDFDLHHGDGVQKAFQ 264

Query: 250 QDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQ 309
             + V  VSLH FE G ++P T   Q     E K      NI    G   D  ++    +
Sbjct: 265 FSKNVQTVSLHMFEPG-FFPCTGSLQ-----EAKAGSSIVNIPLLHG--LDGTFLKQLTK 316

Query: 310 -IVMPMGREFQPDLVIISSGFDAADGDVIGQCHVT-PSCYGHMTHMLKSLARGNLVVVLE 367
            I++P+  + +P++++I  G D   GD   +  +T     G +  ++ +    ++V++  
Sbjct: 317 DIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGAIMKLINTFPSCSVVLLGG 376

Query: 368 GGYN 371
           GGYN
Sbjct: 377 GGYN 380

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 129/276 (46%), Gaps = 18/276 (6%)

Query: 99  MLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYF 158
           +LS    I D +   P + ++ + +L  H+ E  +   + +T  R+ L +   +GD   F
Sbjct: 113 LLSKFKKIKDDLPPKPRKRSSLEALL--HADEDDDEKSNVSTGQRD-LKQFNLEGDCPLF 169

Query: 159 NNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAA 217
           +    M  ++  G  +     V++G+   ++ +    G HH+  + + GFC  +++ +  
Sbjct: 170 SFIP-MYCQVITGATLMLADKVIKGE--RSIGINWDGGRHHAFKQKASGFCYVNDIVLLI 226

Query: 218 KNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYD 277
           + + +   +  +KI  +D+D+HHG+G +KAF     V  +SLH FE G ++PGT      
Sbjct: 227 QKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQTISLHLFEVG-FFPGT-----G 277

Query: 278 QCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVI 337
              E        NI     G+ D       EQIV P+    +PD+++I  G D   GD  
Sbjct: 278 NLSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDGF 336

Query: 338 GQCHVTPSCYGH-MTHMLKSLARGNLVVVLEGGYNL 372
            +  ++       +T ++ +     ++++  GGYN+
Sbjct: 337 NEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNV 372

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 86/176 (48%), Gaps = 12/176 (6%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HHS    + GFC  +++ +A + + +N+      I  +D+D+HHG+G ++AF   + V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
           +SLH  E G ++PGT   +  Q G         NI    G   D   M   E +V+P  +
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-----INIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVT-PSCYGHMTHMLKSLARGNLVVVLEGGYN 371
           +  P +++I  G D   GD   +  +T       +  +L SL   +++++  GGYN
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 97/211 (45%), Gaps = 15/211 (7%)

Query: 164 MSAKLSCGGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILK 222
           M  +++ G  +   K +V       + +    G HH+  + + GFC  +++ +  + + K
Sbjct: 185 MYLQVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRK 244

Query: 223 NYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEG 282
           N     +KI  LD+D+HHG+G +KAF   + +  +SLH FE G ++PGT        G  
Sbjct: 245 N---GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--------GGL 292

Query: 283 KGEGFNCNITWP-TGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCH 341
             +G    I  P + G+ D       +QI++P       + +++  G D   GD   +  
Sbjct: 293 SNKGSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQ 352

Query: 342 VTPSCYGH-MTHMLKSLARGNLVVVLEGGYN 371
           +T       +  ++   +   +V++  GGYN
Sbjct: 353 LTIKGLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 115/240 (47%), Gaps = 20/240 (8%)

Query: 137 STTTMNREVLLKETEKGDSVYFNNDSYMS--AKLSCGGAIEACKAVVEGKVKNALAVVRP 194
           S T ++R VL K     D   F   +Y+    ++  G  +   +A    + + A+++   
Sbjct: 162 SETGLDRRVLEKYGLSHDCYLF---AYLPLYCQVIAGATLSLVRAACL-RHERAISINWD 217

Query: 195 PG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDER 253
            G HH+    + GFC  +++A+  + + +     +R+I  +D+D+HH +G ++AF   + 
Sbjct: 218 GGRHHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQS 274

Query: 254 VLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTG-GVGDAEYMWAFEQIVM 312
           V  +S+H  E G ++PGT  G   +   GK       +  P   G+ D       ++++M
Sbjct: 275 VQTISVHLHEPG-FFPGT--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIM 326

Query: 313 PMGREFQPDLVIISSGFDAADGDVIGQCHVT-PSCYGHMTHMLKSLARGNLVVVLEGGYN 371
           P  R   P++++I  G D   GD   +  +T      ++ ++++     N+V++  GGYN
Sbjct: 327 PCIRSHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 101/211 (47%), Gaps = 12/211 (5%)

Query: 168 LSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
           +S G  +   + ++EG  +          HHS    + GFC  +++A+    + +     
Sbjct: 174 VSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---G 230

Query: 228 VRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGF 287
           V +I  +D+D+HHG+G +KAF   ++V  +SLH +E G ++P    G  +    GK    
Sbjct: 231 VDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFP--CSGSLEDNSSGKSI-- 285

Query: 288 NCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCY 347
             NI     G+ D+      ++I++P   + QP++++I  G D   GD   +  +  S  
Sbjct: 286 -VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL--SIK 341

Query: 348 GHMTHMLKSLARGNLVVVLEGGYNLDSIAIS 378
           G  + +   + + N  +VL GG   +++ +S
Sbjct: 342 GLTSTITSLIEQFNCHIVLLGGGGYNNLLMS 372

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 88/177 (49%), Gaps = 13/177 (7%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+  + + GFC  ++V +  + + K     + KI  +D+D+HHG+G +KAF   +++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAF-EQIVMPMG 315
           +S+H +E G ++PGT  G      + K       +  P     D  Y+     +IV P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVTPSCYGH-MTHMLKSLARGNLVVVLEGGYN 371
              +P+ +II  G D   GD   +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 11/176 (6%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+  + + GFC  ++V +  + + K     + KI  LD+D+HHG+G +KAF   +++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
           +S+H +E G ++PGT  G  D    GK      NI     G  D+       +I+ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLKH-GCDDSYLNLIASKIINPLID 319

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVTPSCYGH-MTHMLKSLARGNLVVVLEGGYN 371
           +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 20/234 (8%)

Query: 141 MNREVLLKETEKGDSVYFNNDSYMS--AKLSCGGAIEACKAVVEGKVKNALAVVRPPG-H 197
           M RE L     +GD   F   SY+    ++  G  +   K +     +  +AV    G H
Sbjct: 177 MIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDGGRH 233

Query: 198 HSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYV 257
           H+    + GFC  +++ +  + +  N     ++I  +D+D+HHG+G Q++F     V  +
Sbjct: 234 HALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTI 290

Query: 258 SLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGRE 317
           S H FE G ++P T  G   +   GK      NI     GV D       E++++P  + 
Sbjct: 291 SAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LHGVDDMLMNEIVEKVMIPCVKR 343

Query: 318 FQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLA--RGNLVVVLEGG 369
           + P++++I  G D   GD   +  +T   +G + ++LK L    G  VV+L GG
Sbjct: 344 YDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGG 395

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 84/177 (47%), Gaps = 13/177 (7%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+    + GFC  +++A+  + + +     + KI  LD+D+HHG+G ++AF     V  
Sbjct: 224 HHAFKSKASGFCYVNDIAILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQT 280

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPT-GGVGDAEYMWAFEQIVMPMG 315
           +S+H +E G ++PGT  G       G+       +  P   G+ D        ++V+P  
Sbjct: 281 ISIHMYEEG-FFPGT--GTLKDASSGRNI-----VNIPVLHGMDDTFLNEVVNRVVIPCL 332

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVT-PSCYGHMTHMLKSLARGNLVVVLEGGYN 371
               P++VII  G D   GD   +  +T       +  +++     N+V++  GGYN
Sbjct: 333 HNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYN 389

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 19/206 (9%)

Query: 171 GGAIEACKAVVEGKVKNALAVVRPPG-HHSEPESSGGFCLFSNVAVAAKNILKNYPESVR 229
            GA  A    +     +ALAV    G HH+    + GFC  +++A+  + + +   +   
Sbjct: 166 AGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFL 222

Query: 230 KIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNC 289
           ++  +D+D+HHG+G + AF   + V   SLH FE G ++PGT  G    C +      N 
Sbjct: 223 RVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT--GACKNCTD------NS 273

Query: 290 NITWP-TGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYG 348
            +  P   GV D+      + IV P  +   P+++II  G D   GD  G+  +  S +G
Sbjct: 274 VLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHG 331

Query: 349 HMTHMLKSLAR---GNLVVVLEGGYN 371
              ++LK +       + ++  GGYN
Sbjct: 332 LTRNILKLVQAHKFKKIALLGGGGYN 357

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 87/176 (49%), Gaps = 11/176 (6%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+    + GFC  +++ +  + + K   + + K+  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
           +S+H +E G ++P T  G  +    GK    N        GV D        +++ P+  
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGK----NIVNVPLYHGVDDNYMTEIVNELIKPLIE 332

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVTPS-CYGHMTHMLKSLARGNLVVVLEGGYN 371
              P++++I  G D   GD   +  +T S    ++ ++++   + +++++  GGYN
Sbjct: 333 RHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 131/319 (41%), Gaps = 70/319 (21%)

Query: 123 ILEVHSREHLEFLESTTTMNREVLLK-ETEKGDSVYFNNDSYMSAKL------SCGGAIE 175
           +L+VH R+    L        E L K E E  DS + + D Y+S+K       S G    
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDS-WNSGDIYLSSKTIEALQGSIGALET 166

Query: 176 ACKAVVEG----KVKN-ALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRK 230
              ++ EG     V N A  V+RPPGHH    +  GFCL +N  V+ +     Y   +  
Sbjct: 167 GVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITH 224

Query: 231 IMILDWDIHHGNGTQ-------------------------KAFYQDERVLYVSLHRFEAG 265
            ++LD+D+HHG+GTQ                         K F +  RV Y S+H   + 
Sbjct: 225 AVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSF 284

Query: 266 KYYPG-TVQGQYDQCGEGKGEGFNCNI------TWPT----GGVGDAEYMWAFEQI---- 310
               G   +            G + NI       W T      +  ++Y   F +     
Sbjct: 285 PTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFF 344

Query: 311 ------VMPMGREFQPDLVIISSGFDAADGDVIG-QCH---VTPSCYGHMTHMLKSLAR- 359
                 +   G++F+  LV+IS+GFDA++ + +  Q H   V  + Y   T     LA+ 
Sbjct: 345 KNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQM 403

Query: 360 ---GNLVVVLEGGYNLDSI 375
              G ++ VLEGGY+  +I
Sbjct: 404 HSEGKVLSVLEGGYSDKAI 422

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 16/178 (8%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+    + GFC  +++ +  + + KN      ++  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
            SLH FEAG ++PGT  G +  C E        NI     G+ D       + I++P   
Sbjct: 252 CSLHLFEAG-FFPGT--GSFKNCRETNV----VNIPL-FHGLDDESLDEIVDNILIPCVN 303

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSL---ARGNLVVVLEGGYN 371
           +  P++++I  G D   GD   +  +T   +G   ++LK +   +   +V++  GGYN
Sbjct: 304 KHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGGGYN 359

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 118/291 (40%), Gaps = 69/291 (23%)

Query: 153 GDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKN-----ALAVVRPPGHHSEPESSGGF 207
           GD +Y   ++  + + S G       ++ +G+V       A   +RPPGHHS   +  GF
Sbjct: 145 GD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGF 203

Query: 208 CLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ---------------------- 245
           CL +N  +A +     Y   V   +ILD+D+HHG+GTQ                      
Sbjct: 204 CLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYN 261

Query: 246 ---KAFYQDERVLYVSLHRFEAGKYYPGTVQ-GQYDQCGEGKG----------------- 284
              K F +  +V Y S+H   +   +P  +     D+  +                    
Sbjct: 262 EFDKKFAEFPKVGYFSMHDINS---FPTELNYASKDKVKDASTCIMDAHDVNIWNIHLLP 318

Query: 285 ----EGFN--CNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIG 338
               E FN      + T      E+  A +  +   G+ F+  LV++S+GFDA++ + + 
Sbjct: 319 YETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFK-GLVVMSAGFDASEYEQVS 377

Query: 339 -QCH---VTPSCYGHMTHMLKSLAR----GNLVVVLEGGYNLDSIAISALS 381
            Q H   V  S Y   T     LA+    G ++ +LEGGY+  +IA    S
Sbjct: 378 MQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIASGVFS 428

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 90/181 (49%), Gaps = 22/181 (12%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+    + GFC  +++ +  + + K   +   K+  LD+D+HHG+G ++AF   ++V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 257 VSLHRFEAGKYYP--GTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPM 314
           +SLH +E G ++P  G+++G           GF+        G+ D+      +Q+V P+
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFDTVNLPLQHGLTDSFLQGLVDQVVNPL 312

Query: 315 GREFQPDLVIISSGFDAADGDVIGQCHVT----PSCYGHMTHMLKSLARGNLVVVLEGGY 370
            +   P++++I  G D   GD   +  ++      C   +  ++    + +++++  GGY
Sbjct: 313 IQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGGY 369

Query: 371 N 371
           N
Sbjct: 370 N 370

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 133/320 (41%), Gaps = 67/320 (20%)

Query: 120 ADEILEVH-SREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKL--SCGGAIEA 176
           A  +L+VH S    E +E     + ++L  E E  D+ + + D Y+S+K   +  G I A
Sbjct: 107 APHVLKVHGSSWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGA 165

Query: 177 CKAVVEGKVK---------NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
            +  V+   K          A   +RPPGHH    +  GFCL +N  VA +     Y  +
Sbjct: 166 IETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--N 223

Query: 228 VRKIMILDWDIHHGNGTQ------------------------KAFYQDERVLYVSLHRFE 263
           V  +++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 224 VTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDIN 283

Query: 264 AGKYYPG-TVQGQYDQCGEGKGEGFNCNI------TWPTGGVGDAEY------MWA---- 306
           +     G   +              + NI       W T    +  Y      ++A    
Sbjct: 284 SFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADE 343

Query: 307 -FEQIVMPMGREFQP--DLVIISSGFDAADGDVIG-QCH---VTPSCYGHMTHMLKSLAR 359
            F    + M ++ +P   LV+IS+GFDA++ +    Q H   V  S Y   T     LA+
Sbjct: 344 FFRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 360 ----GNLVVVLEGGYNLDSI 375
               G ++ ++EGGY+  +I
Sbjct: 404 MHCHGKVLSLMEGGYSDKAI 423

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 88/178 (49%), Gaps = 15/178 (8%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+  + + GFC  +++ +    I K   +  +++  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGR 316
           +S+H FE G ++P +  G  +   +GK      NI     G+ D        Q+V+P+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPL-AHGLNDEYLNEIVTQVVIPLTD 304

Query: 317 EFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLAR---GNLVVVLEGGYN 371
              P ++II  G D   GD   +  +T    G   ++LK + R    ++V++  GGYN
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 127/320 (39%), Gaps = 67/320 (20%)

Query: 120 ADEILEVH-SREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKL--SCGGAIEA 176
           A  +L+VH S    E +E     + ++L  E E  D+ + + D Y+S+K   +  G I A
Sbjct: 107 APHVLKVHGSHWPTELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIQALQGTIGA 165

Query: 177 CKAVVEGKVK---------NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
            +  V+   K          A   +RPPGHH    +  GFCL +N  VA +     Y   
Sbjct: 166 IETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--D 223

Query: 228 VRKIMILDWDIHHGNGTQ------------------------KAFYQDERVLYVSLHRFE 263
           V  +++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 224 VTHVVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDIN 283

Query: 264 AGKYYPG-TVQGQYDQCGEGKGEGFNCNI------TWPTGG-------------VGDAEY 303
           +     G   +              + NI       W T                  A+ 
Sbjct: 284 SFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADE 343

Query: 304 MWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIG-QCH---VTPSCYGHMTHMLKSLAR 359
            +   ++ M    +    LV+IS+GFDA++ +    Q H   V  S Y   T     LA+
Sbjct: 344 FFKTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 360 ----GNLVVVLEGGYNLDSI 375
               G ++ ++EGGY+  +I
Sbjct: 404 MHCHGKVLSLMEGGYSDKAI 423

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 83/177 (46%), Gaps = 13/177 (7%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLY 256
           HH+    + GFC  +++ +  +++ +   +  +++  +D+D+H+G+G  KAF   E V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 257 VSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPT-GGVGDAEYMWAFEQIVMPMG 315
           +S+H +E G ++PGT  G  ++    K       +  P   G+ D   +     ++ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVL-EGGYN 371
             F  + ++I  G D   GD   +  ++     H    +  + R   V +L  GGYN
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 99/250 (39%), Gaps = 57/250 (22%)

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VE     A   +RPPGHHS   +  GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 241 GNGTQ-------------------------KAFYQDERVLYVSLHRFEAGKYYPG-TVQG 274
           G+GTQ                         K F +  +V Y SLH   +     G   + 
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKE 295

Query: 275 QYDQCGEGKGEGFNCNI--------------------TWPTGGVGDAEYMWAFEQIVMPM 314
                     +  + NI                     + T      EY    +Q +  +
Sbjct: 296 NVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMRAL 355

Query: 315 GREFQPDLVIISSGFDAADGDVIG-QCH---VTPSCYGHMTHMLKSLAR----GNLVVVL 366
           G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G L+ VL
Sbjct: 356 GKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLSVL 414

Query: 367 EGGYNLDSIA 376
           EGGY+  +I+
Sbjct: 415 EGGYSDGAIS 424

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 130/320 (40%), Gaps = 67/320 (20%)

Query: 120 ADEILEVH-SREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKL-----SCGGA 173
           A  +L+VH S    E +E     + ++L  E E  D+ + + D Y+S+K         GA
Sbjct: 107 APHVLKVHGSHWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGA 165

Query: 174 IE-ACKAVVEGKV-----KNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
           IE    ++ EG         A   +RPPGHH    +  GFCL +N  VA +     Y  +
Sbjct: 166 IETGVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--N 223

Query: 228 VRKIMILDWDIHHGNGTQ------------------------KAFYQDERVLYVSLHRFE 263
           V  +++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 224 VTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDIN 283

Query: 264 AGKYYPG-TVQGQYDQCGEGKGEGFNCNI------TWPTGGVGDAEY------MWA---- 306
           +     G   +              + NI       W T    +  Y      ++A    
Sbjct: 284 SFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADE 343

Query: 307 -FEQIVMPMGREFQP--DLVIISSGFDAADGDVIG----QCHVTPSCYGHMTHMLKSLAR 359
            F      M +  +P   LV+IS+GFDA++ +         +V  S Y   T     LA+
Sbjct: 344 FFRSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 360 ----GNLVVVLEGGYNLDSI 375
               G ++ ++EGGY+  +I
Sbjct: 404 MHCHGKVLSLMEGGYSDKAI 423

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 149 ETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGK-----VKNALAVVRPPGHHSEPES 203
           E+     +Y N+D+ M+ K S G       ++  G         A   +RPPGHH     
Sbjct: 141 ESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGM 200

Query: 204 SGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ 245
             GFCL +N  +  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 201 PSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 9/83 (10%)

Query: 302 EYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIG----QCHVTPSCYGHMTHMLKSL 357
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 358 AR----GNLVVVLEGGYNLDSIA 376
           A+    G ++ ++EGGY+  +I 
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAIT 427

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 117/304 (38%), Gaps = 66/304 (21%)

Query: 141 MNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKV-----KNALAVVRPP 195
            N E+ + ++     +Y ++++  + + S G       ++  G         A   +RPP
Sbjct: 134 QNGEIEVPDSWNSGDIYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPP 193

Query: 196 GHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ---------- 245
           GHH    +  GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ          
Sbjct: 194 GHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDICWKRAGFK 251

Query: 246 -----------KAFYQD--------ERVLYVSLHRFEAGKYYPG-TVQGQYDQCGEGKGE 285
                      K  Y D         +V Y S+H   +     G   +           +
Sbjct: 252 PDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIKNASTCVMD 311

Query: 286 GFNCNI------TWPTGGVGDAEYMWAFEQI--------------VMPMGREFQPDLVII 325
             + NI      TW T    +  Y   +  +              +  M + F+  LV+I
Sbjct: 312 AHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKPFK-GLVVI 370

Query: 326 SSGFDAADGDVIG----QCHVTPSCYGHMTHMLKSLAR----GNLVVVLEGGYNLDSIAI 377
           S+GFDA++ +         +V  S Y   T     LA+    G ++ VLEGGY+  +IA 
Sbjct: 371 SAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGGYSDKAIAS 430

Query: 378 SALS 381
              S
Sbjct: 431 GVFS 434

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 13/137 (9%)

Query: 120 ADEILEVHSREHLEFL-----ESTTTMNR-EVLLKETEKGDSVYFNNDSYMSAKLSCGGA 173
           AD +L+VH  +    L     +S   ++R EV + E+     +Y +  +  + + S G  
Sbjct: 108 ADHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGAL 167

Query: 174 IEACKAVVEGKV-----KNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESV 228
                ++  G         A   +RPPGHHS   +  GFCL +N  +A +     Y  +V
Sbjct: 168 ETGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NV 225

Query: 229 RKIMILDWDIHHGNGTQ 245
              ++LD+D+HHG+GTQ
Sbjct: 226 THAVVLDFDLHHGDGTQ 242

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 97/254 (38%), Gaps = 69/254 (27%)

Query: 188 ALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ-- 245
           A   +RPPGHH   ++  GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 246 -----------------------KAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEG 282
                                  K F +  +V Y S+H   +   +P   + QY    E 
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINS---FP--TESQY-ATKEN 296

Query: 283 KGEGFNC-------NI------TWPTGGVGDAEYMWAFEQIVM--------------PMG 315
                 C       NI       W T    D  Y   +  +                 +G
Sbjct: 297 IRNASTCVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALG 356

Query: 316 REFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLA--------RGNLVVVLE 367
           + FQ  LV+IS+GFDA++ +       + +   H   M    A         G ++ ++E
Sbjct: 357 KPFQ-GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIME 415

Query: 368 GGYNLDSIAISALS 381
           GGY+  +IA    S
Sbjct: 416 GGYSDKAIASGVFS 429

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240
           VE     A   +RPPGHHS   +  GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 241 GNGTQ 245
           G+GTQ
Sbjct: 234 GDGTQ 238

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 122/314 (38%), Gaps = 68/314 (21%)

Query: 123 ILEVHS----REHLEFLESTTT--MNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEA 176
           +L+VH     R  LE  +   T   N E+ + +      +Y ++ +  + + S       
Sbjct: 111 VLKVHGNDWPRNLLEICKQADTKLQNNEIEVPDNWNAGDIYLSSKTIEALEGSIAAIETG 170

Query: 177 CKAVVEGK-----VKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKI 231
             ++  G         A   +RPPGHH +  +  GFCL +N  ++ +    +Y   +   
Sbjct: 171 IDSIFNGPSPEHICNRAFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHA 228

Query: 232 MILDWDIHHGNGTQ-------------------------KAFYQDERVLYVSLHRFEAGK 266
           +ILD+D+HHG+GTQ                         K F +  +V Y S+H   +  
Sbjct: 229 VILDFDLHHGDGTQDICWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFP 288

Query: 267 YYPG-TVQGQYDQCGEGKGEGFNCNITW-----PTGGVGDAEYMWA-------------F 307
              G   +           +G + NI W     P     D + ++              F
Sbjct: 289 TETGYATKVNIRNASTCIMDGHDLNI-WNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYF 347

Query: 308 EQIVMPMGREFQP--DLVIISSGFDAADGDVIG----QCHVTPSCYGHMTHMLKSLA--- 358
                 M +E +P   LV+IS+GFDA++ +         +V  + Y   T     LA   
Sbjct: 348 RNAKYQMAQEGKPFKGLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIH 407

Query: 359 -RGNLVVVLEGGYN 371
            +G ++ +LEGGY+
Sbjct: 408 CQGKVLSLLEGGYS 421

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 123 ILEVHSRE-HLEFLESTTTMNREVLLKETEKGDS-----VYFNNDSYMSAKLSCGGAIEA 176
           +L+VH  +   E L+     + ++  K+ E  D      +Y +  +  + + S G     
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGALETG 168

Query: 177 CKAVVEGKVK-----NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKI 231
             ++ +G  +      A   VRPPGHHS   +  GFCL +N  +A +     +  +V   
Sbjct: 169 IDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHA 226

Query: 232 MILDWDIHHGNGTQ 245
           ++LD+D+HHG+GTQ
Sbjct: 227 VVLDFDLHHGDGTQ 240

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 91/213 (42%), Gaps = 35/213 (16%)

Query: 315 GREFQPDLVIISSGFDAADGDVIG-QCH--VTPSCYGHM-THMLKSLAR----GNLVVVL 366
           G++F+  LV+IS+GFDA++ +    Q H    P+C+ +M T     LA+    G ++ V+
Sbjct: 355 GKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKLAQMHTSGKVLSVM 413

Query: 367 EGGYNLDSIAISALSVAKTLIGXXXXXXXXXXXXXXXXALEMIYKVIKIQSKYWKCFKRR 426
           EGGY+  +I+    S    LIG                + +++ ++I+     WK +K +
Sbjct: 414 EGGYSDGAISSGVFS---HLIG-----LQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTK 465

Query: 427 HGNYNIN----------------FSEVASDTLATKTFP-LQTAIRQQQYYNLFKEYDFVK 469
                I                 F ++    +  +  P ++   R Q+  N+  + + V 
Sbjct: 466 KARDVIRIWAEEVIKLGRSMIPEFEDLLFGMVEAQIVPDVKRVTRSQKASNVVAKVNNVA 525

Query: 470 FPTANLKLPDDLILCSPNIHTAETVIIIVHDTP 502
            P ++   P+D  L   N   +E V  +  D P
Sbjct: 526 LPRSDTPTPEDRRLARNN-KPSEAVPFLQQDLP 557

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 15/138 (10%)

Query: 120 ADEILEVH-SREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKL--SCGGAIEA 176
           A  + +VH S    E ++     + ++L  E E  D+ + + D Y+S+K   +  G I A
Sbjct: 107 APHVFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGA 165

Query: 177 CKAVVEGKVK---------NALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPES 227
            +  V+   K          A   +RPPGHH    +  GFCL +N  VA +     Y  +
Sbjct: 166 IETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--N 223

Query: 228 VRKIMILDWDIHHGNGTQ 245
           V  +++LD+D+HHG+GTQ
Sbjct: 224 VTHVVVLDFDLHHGDGTQ 241

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 88/189 (46%), Gaps = 24/189 (12%)

Query: 197 HHSEPESSGGFCLFSNVAVAAKNILKNYPESV---RKIMILDWDIHHGNGTQKAFYQDER 253
           HH+    + GFC  +++ V+  N L+  P      RK+  +D D+HHG+G + AF   + 
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 254 VLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTG-GVGDAEYMWAFEQIVM 312
           +  +S+H FE G +YP T   ++     GK +  N  I  P   G+ ++        I++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 313 PMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLAR----------GNL 362
           P+    Q D ++I  G D  + D   +  +T    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 363 VVVLEGGYN 371
           V++  GGYN
Sbjct: 376 VLLGGGGYN 384

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 144 EVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKN-----ALAVVRPPGHH 198
           E+ + E+     +Y ++ +  + + + G       ++ +G   +     A   +RPPGHH
Sbjct: 135 EIEVPESWNAGDIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHH 194

Query: 199 SEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ 245
               +  GFCL +N  VA +     Y   V  + +LD+D+HHG+GTQ
Sbjct: 195 CHFATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 115/291 (39%), Gaps = 60/291 (20%)

Query: 143 REVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKV-----KNALAVVRPPGH 197
           +EV +  +     +Y ++ +  + + S G    A  ++ +G         A   +RPPGH
Sbjct: 132 KEVEVPASWNAGDIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGH 191

Query: 198 HSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ------------ 245
           H    +  GFCL +N  VA +     +   V    ILD+D+HHG+GTQ            
Sbjct: 192 HCHVATPSGFCLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPD 249

Query: 246 -------------KAFYQDERVLYVSLHRFEAGKYYPG-TVQGQYDQCGEGKGEGFNCNI 291
                        K F +  RV Y S+H   +     G   +              + NI
Sbjct: 250 EEDEDSPGYDSFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTCIMNAHDVNI 309

Query: 292 ------TWPT----GGVGDAEYMWA-------FEQIVMPMGREFQP--DLVIISSGFDAA 332
                  W T      +   +Y          F+Q  + M  + +P   LV+ISSGFDA+
Sbjct: 310 WNIHLSPWETEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDAS 369

Query: 333 DGDVIG-QCHVT--PS-CYGHMTHMLKSLAR----GNLVVVLEGGYNLDSI 375
           + +    Q H T  P+  Y   T     L++    G ++ ++EGGY+  +I
Sbjct: 370 EFEQTSMQRHGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAI 420

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 13/98 (13%)

Query: 159 NNDSYMSAKL--SCGGAIEACKAVVEGKVK---------NALAVVRPPGHHSEPESSGGF 207
           + D Y+S+K   +  G+I A +  V+   K          A   +RPPGHH    +  GF
Sbjct: 144 SGDIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGF 203

Query: 208 CLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ 245
           C+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 204 CVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 188 ALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ 245
           A   +RPPGHHS   +  GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQ 239

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 12/95 (12%)

Query: 302 EYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQ----CHVTPSCYGHMTHMLKSL 357
           E++   ++ +   G+ ++  L+IIS+GFDA++ + +       HV  S Y   T     L
Sbjct: 342 EFLRVSQKRMASEGKNYK-GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKL 400

Query: 358 A----RGNLVVVLEGGYNLDSIAISALSVAKTLIG 388
           A    +G L+ +LEGGY+ D+  +S   V   LIG
Sbjct: 401 AQMHTQGKLLSLLEGGYS-DAALVSG--VFSHLIG 432

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 126/323 (39%), Gaps = 67/323 (20%)

Query: 123 ILEVHSREHLEFL-----ESTTTMNR-EVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEA 176
           +L+VH  E    L     +S + + R EV + +      +Y  + +  + + + G     
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 177 CKAVVEG----KVKNALAV-VRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKI 231
             ++  G     + N + V +RPPGHH    +  GFCL +N  +  +     Y   V   
Sbjct: 166 VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 232 MILDWDIHHGNGTQ------------------------KAFYQDERVLYVSLHRFEAGKY 267
           +ILD+D+HHG+GTQ                        K F +  +V Y S+H   +   
Sbjct: 224 VILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPT 283

Query: 268 YPG-TVQGQYDQCGEGKGEGFNCNI------TWPT----GGVGDAEYMWAFEQI------ 310
             G   +              + NI       W T      +  ++Y   F +       
Sbjct: 284 ESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKN 343

Query: 311 ----VMPMGREFQPDLVIISSGFDAADGDVIG----QCHVTPSCYGHMTHMLKSLA---- 358
               +  +G+ F+  LV+IS+GFDA++ +         +V  S Y   T     LA    
Sbjct: 344 SKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHC 402

Query: 359 RGNLVVVLEGGYNLDSIAISALS 381
           +G ++ +LEGGY+  +I     S
Sbjct: 403 QGKVLSLLEGGYSDKAITSGVFS 425

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 148 KETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALA-----VVRPPGHHSEPE 202
           KE   GD +Y ++ +  + + + G        +  G     ++     VVRPPGHH    
Sbjct: 139 KEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHCHVT 197

Query: 203 SSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQ 245
              GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 198 GPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>Kwal_55.20650 s55 (505162..505776) [615 bp, 204 aa] {ON} YLL033W -
           Hypothetical ORF [contig 142] FULL
          Length = 204

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 5/110 (4%)

Query: 115 VREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVY-FNNDSYMSAKLSCGGA 173
           +RE  +D++L +  R    F+  T  ++R  ++++T      Y F N++Y   +L+ G A
Sbjct: 35  IREYPSDDVLRMCYRR---FMRLTPLISRRSMIRQTYVHYVRYKFKNENYEEKRLASGLA 91

Query: 174 IEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKN 223
           +   K  +  +V N+L        + +  S G   +   + + +KNILKN
Sbjct: 92  VLEAKPCILQQVVNSLNFCLEAVVYVKKGSPGEQAVAEEIRL-SKNILKN 140

>KNAG0F00310 Chr6 (36504..38312) [1809 bp, 602 aa] {ON} Anc_1.54
           YDR506C
          Length = 602

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 19/99 (19%)

Query: 542 DVNIPQSLIYGDE---NPDNYSSLIN--AQEILLFLWDNHIKFLNEVNKIAFIGVGDSVS 596
           +++I +S ++G E   +P    SLIN  AQ+ ++FL +   K+L    K+  +  G S +
Sbjct: 213 NLDILKSSVWGPEGGPDPRVEESLINGSAQDNVVFLLEGSSKYL----KLRVVNTGMSGT 268

Query: 597 GVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLS 635
            ++HLLGH+        +I    D  L  +VP V E+L+
Sbjct: 269 QILHLLGHK--------IIVIETDGVL--IVPFVVETLT 297

>TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {ON}
           Anc_4.133 YLR316C
          Length = 352

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 34/152 (22%)

Query: 75  HPEDPRRI-YRIYKILAENGLIND-TMLSGVDDIGDIMLKIPVREATADEILEVHSREHL 132
           +P D + I Y +   +AENG+  D ++++G+  + D               LEV  R   
Sbjct: 205 NPNDSKNIIYSMDTRVAENGIPTDHSIMNGIKKVAD---------------LEVKRR--- 246

Query: 133 EFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACK----AVVEGKVKNA 188
                   M++  L  E +  D +  N+ +Y+          E C     A+V  ++K  
Sbjct: 247 ------ALMSKSDLSNEHQVNDDIK-NHQTYLCFNFDIYTTHEPCSMCSMALVHSRIK-R 298

Query: 189 LAVVRPPGHHS--EPESSGGFCLFSNVAVAAK 218
           L  ++P       +PES  GFC+ SN  + +K
Sbjct: 299 LIFIKPMVKTGTLKPESGKGFCMHSNKLLNSK 330

>KAFR0B06970 Chr2 (1449791..1452178) [2388 bp, 795 aa] {ON}
           Anc_4.383 YHR204W
          Length = 795

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 596 SGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCW 653
           SG+ HLL H  +++R+++   F+  + LK L  L DE+      +++++FS   HP W
Sbjct: 443 SGIQHLL-HGTSQDRMES---FVLSESLKYLFLLFDENNELHKSRDNVIFSTEAHPFW 496

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 4/64 (6%)

Query: 639 FKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEW 698
           FK  L F+N    C GDKE     K    + RC  +G   T +  F +AT++ L    E 
Sbjct: 241 FKPELSFANYDDTCEGDKELLNGLK---NLYRCTAEGY-ETADLSFTKATEYFLKQLSET 296

Query: 699 SDSE 702
            D E
Sbjct: 297 PDDE 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,747,403
Number of extensions: 3485383
Number of successful extensions: 9173
Number of sequences better than 10.0: 108
Number of HSP's gapped: 9145
Number of HSP's successfully gapped: 117
Length of query: 702
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 585
Effective length of database: 40,065,477
Effective search space: 23438304045
Effective search space used: 23438304045
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)