Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H033102.286ON48848825300.0
NDAI0G006602.286ON49649919200.0
Suva_14.3252.286ON49049118080.0
Skud_14.3072.286ON49049117980.0
YNL022C2.286ON49049217920.0
KNAG0H020002.286ON49850017820.0
CAGL0M06941g2.286ON49249517720.0
Kpol_1003.382.286ON49649817650.0
TPHA0C034002.286ON49449617470.0
SAKL0E07678g2.286ON47748917430.0
NCAS0G037902.286ON49249317350.0
Smik_14.3092.286ON49049117350.0
TDEL0G021702.286ON48448917120.0
TBLA0B069602.286ON50850817010.0
Kwal_27.115322.286ON47948816950.0
KLTH0G10362g2.286ON52949216950.0
KLLA0E08361g2.286ON49149616770.0
Ecym_33252.286ON49648916380.0
ZYRO0A01892g2.286ON46548915920.0
ADL215W2.286ON48449015320.0
ADL254W2.247ON6032221874e-14
CAGL0J10032g2.247ON6192781865e-14
KNAG0I018702.247ON6292001831e-13
TPHA0C031502.247ON6082001831e-13
SAKL0E08624g2.247ON6112221831e-13
KAFR0J009702.247ON6102001822e-13
ZYRO0A01562g2.247ON6172001803e-13
Smik_14.2662.247ON6182221793e-13
TBLA0E038502.247ON6322221794e-13
Skud_14.2712.247ON6192221794e-13
NCAS0G030302.247ON4902001784e-13
Suva_14.2802.247ON6202781785e-13
YNL061W (NOP2)2.247ON6182001785e-13
Kpol_1003.152.247ON6332221776e-13
NDAI0D010502.247ON6252001777e-13
KLLA0F03399g2.247ON6192001777e-13
TDEL0C041502.247ON6142221768e-13
Kwal_23.48412.247ON6272001751e-12
Ecym_32842.247ON6062001741e-12
KLTH0G09460g2.247ON6372001723e-12
ZYRO0G08998g8.171ON6832981624e-11
AFR179C8.171ON7002941616e-11
TDEL0B043908.171ON6733011562e-10
TPHA0H001508.171ON6493011473e-09
Ecym_23538.171ON6902941465e-09
KNAG0D020508.171ON6822971421e-08
Suva_2.978.171ON6702971393e-08
KLTH0H08096g8.171ON6882941393e-08
Smik_2.928.171ON6742971384e-08
NCAS0B043908.171ON6712971374e-08
Skud_2.818.171ON6812971375e-08
NCAS0B056408.171ON6592991375e-08
NDAI0B018308.171ON6862971366e-08
KAFR0B022208.171ON6862971341e-07
TBLA0A087408.171ON6863011341e-07
Kpol_1002.1098.171ON6703001332e-07
SAKL0H19448g8.171ON6912951332e-07
YBL024W (NCL1)8.171ON6842971332e-07
TPHA0C028708.171ON6742971322e-07
NDAI0B029808.171ON6792981303e-07
KNAG0G015108.171ON6662961278e-07
CAGL0K01991g8.171ON6722941152e-05
KLLA0F12562g8.171ON7042981125e-05
Kwal_14.20818.171ON272125810.20
SAKL0F16346gsingletonON379105800.26
TPHA0M019706.360ON29790790.32
YOR170WsingletonOFF10169720.55
Ecym_30036.1ON319102741.5
TDEL0E034905.277ON345109732.2
SAKL0E00660g6.1ON322102713.5
SAKL0D07700g1.376ON683102705.1
CAGL0J06534g8.821ON167061705.9
SAKL0D08712g1.401ON31299679.7
ZYRO0F00308g6.1ON31984679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03310
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   979   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   744   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   701   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   697   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   694   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   691   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   687   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   684   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   677   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   676   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   672   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   672   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   664   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   659   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   657   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   657   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   650   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   635   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   617   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   594   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    77   4e-14
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    76   5e-14
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    75   1e-13
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    75   1e-13
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    75   1e-13
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    75   2e-13
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    74   3e-13
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    74   3e-13
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    74   4e-13
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    74   4e-13
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    73   4e-13
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    73   5e-13
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    73   5e-13
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    73   6e-13
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    73   7e-13
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    73   7e-13
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    72   8e-13
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    72   1e-12
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    72   1e-12
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    71   3e-12
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    67   4e-11
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    67   6e-11
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    65   2e-10
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    61   3e-09
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    61   5e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    59   1e-08
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    58   3e-08
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    58   3e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    58   4e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    57   4e-08
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    57   5e-08
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    57   5e-08
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    57   6e-08
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    56   1e-07
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    56   1e-07
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    56   2e-07
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    56   2e-07
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    56   2e-07
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    55   2e-07
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    55   3e-07
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    54   8e-07
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    49   2e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    48   5e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    36   0.20 
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...    35   0.26 
TPHA0M01970 Chr13 (410065..410958) [894 bp, 297 aa] {ON} Anc_6.3...    35   0.32 
YOR170W Chr15 (651858..652163) [306 bp, 101 aa] {OFF} Dubious op...    32   0.55 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    33   1.5  
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     33   2.2  
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    32   3.5  
SAKL0D07700g Chr4 complement(632735..634786) [2052 bp, 683 aa] {...    32   5.1  
CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} simi...    32   5.9  
SAKL0D08712g Chr4 complement(724741..725679) [939 bp, 312 aa] {O...    30   9.7  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    30   9.9  

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/488 (97%), Positives = 476/488 (97%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVMSKSGILKDIPKKKGKPVYTR            SKQKRIQMGKHPIKLFVLRYKSR
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180
           LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180

Query: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240
           VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE
Sbjct: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240

Query: 241 DKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQISV 300
           DKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQISV
Sbjct: 241 DKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQISV 300

Query: 301 NVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEE 360
           NVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEE
Sbjct: 301 NVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEE 360

Query: 361 MAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLDEK 420
           MAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLDEK
Sbjct: 361 MAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLDEK 420

Query: 421 VKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFF 480
           VKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFF
Sbjct: 421 VKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFF 480

Query: 481 AICFERDI 488
           AICFERDI
Sbjct: 481 AICFERDI 488

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/499 (73%), Positives = 423/499 (84%), Gaps = 16/499 (3%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLEY+EQQ++KGRISGSLQ+LVL+SC KYKLK NPKH+YAV+DSCWKYKP+
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM KSGIL DIPKKKGKP+Y+R            SK KRIQMGKHPIK +VL++KSR
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177
           LHSELV+LKLK KV++LSE+VD  DS+ D+TPVRW RINPLRC    D +AV++EL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
           P+RVE+W  IVPGSIY+DE+IP+L+GIHPQDKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD--VRIFAFEKDPERAKVLQKMIKVAGCS 295
           + +D IIDAC+APGNKTTHVASYMFG+   +D  V+I+AFEKDPERAK+L+KMIKVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 296 KQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDI------ 349
           K I V VGDFTK ATP KF DVTGFIVDPSCSGSGIFGRKY+DSLNRQ+           
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 350 --VDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEE 407
              D+ VPDEQE+  +KE  +L+ RL+KLSSFQFQV+KHAMSFP AK+IVYSTCSIHAEE
Sbjct: 361 TEEDDEVPDEQEDYNKKE--DLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEE 418

Query: 408 NERVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCI 467
           NERV LDLLLD KVKQWGWK+A +ESVIP WPRRG + EF+E+FRD  A +CQ +ADGCI
Sbjct: 419 NERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA-KCQALADGCI 477

Query: 468 RALPREDGGIGFFAICFER 486
           RALPR+DGGIGFFA+CFER
Sbjct: 478 RALPRDDGGIGFFAVCFER 496

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/491 (70%), Positives = 404/491 (82%), Gaps = 7/491 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM K+ IL++IPKKKGKP++ R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177
           LHSE+VKLKLK KVRDLSELV + D  ND+ PVRW RINPL+C PD +   V+ EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
            Q+V++W  +VPGSIYHDE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVD-DVRIFAFEKDPERAKVLQKMIKVAGCSK 296
              D +IDACSAPGNKTTH ASY+F     D  ++I+AFEKDPERAK+LQKMIKVAGCS 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQ-KKTQDIVDNGVP 355
            I VNVGDFTKLATP K   VTGFIVDPSCSGSGIFGRK+ DSLNR+    +D  D+ VP
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAVP 360

Query: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 361 DEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDL 418

Query: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475
           LLD+ V++WGWK+A R  V+P WPRRG V EF+E+FRD +A + Q++A+GCIRALP+EDG
Sbjct: 419 LLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDG 478

Query: 476 GIGFFAICFER 486
           GIGFFA+CF R
Sbjct: 479 GIGFFAVCFVR 489

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/491 (69%), Positives = 398/491 (81%), Gaps = 7/491 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVL+SC+KYKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM K+ IL+DIPKKKGKP+++R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177
           LHSE+VKLKLK KVRDLSE+V + D +ND+ PVRW RINPL+C    D   V+ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
             +V  W  +VPGSIY+DE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296
             +D +IDACSAPGNKTTH ASY+      D+ +RI+AFEKDPERAK+LQKM+KVAGCS 
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV-P 355
            I V VGDFTKLATP K    TGFIVDPSCSGSGIFGRK+ DSLN++K  +   DN V P
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDVIP 360

Query: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 361 DEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418

Query: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475
           LLD+ V++WGWK+A R  VIP WPRRG V EF E+FRD TA   +++A+GCIRALP+EDG
Sbjct: 419 LLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDG 478

Query: 476 GIGFFAICFER 486
           GIGFFA+CFER
Sbjct: 479 GIGFFAVCFER 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/492 (69%), Positives = 400/492 (81%), Gaps = 7/492 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKHIYAVLDSCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM K+ IL+DIPKKKGKP+++R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177
           LHSE+VKLKLK KVR+LSELV + D SND+ PVRW RINPL+C P+     V+ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
             +V+ W  +VPGSIY+DEFIP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVD-DVRIFAFEKDPERAKVLQKMIKVAGCSK 296
              D +ID+CSAPGNKTTH ASY++     D + RI+AFEKDPERAKVLQKMIK+AGCS 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLN-RQKKTQDIVDNGVP 355
            ISVNVGDFTKLATP K+ DVT FIVDPSCSGSGIFGRK+ DS N R+   +D     VP
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIVP 360

Query: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 361 DEQEEFIAKE--ELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418

Query: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475
           LLD+ V++WGWK+A +  VIP WPRRG V EF+E+FRD    + Q++A+GCIRALP+ DG
Sbjct: 419 LLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDG 478

Query: 476 GIGFFAICFERD 487
           GIGFFA+CFERD
Sbjct: 479 GIGFFAVCFERD 490

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/500 (65%), Positives = 409/500 (81%), Gaps = 14/500 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M+FYRDATWVLE IE QD+KG++SGSLQ+LVL SC+++K+KTNPKHIYAV+ SCW+YKPF
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM KS IL ++P+KKG PV+ R            SK KRIQMGKHPIK+FVL+YK+R
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD---ASAVMKELEKKF 177
           L++EL K+K+K KV+DLS+L D+ D +NDITPVRWFR+NPLRC       +V+ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
            ++V+SW+ +VPGSIY+DE+IP LF +HPQDKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD---VRIFAFEKDPERAKVLQKMIKVAGC 294
             +D +IDAC+APGNKTTH+A++MF +   D+   V+I+AFEKDPERA+VL KMIK+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 295 SKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVD--- 351
           SK+I V VGDFTKLATP   P+V G IVDPSCSGSGIFGRKYIDS+N +K  ++  +   
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 352 --NGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENE 409
             + VP  +E+  ++ + NL+ RLSKLSSFQFQ+VK+A+SFP+A ++VYSTCSIHAEENE
Sbjct: 361 ELDAVP--EEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENE 418

Query: 410 RVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFR-DKTASECQEMADGCIR 468
           RV +DLLLD+KVK+ GW++A R  VIP W RRG V EFQ++FR D  +S CQEMADGCIR
Sbjct: 419 RVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIR 478

Query: 469 ALPREDGGIGFFAICFERDI 488
           ALPREDGGIGFFA+CFER +
Sbjct: 479 ALPREDGGIGFFAVCFERTL 498

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 406/495 (82%), Gaps = 11/495 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSK-GRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59
           MEFYRD+TWVLEY+E Q  K GR+SGSLQ++VL+ C++Y++KTNPKHIYA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  FLEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKS 119
           +L+K+M KSG+L  IP+KKGKP +++            SK KRIQMGKHPIK +VL+YK+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCP--DASAVMKELEKKF 177
            L++E VKLK+K K+ DLS++VD  D+++D+TPVRW RINPLR    D   V+ EL+KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
           P RV +W+ I+PGSIY+DEFIP L+GIH  DKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFG---NGLVDDVRIFAFEKDPERAKVLQKMIKVAGC 294
           + +D +IDACSAPGNKTTHVA+++FG   N   D+V+I+AFEKDPERA++LQKMIK AGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 295 SKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV 354
            K I VNVGDFT++ATPSK+ DVTGFI+DPSCSGSGIFGRK +D LN   K  +   + V
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSN---DEV 357

Query: 355 PDEQ--EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVA 412
           PDE   EE  + +N  L+ERLSKL+SFQFQ+V+HAMSFP AK+IVYSTCSIHAEENERV 
Sbjct: 358 PDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVV 417

Query: 413 LDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPR 472
           +DLLLD+KV+ WGW++AK+E V+P W RRGF  EFQE+F DKT  ECQE+ADGC+RALP+
Sbjct: 418 IDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPK 477

Query: 473 EDGGIGFFAICFERD 487
           EDGGIGFFA+CF RD
Sbjct: 478 EDGGIGFFAVCFVRD 492

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/498 (67%), Positives = 402/498 (80%), Gaps = 13/498 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M+FYRD+TWVLEY+E++++K +ISGSLQ LVLKSC+KYK+K+NP+H+YA + SCWK KP+
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM +SGIL DIP KKGKP + R            SK KRIQMGKHPIK ++L+YK+R
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177
           LHSELVKLKLK KVRDLSEL++  +S++DITPVRW RINP+R         +M EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
           P RV  W  IVPG+IYHD++IP LFG+H +DKITSHELYK G++IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296
              D +IDAC+APGNKTTH ASY+ G    D   +I+AFEKDPERAK+LQ MIKVAGCS 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNG--- 353
            I VNVGDFTK+ATP KF +VTGFIVDPSCSGSGIFGRKY+DS+N+ KK +   DNG   
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINK-KKQESSGDNGNQD 359

Query: 354 ----VPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENE 409
               VPDEQEE  + +  +L+ RLSKL+SFQFQVVKHAMSFPKAK+IVYSTCSIHAEENE
Sbjct: 360 DEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENE 419

Query: 410 RVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRA 469
            V +DLLLD+KV++WGWK+A R  VIP WPRRGF +EF ++FRD+   +CQE+ADGCIR 
Sbjct: 420 GVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDED-EKCQELADGCIRV 478

Query: 470 LPREDGGIGFFAICFERD 487
           LP+EDGGIGFFA+CFER+
Sbjct: 479 LPKEDGGIGFFAVCFERN 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/496 (64%), Positives = 403/496 (81%), Gaps = 10/496 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE++E++D+KG+ISGS+QS+VLKSC+ YK+++NPKHIYAV+ SCWKYKP+
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LE +M KSGIL +IPKK GKP + R            SK KRIQMGKHP+K +VL+YK+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCP---DASAVMKELEKKF 177
           L SE+VKL++K K++   +L+ + D +NDITPVRWFRINP+R P       +++ELEKKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
           P RV+ W  I  G+IYHDEFIP LFG+H +DKITSHELYKQG+IIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296
             +D +ID+C+APGNKTTH A+Y+ G    D  ++I AFEKDPERAKVLQKM++ AGC++
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKK----TQDIVDN 352
            I VNVGDFTK+ATP KF +VTGFIVDPSCSGSGIFGRK+ID+LN++K+     +D    
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 353 GVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVA 412
            +P EQ+E   K++ +L+ RLSKL+SFQFQVVKHAM+FPKA+++VYSTCSIHAEENERV 
Sbjct: 361 SIPVEQDEEFSKKD-DLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVV 419

Query: 413 LDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPR 472
           +DLLLDE +K+ GW++A RE VIP WPRRG+V EF+E+FRD    +C+E+A GCIRALP+
Sbjct: 420 IDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPK 478

Query: 473 EDGGIGFFAICFERDI 488
           EDGGIGFFA+CFERDI
Sbjct: 479 EDGGIGFFAVCFERDI 494

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/489 (67%), Positives = 392/489 (80%), Gaps = 14/489 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M  YRDATWV EY+EQ++SKG+I+GSLQ+LVL SC++YKLKTNPKH+YA++ SCWKYKPF
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEK++ KSGILKDIPKKKG+P ++             SK KRIQMGKHPIK FVL++K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD-ASAVMKELEKKFPQ 179
           L +EL KLK+K +V +LS+LV   D SND+TPVRW RINP+RC      V  EL+KKFP 
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVK--DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178

Query: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239
           +V +W  IVPG+IYHDEFIP LFG+HP DKITSHELYK+G+IIIQDRASCFPAHILNPT 
Sbjct: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238

Query: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVR-IFAFEKDPERAKVLQKMIKVAGCSKQI 298
           ED IID+CSAPGNKTTHVA++MF    V   + I AFEKDPERAK LQKMI+VAGC K I
Sbjct: 239 EDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSI 298

Query: 299 SVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQ 358
            V+VGDFTKLA P KF  VTGFIVDPSCSGSGIFGRK ID  N +        N V  E+
Sbjct: 299 EVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK--------NEVLPEE 350

Query: 359 EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLD 418
           E+  E+ + +L+ RL+KLSSFQFQ++KHAMSFP AK++VYSTCSIHAEENERV +DLLLD
Sbjct: 351 EQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD 410

Query: 419 EKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIG 478
           +KV+QWGW++ KR  VIP W RRGFV EFQ++++DK   + QE+ADGCIRALP+EDGGIG
Sbjct: 411 DKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK--QQAQELADGCIRALPKEDGGIG 468

Query: 479 FFAICFERD 487
           FFA+CFERD
Sbjct: 469 FFAVCFERD 477

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/493 (68%), Positives = 393/493 (79%), Gaps = 8/493 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           MEFYRDATWVLE++EQ+D+KGRISGSLQ+LV +SC++YKLK NPKH+YAVLDSCWKYKP+
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM KSGIL +IPK+KGKP+Y+R            SK KRIQMGK PIK +VL++KSR
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180
           LHSELVKLKLK KV++LSELV   DS ND+TPVRW RINPLRC D  A   E++KKFP R
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC-DVEATKLEIQKKFPTR 179

Query: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240
           VE+W  IVPGSIY+DE+IP LFGIHPQDKITSH LYKQG+IIIQDRASCFPAHIL+P   
Sbjct: 180 VENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEN 239

Query: 241 DKIIDACSAPGNKTTHVASYMFGNGLVD-DVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299
           D +ID C+APGNKTTH ASYM      D  ++I+AFEK+PERAK+L KMIKVAGCSK I 
Sbjct: 240 DVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNIK 299

Query: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQD-----IVDNGV 354
           +NVGDFTK+A P K+ DVTGFIVDPSCSGSGIFGRK+IDSLNR+K  +D       D   
Sbjct: 300 INVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDEEE 359

Query: 355 PDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALD 414
               E+    +  +L+ RLSKLSSFQFQVVKHAMSFP AK+IVYSTCSIHAEENERV +D
Sbjct: 360 EVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVID 419

Query: 415 LLLDEKVKQWGWKIAKRESVIPQWPRRG-FVSEFQEIFRDKTASECQEMADGCIRALPRE 473
           L+LD KVKQWGWK+A R  VIP WPRRG      +    D  +S+C+E+A GCIRALPR 
Sbjct: 420 LMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPRS 479

Query: 474 DGGIGFFAICFER 486
           DGGIGFFA+CFER
Sbjct: 480 DGGIGFFAVCFER 492

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/491 (69%), Positives = 399/491 (81%), Gaps = 7/491 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE IE++ +K RISGS+Q+LVLKSC++YKLK+NPKH+YAVLDSCWKYKP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEKVM K+ IL+DIPKKKGKP+++R            SKQKRIQMGKHPIK +VL++KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASA--VMKELEKKF 177
           LHSE+VKLKLK KVR+LSELV + D +ND+ PVRW RINPL+C P+     V+ EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237
             +VE W  +VP SIY+DE+IP LFGIHP DKIT+HELYK G+IIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296
              D +IDACSAPGNKTTH ASY+      D   RI+AFEKDPERAK+LQKMIK+AGCS 
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNG-VP 355
            I V+VGDFTKLATP KF D TGFIVDPSCSGSGIFGRK+ DSLNR+K      DN  VP
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIVP 360

Query: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415
           DEQEE   KE   LQ RL+KLSSFQFQ+VKHAMSFP AK+IVYSTCSIHAEENERV +DL
Sbjct: 361 DEQEEFMAKE--ELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDL 418

Query: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475
           LLD+ V++WGW++A R  VIP WPRRG V EF+E+FR+  A + QE+A+GCIRALP++DG
Sbjct: 419 LLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDG 478

Query: 476 GIGFFAICFER 486
           GIGFFA+CFER
Sbjct: 479 GIGFFAVCFER 489

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/489 (66%), Positives = 394/489 (80%), Gaps = 8/489 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLEY+EQ+D KGR+SGS+Q+LVLKSCQ+YKLK++PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEK+M +S I  DIPKKKGKP+Y+R            SKQKRIQMGK PIK +VL++K+R
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCP--DASAVMKELEKKFP 178
           L+SELVKLKLK KV+ LSE+VD  DSSND+TPVRW RINPLRCP  D   V+KEL KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238
           QRV  W  I  G++Y+DEF+P LFG+HP+DKITSHELY+QG+IIIQDR+SCFPAHILNP 
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 239 LEDKIIDACSAPGNKTTHVASYMFGNGLVDDV-RIFAFEKDPERAKVLQKMIKVAGCSKQ 297
             D +IDAC+APGNKTTHVA+++      +   +I+AFEKDP RA +L+KM  VAGC + 
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQT 300

Query: 298 ISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDE 357
           + ++VGDFTKLA P+ F DVTG IVDPSCSGSGIFGRK +DS N  KK  +  D+ +PDE
Sbjct: 301 VEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTE-TDSEIPDE 359

Query: 358 QEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLL 417
           +E+M   +  N   RLSKL+SFQFQVVKHAMS P AK+IVYSTCSIHAEENERV +DLLL
Sbjct: 360 EEKMVGDDVAN---RLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 418 DEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGI 477
           D  +K+WGWK+A RE VIP+WPRRG V EF+++FRD    +C E+ADGCIRALP+EDGGI
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPV-KCNELADGCIRALPQEDGGI 475

Query: 478 GFFAICFER 486
           GFFA+CF+R
Sbjct: 476 GFFAVCFKR 484

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/508 (63%), Positives = 403/508 (79%), Gaps = 20/508 (3%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLE++E QD KGR+SGSL SLV+KSC+++K+++NPKH+YAV++S WK+KPF
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           +E++M+KSGIL DIPKKKGKP+Y R            SK +RIQMGKHPIK FVL YK+R
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELV----DTGDSSNDITPVRWFRINPLRCP---DASAVMKEL 173
           LHSELVKLKLK KV +L++++    ++ DS++DITPVRW RINP+R P    +  ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 174 EKKFPQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAH 233
            KKF  +V+ W  I PG IY+DE+IP LFGI P DKITSHELYK G+IIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 234 ILNPTLEDKIIDACSAPGNKTTHVASYMFG-----NGLVDDVRIFAFEKDPERAKVLQKM 288
           ILN T +D IIDAC+APGNKTTHVASY+       +   D  R+FAFEKDPER+K+L KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 289 IKVAGCSKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKK-TQ 347
           +K+AGC K + +N GDFTK+ATP K+P+VTGFIVDPSCSGSGIFGRK+ID++N  KK T+
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 348 DIVDNG------VPDEQEEMAE-KENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYST 400
            + D G      +P EQE +AE K   +L+ RLSKLSSFQFQVVKHAMSFP AK+IVYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 401 CSIHAEENERVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQ 460
           CSIHAEENERV +DLLLD+KVK+WGWK+  R   IP W RRG VSEF+++F++  A + +
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 461 EMADGCIRALPREDGGIGFFAICFERDI 488
           ++A+GCIR LP+EDGGIGFFA+CFER+I
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFERNI 508

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/488 (62%), Positives = 385/488 (78%), Gaps = 10/488 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLEY+E+ +S GR++GSLQ+LVL SC+KY LKTNPKH+YA + SCW+Y  F
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LEK++ KS ILKD+PKKKGK ++              +K KRIQMGKHP+K FVL++K+R
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDA-SAVMKELEKKFPQ 179
           L+SELV+LK+K KV DL +L+   D  ND+TPVRWFRINP+RC      VM EL KKFP 
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLK--DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178

Query: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239
           RV+SW+ +VPGSIYHDE+IP LFG+HP DKITSHELYK G+IIIQDRASCFPAHILNP+ 
Sbjct: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238

Query: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299
            D IIDAC+APGNKTTHVA++MF N    +  I AFEKDPERAK L+ M+K AGCSK I+
Sbjct: 239 SDVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGIN 298

Query: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQE 359
           ++VGDFTKLA PS FP+V+GFIVDPSCSGSGIFGR+ ID  N+ ++     +  +P ++E
Sbjct: 299 IHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSRE-----EGALPTQEE 353

Query: 360 EMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLDE 419
           E  E E  +++ RL+KL+SFQF++VK+A+SFP AK++VYSTCSIHAEENER+ +DLLLD 
Sbjct: 354 ERQEIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDS 413

Query: 420 KVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGF 479
           KVK+WGW++ KR   IP WPRRGF  EF+++FR+      +E+A+ CIR  P+EDGGIGF
Sbjct: 414 KVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFRE--GDTAKELAEACIRVAPKEDGGIGF 471

Query: 480 FAICFERD 487
           FA+CFERD
Sbjct: 472 FAVCFERD 479

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 383/492 (77%), Gaps = 14/492 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M FYRDATWVLEY+E  +  GR++GSLQ+LVL SC+KY+LKTNPKHIYA + SCW+Y  F
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           L+K++ +SGILKDIPKKKGK V+              SK KRIQMGKHP+K FVL+YK+R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASA-VMKELEKKFPQ 179
           L SELV+LK+K KV DL +L+   D  ND+TPVRWFR+NP+RC   S  +++EL KKFP 
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLK--DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224

Query: 180 RVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTL 239
           RV SW  I PG IYHDE+IP LFG+HP DKITSHELYK G++IIQDRASCFPAHILN + 
Sbjct: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284

Query: 240 EDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQIS 299
           ED IIDAC+APGNKTTHVA+++F +  V+ VRI AFEKDPERAK L+ MI  AGC+K I 
Sbjct: 285 EDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTKGIE 344

Query: 300 VNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVP---- 355
           V+VGDFT+LA P KFPDVTGFI+DPSCSGSGIFGRK ID  N+ K      D   P    
Sbjct: 345 VHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK-----ADGASPVEEE 399

Query: 356 DEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDL 415
           +++EE  +  + +L+ RL KL+SFQF++VKHAMSFP AK++VYSTCS+HAEENER+ +DL
Sbjct: 400 EKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDL 459

Query: 416 LLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDG 475
           LLD KVK+WGW++ KR  VIP W RRGF  EF+E+FRD+  +  +E+A+ CIR  P+EDG
Sbjct: 460 LLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTA--KELAEACIRVAPKEDG 517

Query: 476 GIGFFAICFERD 487
           GIGFFA+CFERD
Sbjct: 518 GIGFFAVCFERD 529

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/496 (63%), Positives = 388/496 (78%), Gaps = 14/496 (2%)

Query: 1   MEFYRDATWVLEYIEQQDSKG-RISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59
           MEFYRDATWVLE++EQ+ SK  R++GSLQ+LVL SC++YKLKTNP+HIYA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  FLEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKS 119
           +L+K++ KSGIL+D+PKKKGKP++ +            SK KRIQMGKHPIK F+L++++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDA-SAVMKELEKKFP 178
           RL +EL KLK+K KV  LS+L+ T D   D+TPVRW RINP+   +    V+ EL KKFP
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKT-DDGEDVTPVRWIRINPILVKERYDDVLAELNKKFP 179

Query: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238
           QRV SW+ IVPGSIY+DE+IP LFGIHP DKITSHE YK+G+IIIQDRASCFPAHILNP 
Sbjct: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239

Query: 239 LEDKIIDACSAPGNKTTHVASYMFG--NGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSK 296
             D +IDAC+APGNKTTHVA+++FG  +  VD V+I AFEKDPERAK LQ M+  AGC+K
Sbjct: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299

Query: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV-- 354
            + ++VGDFTKL  P  F +VTGFIVDPSCSGSGIFGRK ID +N  K      D     
Sbjct: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359

Query: 355 --PDEQE-EMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERV 411
             P EQE E+ EKE  +L+ RL+KLSSFQ+Q+VKHAMSFP AK+I YSTCSIHAEENERV
Sbjct: 360 VEPVEQEKELFEKEQ-DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERV 418

Query: 412 ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALP 471
            +DLLLD KVK+WGWK+ KR  VIP WPRRG+ SEF+E+F      E +E+A+GCIRALP
Sbjct: 419 VIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRALP 475

Query: 472 REDGGIGFFAICFERD 487
           +EDGGIGFFA+CFERD
Sbjct: 476 KEDGGIGFFAVCFERD 491

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/489 (62%), Positives = 388/489 (79%), Gaps = 8/489 (1%)

Query: 1   MEFYRDATWVLEYIEQQDSKG-RISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59
           MEFYRD++WVLEYIEQ+ SK  RISGSLQ+LVL+SC++YKLKTNPKHIYA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  FLEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKS 119
           +LEK++  SG+L D+P KKG+PV+++            SK KRI MGKHPIK FVL+ + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD-ASAVMKELEKKFP 178
           RL  E  K+ +K KV+ LSELV+  D+  D++PVRW RINP RC      V+KEL KKFP
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRCQGKVDDVLKELRKKFP 191

Query: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238
           ++V+ W  IVPGSIY DE+IP L+G+HP DKITSHELYK+G+IIIQDRASCFPA+ILNPT
Sbjct: 192 KQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPT 251

Query: 239 LEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQI 298
             D +IDACSAPGNKTTH+A+++F +G   DV+I+AFE+D +RA++L+KM+  AGC   I
Sbjct: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCI 311

Query: 299 SVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQ 358
            ++VGDFT+LA P  F DVTGFI+DPSCSGSGIFGR+ +D  N+ K  +  V N V +EQ
Sbjct: 312 QISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEK-VPNEVFEEQ 370

Query: 359 EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLD 418
           +    ++N   + RL+KLSSFQFQ+VKHAMSFP AK++VYSTCSIHAEENERV +DLLLD
Sbjct: 371 DPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD 430

Query: 419 EKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIG 478
           + +KQ+GWK+AKR+SVIP W RRG +SEF+E+F  + A   QE+ADGCIRALP+EDGGIG
Sbjct: 431 QNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGGIG 487

Query: 479 FFAICFERD 487
           FFA+CFER+
Sbjct: 488 FFAVCFERE 496

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/489 (61%), Positives = 378/489 (77%), Gaps = 27/489 (5%)

Query: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60
           M+FYRD+TW+LEY+E ++ KG++SGSLQS VLK+C KYK+K NPKHIYAV+ SCWKY+ +
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKSR 120
           LE++M KSGILK IP+KKGKP ++R            SKQKRIQMGKHPIK +VL+YK+R
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180
           LH+ELVKLK+K KV++LSELVD  D  +D TPVRW RINPL+C D   V+++L KKFP R
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQ-DDGDDATPVRWIRINPLKC-DIPVVVEQLNKKFPHR 178

Query: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240
           V+ W+ + PGSIY+DE++P LFGIHP +KITSH+LYKQG++IIQDRASC PAHILNP  E
Sbjct: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238

Query: 241 DKIIDACSAPGNKTTHVASYMF---GNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQ 297
           D ++DAC+APGNKTTH+A+++    G+      +I AFEK+P RAKVLQKM   AGC   
Sbjct: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298

Query: 298 ISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDE 357
           + ++VGDFT+LA P +F DVT  +VDPSCSGSGIFGRK ++S N              D 
Sbjct: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN--------------DS 344

Query: 358 QEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLL 417
           Q++        LQ+RLSKLSSFQFQVVKHAMS P A++IVYSTCS+HAEENERV +DLLL
Sbjct: 345 QDQ-------KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLL 397

Query: 418 DEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGI 477
           D KVK+WGW+++ R  V+P WPRRG   EF+E+FRD    +CQ +A+ CIRALPREDGGI
Sbjct: 398 DSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDGGI 456

Query: 478 GFFAICFER 486
           GFFA+CF+R
Sbjct: 457 GFFAVCFQR 465

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/490 (58%), Positives = 365/490 (74%), Gaps = 9/490 (1%)

Query: 1   MEFYRDATWVLEYIEQQDS-KGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59
           MEFYRDA+WVLEYIEQ+ + K +++GSL SLVL+S +KYKLK++ +H+YA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  FLEKVMSKSGILKDIPKKKGKPVYTRXXXXXXXXXXXXSKQKRIQMGKHPIKLFVLRYKS 119
           +L++++ KSG+LKD+P+KKG+P + R            SK+KRI MGKHP+K FVL++++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC-PDASAVMKELEKKFP 178
           RL  E  K  +K  V DLS LV   D   D TPVRW R+NP R       V++EL+KKFP
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQ--DEREDATPVRWIRLNPFRIRGQREEVLQELQKKFP 178

Query: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238
           +RV  W  + PGSIY DE++  L+G+HP DKITSHELYK+G+IIIQDRASCFPA IL P 
Sbjct: 179 RRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPG 238

Query: 239 LEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQI 298
             D IIDAC+APGNKTTHVA+++F  G  D  +I AFE+DP+RAK L+KMI  AGC   I
Sbjct: 239 RSDVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDPQRAKTLRKMIATAGCDNAI 298

Query: 299 SVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNR-QKKTQDIVDNGVPDE 357
            V+VGDFT+ A P  F +VTGFIVDPSCSGSGIFGR+ +D+    QK T+      VP+E
Sbjct: 299 EVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPEE 358

Query: 358 QEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLL 417
           +   A K    L+ RL+KLSSFQFQ+VKHAMSFP AK+++YSTCS+HAEENERV +DLLL
Sbjct: 359 ETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDLLL 418

Query: 418 DEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGI 477
           D KV++ GWK+A R  VIP WPRRG  +EF+E+F D    + +E+A GCIR LP+EDGGI
Sbjct: 419 DSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD----QAEELAGGCIRVLPKEDGGI 474

Query: 478 GFFAICFERD 487
           GFFA+CFER+
Sbjct: 475 GFFAVCFERE 484

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 100/222 (45%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 363

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 364 DANKARTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 416

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     +NR +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 417 IGKDQSVKVNRTEK--DFMQ--IPHLQKQLI----------LSAIDSVDSN-SKHGGV-- 459

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EENE V   AL    + K+ + G  I K
Sbjct: 460 ----IVYSTCSVAVEENEAVVDYALRKRPNVKLVETGLAIGK 497

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 118/278 (42%), Gaps = 58/278 (20%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++++D  SAPG KTT++++ M   G V     FA 
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALMKNTGCV-----FAN 379

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + + +R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 380 DANKKRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRVLLDAPCSGTGV 432

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      K  +   
Sbjct: 433 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDANSKKGGV--- 475

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQ 448
               IVYSTCS+  EE+E V   AL    + K+   G +I K           GFVS   
Sbjct: 476 ----IVYSTCSVAVEEDEAVVDYALRKRPNVKLVDTGLQIGK----------EGFVS--- 518

Query: 449 EIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
             FR K      ++     R  P      GFF   F++
Sbjct: 519 --FRGKKFHPSLKLTR---RYYPHTYNVDGFFVAKFQK 551

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 334 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 388

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 389 DANKNRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 441

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      K  +   
Sbjct: 442 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDANSKKGGI--- 484

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 485 ----IVYSTCSVAVEEDEAV 500

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G+ I+Q  +S  P   L+P L ++++D  +APG KTT++++ M   G V     FA 
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGCV-----FAN 371

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 372 DANKARTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 424

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S             
Sbjct: 425 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDANSKTGGF--- 467

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 468 ----IVYSTCSVAVEEDEAV 483

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 101/222 (45%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV-----FAN 370

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC   I  N           +FP V G     ++D  CSG+G+
Sbjct: 371 DANKARTKSLIANIHRLGCHNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 423

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S    V  H+ +  
Sbjct: 424 IGKDQSVKVSRTEK--DFMQ--IPHLQKQLI----------LSAIDS----VDAHSKT-- 463

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EENE V   AL    + K+ + G  I K
Sbjct: 464 -GGVIVYSTCSVAVEENEAVVNYALRKRPNVKLVETGLAIGK 504

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G+ I+Q  +S  P   L+P   ++I+D  SAPG KTT++++ M   G V     FA 
Sbjct: 317 YLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKTTYISALMKNTGCV-----FAN 371

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 372 DANKNRTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 424

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S         +   
Sbjct: 425 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDANSKSGGV--- 467

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 468 ----IVYSTCSVAVEEDEAV 483

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 94/200 (47%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV-----FAN 377

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 378 DANKSRTKSLVANIHRLGCTNTIVCNY-------DAREFPRVIGGFDRILLDAPCSGTGV 430

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S    V  H+ +  
Sbjct: 431 IGKDQSVKVSRTEK--DFMQ--IPHLQKQLL----------LSAIDS----VDSHSKT-- 470

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E+V
Sbjct: 471 -GGIIVYSTCSVAVEEDEQV 489

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 100/222 (45%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 376

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 429

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 430 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGV-- 472

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EE+E V   AL    + K+ + G  I K
Sbjct: 473 ----IVYSTCSVAVEEDEAVIDYALRKRPNVKLVETGLAIGK 510

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 99/222 (44%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++++D  SAPG KTT++++ M   G      IFA 
Sbjct: 336 YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALMKNTGC-----IFAN 390

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 391 DANKARTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 443

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S         +   
Sbjct: 444 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLI----------LSAIDSLDSNSKNGGV--- 486

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               +VYSTCS+  EE+E V   AL    + K+ + G  I K
Sbjct: 487 ----LVYSTCSVAVEEDEAVVDYALRKRPNVKLVETGLAIGK 524

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 100/222 (45%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 377

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 378 DANKSRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 430

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 431 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGV-- 473

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EE+E V   AL    + K+ + G  I K
Sbjct: 474 ----IVYSTCSVAVEEDEAVVNYALRKRPNVKLVETGLAIGK 511

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 248

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 249 DANKNRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 301

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 302 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGV-- 344

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 345 ----IVYSTCSVAVEEDEAV 360

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 117/278 (42%), Gaps = 58/278 (20%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 378

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 379 DANKSRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 431

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 432 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGV-- 474

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQ 448
               IVYSTCS+  EE+E V   AL    + K+ + G  I K           GF S   
Sbjct: 475 ----IVYSTCSVAVEEDEAVVDYALRKRPNVKLVETGLAIGK----------EGFTS--- 517

Query: 449 EIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
             FR K      ++A    R  P      GFF   F++
Sbjct: 518 --FRGKKFHPSVKLAR---RYYPHTYNVDGFFVAKFQK 550

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 376

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 429

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 430 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGV-- 472

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 473 ----IVYSTCSVAVEEDEAV 488

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 99/222 (44%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G+ I+Q  +S  P   L+P   ++++D  +APG KTT++++ M   G V     FA 
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTGCV-----FAN 391

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 392 DANKARTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 444

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+    S+   +  +D +   +P  Q+++           LS + S         +   
Sbjct: 445 IGKD--QSVKSSRTEKDFIQ--IPHLQKQLL----------LSAIDSVDANSKTGGV--- 487

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EE+E V   AL    + K+ + G  I K
Sbjct: 488 ----IVYSTCSVAVEEDEAVVDYALRKRPNVKLVESGLAIGK 525

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGTV-----FAN 383

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 384 DANKNRTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 436

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S      KH     
Sbjct: 437 IGKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDCN-SKHGGI-- 479

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EE+E V
Sbjct: 480 ----IVYSTCSVAVEEDEAV 495

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 90/200 (45%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 373

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 374 DANKARTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 426

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   +P  Q+++           LS + S         +   
Sbjct: 427 IGKDQSVKVSRTEK--DFMQ--IPHLQKQLL----------LSAIDSVDSNSKTGGV--- 469

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  +ENE V
Sbjct: 470 ----IVYSTCSVAVDENEAV 485

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 99/222 (44%), Gaps = 40/222 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGCV-----FAN 373

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  C+G+G+
Sbjct: 374 DANKARTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCTGTGV 426

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
            G+     ++R +K  D +   VP  Q+++           LS + S         +   
Sbjct: 427 IGKDQSVKVSRTEK--DFIQ--VPHLQKQLL----------LSAIDSVDSNSKTGGI--- 469

Query: 392 KAKRIVYSTCSIHAEENERV---ALDLLLDEKVKQWGWKIAK 430
               IVYSTCS+  EE+E V   AL    + K+ + G  I K
Sbjct: 470 ----IVYSTCSVAVEEDEMVVDYALRKRPNVKLVEAGLAIGK 507

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 89/200 (44%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 385

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 386 DANKARTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 438

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
             +     ++R +K  D +   +P  Q+++           LS + S         +   
Sbjct: 439 IAKDQSVKVSRTEK--DFIQ--IPHLQKQLL----------LSAIDSVDANSKTGGV--- 481

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EENE V
Sbjct: 482 ----IVYSTCSVAVEENEAV 497

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 89/200 (44%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCV-----FAN 365

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 366 DANKARTKSLIANIHRLGCTNTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGV 418

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
             +     ++R +K  D +   +P  Q+++           LS + S         +   
Sbjct: 419 IAKDQSVKVSRTEK--DFMQ--IPHLQKQLI----------LSAIDSVDSNSKTGGI--- 461

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EENE V
Sbjct: 462 ----IVYSTCSVAVEENEAV 477

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 88/200 (44%), Gaps = 37/200 (18%)

Query: 216 YKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAF 275
           Y  G  I+Q  +S  P   L+P   ++I+D  +APG KTT++++ M   G V     FA 
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGCV-----FAN 387

Query: 276 EKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG----FIVDPSCSGSGI 331
           + +  R K L   I   GC+  I  N           +FP V G     ++D  CSG+G+
Sbjct: 388 DANKARTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGV 440

Query: 332 FGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFP 391
             +     ++R  K  D +   +P  Q+++           LS + S         +   
Sbjct: 441 IAKDQSVKVSRTDK--DFMQ--IPHLQKQLL----------LSAIDSVDANSKTGGV--- 483

Query: 392 KAKRIVYSTCSIHAEENERV 411
               IVYSTCS+  EENE V
Sbjct: 484 ----IVYSTCSVAVEENEAV 499

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 115/298 (38%), Gaps = 62/298 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L+      ++D C+APG+KT  +  Y+  +       + A + D
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDAD 201

Query: 279 PERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTG---------FIVDPSCSGS 329
            +R+ +L   +K    +  I VN  D          PD T           + D  CSG 
Sbjct: 202 AKRSHMLVHQLKRLNSANLIVVN-HDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGD 260

Query: 330 GIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMS 389
           G   RK ++   R   TQ    NG+                     L + Q  ++   + 
Sbjct: 261 GTM-RKNVNVW-RDWTTQ----NGL--------------------ALHNVQLNILNRGLH 294

Query: 390 FPKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQ 437
             K+  R+VYSTCS++  ENE V     + E +++WG K+             R + I Q
Sbjct: 295 LLKSGGRLVYSTCSMNPIENEAV-----VAEALRKWGGKVRLVDCSDKLPGLVRSNGINQ 349

Query: 438 WPRRGFVSEFQEIFRDKTASEC-----QEMA----DGCIRALPREDGGIGFFAICFER 486
           WP      E +E   D T         +E A    D C+R  P +    GFF    E+
Sbjct: 350 WPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 109/294 (37%), Gaps = 57/294 (19%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P ++L       ++D C+APG+KT  +   +  NG      + A + D
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDAD 205

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPSKFPDVTGF---IVDPSCSGSGIFG 333
             R+ +L   +K    +  I VN     F ++ T     D   F   + D  CSG G   
Sbjct: 206 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTM- 264

Query: 334 RKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPK- 392
           RK I+          +                          L + Q  ++   ++  K 
Sbjct: 265 RKNINVWKDWGTGSGL-------------------------GLHTVQLNILNRGLTLLKN 299

Query: 393 AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESVIPQWPRR 441
             R+VYSTCS++  ENE V    L     ++WG KI             R + I  WP  
Sbjct: 300 GGRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGISSWPVL 354

Query: 442 GFVSEFQEIFRDKTAS--------ECQEMA-DGCIRALPREDGGIGFFAICFER 486
               E +    D T +        E +E   + CIR  P +    GFF   FE+
Sbjct: 355 DKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 117/301 (38%), Gaps = 67/301 (22%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 279 PERAKVLQKMIKVAGCSKQISVN------------VGDFTKLATPSKFPDVTGFIVDPSC 326
            +R+ +L   +K    +  + VN              D +  A   KF  V   + D  C
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVPC 259

Query: 327 SGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKH 386
           SG G             +K  ++  +  P           G L      L + QF ++  
Sbjct: 260 SGDGTM-----------RKNVNVWRDWTP----------QGGL-----GLHTVQFNILNR 293

Query: 387 AMSFPKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI--AKRESVIPQWPRRGF 443
            +   K K R+VYSTCS++  ENE V     + E +++WG KI     E  +P   R   
Sbjct: 294 GLHLLKNKGRLVYSTCSMNPIENEAV-----VAEALRKWGDKIRLVSCEDKLPGLVRSKG 348

Query: 444 VSEFQEIFRDKTASE-------------CQEMA-----DGCIRALPREDGGIGFFAICFE 485
           VS++  I R+ T  E              +E A     + CIR  P +    GFF   FE
Sbjct: 349 VSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFE 408

Query: 486 R 486
           +
Sbjct: 409 K 409

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 118/301 (39%), Gaps = 66/301 (21%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L+      ++D C+APG+KT  +   +  +       + A + D
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDAD 199

Query: 279 PERAKVLQKMIKVAGCSKQISV--------NVGDFTKLATPSKFPDVTGFIVDPSCSGSG 330
            +R+ +L   +K    S  + V        N+   TK A+  +       + D  CSG G
Sbjct: 200 NKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSGDG 259

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          +N N Q  L  L + QF ++   ++ 
Sbjct: 260 TM-RKNVNVW------------------------KNWNTQNALG-LHNVQFNILDRGLTL 293

Query: 391 PK-AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQW 438
            K   ++VYSTCS++  ENE V   +L     ++WG K+             R   +  W
Sbjct: 294 LKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLTTW 348

Query: 439 PRRGFVSEFQEIFR----DKTASEC-----QEMA----DGCIRALPREDGGIGFFAICFE 485
           P      + +E+ R    DK    C     +E++    D C+R  P +    GFF   FE
Sbjct: 349 PVIN--RDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFE 406

Query: 486 R 486
           +
Sbjct: 407 K 407

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 109/294 (37%), Gaps = 57/294 (19%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L    +  ++D C+APG+KT  +   +   G      + A + D
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPSKFPDVTGF---IVDPSCSGSGIFG 333
             R+ +L   +K    +  I VN     F ++ T     D   F   + D  CSG G   
Sbjct: 205 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTM- 263

Query: 334 RKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPK- 392
           RK I+          +                          L + Q  ++   ++  K 
Sbjct: 264 RKNINVWKDWATASGL-------------------------GLHTVQVNILNRGLNLLKD 298

Query: 393 AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQWP-- 439
             R+VYSTCS++  ENE V    L     ++WG KI             R   I QWP  
Sbjct: 299 GGRLVYSTCSLNPIENEAVVAAAL-----RKWGDKIKLVECGDKLPGLIRSQGISQWPVY 353

Query: 440 RRGFVSE------FQEIFRDKTASECQEM-ADGCIRALPREDGGIGFFAICFER 486
            +GF ++          +   T  E  +   + C+R  P +    GFF   FE+
Sbjct: 354 DKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 113/297 (38%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L    +  ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATP---SKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  I VN     F ++ T     K  D+  F   + D  CSG G
Sbjct: 205 NRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++   R   TQ+ +                         L   Q  ++   +  
Sbjct: 265 TM-RKNVNVW-RDWNTQNALG------------------------LHQVQANILNRGLHL 298

Query: 391 -PKAKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQW 438
             K  R+VYSTCS++  ENE V    L     ++WG K+             R   I +W
Sbjct: 299 LKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGISKW 353

Query: 439 P--RRGF--VSEFQEIFRDKTASECQEMA-----DGCIRALPREDGGIGFFAICFER 486
           P   R    + + QE   D      +E A     + CIR  P +    GFF   FE+
Sbjct: 354 PTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 110/297 (37%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKL---ATPSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++      +K  DV  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 265 TM-RKNVNVW------------------------KDWNTQAGLG-LHTVQLNILNRGLHL 298

Query: 391 PK-AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQW 438
            K   R+VYSTCS++  ENE V     + E +++WG KI             R   + +W
Sbjct: 299 LKDGGRLVYSTCSLNPIENEAV-----IAEALRKWGDKIRLVNCDDKLSGLVRSKGVSKW 353

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G     +  F        +     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 103/294 (35%), Gaps = 57/294 (19%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLAT---PSKFPDVTGFIVDPSCSGSGIFG 333
             R+ +L   +K    +  + VN     F ++ T    ++F      + D  CSG G   
Sbjct: 205 ARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM- 263

Query: 334 RKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF-PK 392
           RK ++          +                          L + Q  ++K  ++   K
Sbjct: 264 RKNVNVWKDWGTASGL-------------------------GLHTVQLNILKRGLNLLKK 298

Query: 393 AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESVIPQWP-- 439
             R+VYSTCS++  ENE V    L     +QWG KI             R   I  WP  
Sbjct: 299 GGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPVI 353

Query: 440 -------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
                   +G     +  F            D CIR  P +    GFF    E+
Sbjct: 354 DKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 109/297 (36%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKL---ATPSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++      S   DV  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 265 TM-RKNVNVW------------------------KDWNTQAGLG-LHTVQLNILNRGLHL 298

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQW 438
            K   R+VYSTCS++  ENE V     + E +++WG KI             R   + +W
Sbjct: 299 LKNNGRLVYSTCSLNPIENEAV-----VAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKW 353

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G     +  F        +     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 116/297 (39%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L    +  ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLAT---PSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++       K  D+  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q+ ++   +  
Sbjct: 265 TM-RKNVNVW------------------------KDWNAQGALG-LHTVQWNILNRGLHL 298

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI--AKRESVIPQWPRRGFVSEF 447
            K   R+VYSTCS++  ENE V    L     ++WG KI     +  +P   R   +S++
Sbjct: 299 LKPNGRLVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQW 353

Query: 448 QEIFRD-KTASECQEMA-----------------DGCIRALPREDGGIGFFAICFER 486
             + RD +T ++  E                   D CIR  P +    GFF   FE+
Sbjct: 354 PVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 111/297 (37%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKL---ATPSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++      +K  D+  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 265 TM-RKNVNVW------------------------KDWNTQAGLG-LHTVQLNILNRGLHL 298

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQW 438
            K+  R+VYSTCS++  ENE V     + E +++WG KI             R   + +W
Sbjct: 299 LKSNGRLVYSTCSLNPIENEAV-----IAEALRKWGDKIRLVNCDDKLTGLIRSKGVSKW 353

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G     +  F        +     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 110/299 (36%), Gaps = 64/299 (21%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVVANDSD 198

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPSKFPDVTGF------IVDPSCSGSG 330
             RA +L   +K    +  + VN     F K+   +   + +G       + D  CSG G
Sbjct: 199 SRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGDG 258

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 259 TM-RKNVNVW------------------------KDWNTQNALG-LHNVQLNILNRGLQL 292

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESVIPQW 438
            K   R+VYSTCS++  ENE V    L     ++WG KI             R + I  W
Sbjct: 293 LKDNGRLVYSTCSLNPIENEAVVAAAL-----RKWGNKIKLVDCQNKLQGLVRSNGISHW 347

Query: 439 PRRGFVSEFQEIFRD--KTASECQEMADG---------CIRALPREDGGIGFFAICFER 486
               +  E   I +D   T S   E  D          C+R  P +    GFF   FE+
Sbjct: 348 --SVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 107/297 (36%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--------VGDFTKLATPSKFPDVTGFIVDPSCSGSG 330
            +R+ +L   +K    +  + VN        +   T      +       + D  CSG G
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   ++ 
Sbjct: 265 TM-RKNVNVW------------------------KDWNTQGGLG-LHTVQLNILNRGLNL 298

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESVIPQW 438
            K+  R+VYSTCS++  ENE V     + E +++WG KI             R   I  W
Sbjct: 299 LKSGGRLVYSTCSMNPIENEAV-----VAEALRKWGSKIKLVNCDDKLVGLVRSKGISNW 353

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G     +  F            D CIR  P +    GFF   FE+
Sbjct: 354 PVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 111/297 (37%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L    +  ++D C+APG+KT  +   +  +       + A + D
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVVANDAD 205

Query: 279 PERAKVLQKMIKVAGCSKQISVNV-GDF---TKLATPS-KFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN    F    K++  S K  D+  F   + D  CSG G
Sbjct: 206 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGDG 265

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q+ ++   ++ 
Sbjct: 266 TM-RKNVNVW------------------------KDWNTQSGLG-LHTVQYNILNRGLNL 299

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESVIPQW 438
            K+  R+VYSTCS++  ENE V    L     + WG KI             R   I QW
Sbjct: 300 LKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRSQGISQW 354

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G     +  F            + CIR  P +    GFF    E+
Sbjct: 355 PVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 105/301 (34%), Gaps = 68/301 (22%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN------------VGDFTKLATPSKFPDVTGFIVDPSC 326
             R+ +L   +K    +  + VN            VGD  K     KF  +   + D  C
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDVPC 260

Query: 327 SGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKH 386
           SG G   RK ++                          ++ N Q  L  L + Q+ ++  
Sbjct: 261 SGDGTM-RKNVNVW------------------------KDWNTQAGLG-LHTIQYNILNR 294

Query: 387 AMSFPK-AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIA-----------KRESV 434
            +   K   R+VYSTCS++  ENE V    L     + WG KI             R + 
Sbjct: 295 GLHLLKTGGRLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRSNG 349

Query: 435 IPQWP---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFE 485
           + QWP          +G     +  F              C+R  P +    GFF    E
Sbjct: 350 VTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFITVIE 409

Query: 486 R 486
           +
Sbjct: 410 K 410

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 113/300 (37%), Gaps = 66/300 (22%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKL-----ATPSKFPDVTGF---IVDPSCSG 328
            +R+ +L   +K    +  + VN     F ++     AT  K  DV  F   + D  CSG
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKK--DVLRFDRVLCDVPCSG 262

Query: 329 SGIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAM 388
            G   RK ++                           + N Q  L  L + Q  ++   +
Sbjct: 263 DGTM-RKNVNVW------------------------RDWNTQSGLG-LHTVQLNILNRGL 296

Query: 389 SFPKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIP 436
              K K R+VYSTCS++  ENE V    L     ++WG KI             R   I 
Sbjct: 297 HLLKPKGRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLVRSKGIS 351

Query: 437 QWP---------RRGFVSEFQEIFRDKTASECQEM-ADGCIRALPREDGGIGFFAICFER 486
            WP         ++G  +  +  F   T  E ++     CIR  P +    GFF   FE+
Sbjct: 352 TWPVVDRNMEEKKKGDENTVESWFA-PTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 102/295 (34%), Gaps = 59/295 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTGFI------VDPSCSGSGIF 332
            +R+ +L   +K    +  + VN  D          PD   F+       D  CSG G  
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVN-HDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTM 263

Query: 333 GRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPK 392
            RK ++          +                          L + Q  ++   ++  K
Sbjct: 264 -RKNVNVWRDWGTASGL-------------------------GLHTVQLNILNRGLNLLK 297

Query: 393 -AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQWP- 439
              R+VYSTCS++  ENE V    L     ++WG KI             R   I QWP 
Sbjct: 298 DGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPV 352

Query: 440 --------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
                    +G     +  F        +   + CIR  P +    GFF   FE+
Sbjct: 353 YDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 108/297 (36%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKL---ATPSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++      +   DV  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDG 264

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 265 TM-RKNVNVW------------------------KDWNTQAGLG-LHAVQLNILNRGLHL 298

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQW 438
            K   R+VYSTCS++  ENE V     + E +++WG KI             R   + +W
Sbjct: 299 LKNNGRLVYSTCSLNPIENEAV-----VAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKW 353

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P          +G        F        +     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 107/297 (36%), Gaps = 60/297 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  N       + A + D
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVVANDAD 203

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPSKFPDVTGF------IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++A      D   F      + D  CSG G
Sbjct: 204 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGDG 263

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++ + R   +Q                   G L      L + Q  ++   +  
Sbjct: 264 TM-RKNVN-VWRDWTSQ-------------------GGL-----GLHNIQLNILNRGLHL 297

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI-----------AKRESVIPQW 438
            K K R+VYSTCS++  ENE V     +   +++WG KI             R   I  W
Sbjct: 298 LKPKGRLVYSTCSMNPIENEAV-----IAAALRKWGSKIRVINCDEKLPGLVRSKGIDSW 352

Query: 439 P---------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFER 486
           P         ++G        F      + Q     CIR  P +     FF    E+
Sbjct: 353 PVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 115/298 (38%), Gaps = 61/298 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L+      ++D C+APG+KT  +   +  +G      + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSD 198

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPS-------KFPDVTGFIVDPSCSGS 329
            +R+ +L   +K    +  + VN     F K+   S       ++      + D  CSG 
Sbjct: 199 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSGD 258

Query: 330 GIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMS 389
           G   RK ++                          ++ N Q  L  L + Q  ++   + 
Sbjct: 259 GTI-RKNVNIW------------------------KDWNTQNSLG-LHNVQLNILNRGIQ 292

Query: 390 FPKA-KRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK---RESV--------IPQ 437
             K+  R+VYSTCS+   ENE V     +   +++WG KI     +E +        I +
Sbjct: 293 LLKSGGRLVYSTCSLSPIENEAV-----ISATLRKWGNKIKLVDCKEMLPGLISSPGISK 347

Query: 438 WP----RRGFVSEFQEIFRDKTASECQEMADG-----CIRALPREDGGIGFFAICFER 486
           W         VS+  E  +D      +E A+      CIR  P +    GFF    E+
Sbjct: 348 WEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 104/296 (35%), Gaps = 58/296 (19%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +  +       I A + D
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGIIVANDSD 218

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLATPSKFPDVTG----FIVDPSCSGSGIF 332
             R+ +L   +K    S  + VN     F  + T S   ++T      + D  CSG G  
Sbjct: 219 MRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGTL 278

Query: 333 GRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPK 392
            RK I+  N  +                         Q  L  L   Q  ++   +   +
Sbjct: 279 -RKNINIWNDWR------------------------FQNALG-LHRLQNNILNRGLQLLR 312

Query: 393 -AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQWP- 439
              R+VYSTCS++  ENE V  + L     + W  +++            R   I  WP 
Sbjct: 313 NGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRGISSWPV 367

Query: 440 --------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFFAICFERD 487
                    RG        F      +     + CIR  P +     FF   FE++
Sbjct: 368 IDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEKN 423

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 109/294 (37%), Gaps = 66/294 (22%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KTT +   +  +       + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDAD 202

Query: 279 PERAKVLQKMIKVAGCSKQISVN--VGDFTKLAT---PSKFPDVTGF---IVDPSCSGSG 330
             R+ +L   +K    +  + VN     F ++     PSK      F   + D  CSG G
Sbjct: 203 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGDG 262

Query: 331 IFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSF 390
              RK ++                          ++ N Q  L  L + Q  ++   +  
Sbjct: 263 TM-RKNVNVW------------------------KDWNTQGALG-LHTVQLNILDRGLHL 296

Query: 391 PKAK-RIVYSTCSIHAEENERVALDLLLDEKVKQWGWKIAK-----------RESVIPQW 438
            +   R+VYSTCS++  ENE V     + E +++WG K+             R   I QW
Sbjct: 297 LQNNGRLVYSTCSMNPIENEAV-----VAEALRRWGDKVRLVDCSEKLPGLIRSQGITQW 351

Query: 439 P------------RRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIGFF 480
           P              G ++ +   F        +   + C+R  P +    GFF
Sbjct: 352 PVIDRNMEERKKEDEGMINSW---FPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 115/298 (38%), Gaps = 61/298 (20%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L+      ++D C+APG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVNVG---------DFTKLATPSKFPDVTGFIVDPSCSGS 329
            +R+ +L   +K    +  + VN           D T+ +   +F      + D  CSG 
Sbjct: 205 YKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSGD 264

Query: 330 GIFGRKYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMS 389
           G   RK ++                          ++ N    L  L   Q  +++  ++
Sbjct: 265 GTM-RKNVNVW------------------------KDWNTGSGLG-LHIVQLNILERGLN 298

Query: 390 FPK-AKRIVYSTCSIHAEENERVALDLLLDEKVKQWGWKI--AKRESVIPQWPRRGFVSE 446
             K   ++VYSTCS++  ENE V     +   +++WG K+     +  +P   R   ++E
Sbjct: 299 LLKEGGKLVYSTCSLNPIENEAV-----IAAALRRWGDKVRLVNCDDQLPGLVRSKGITE 353

Query: 447 F-----QEIFRDK------------TASECQEM-ADGCIRALPREDGGIGFFAICFER 486
           +     Q   R+K            TA E ++   + C+R    +    GFF   FE+
Sbjct: 354 WKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVFEK 411

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 51/125 (40%), Gaps = 6/125 (4%)

Query: 219 GRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKD 278
           G I  Q+  S  P  +L       ++D C+APG+KT  +   +          + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVVANDAD 204

Query: 279 PERAKVLQKMIKVAGCSKQISVNV-GDF---TKLATPS-KFPDVTGFIVDPSCSGSGIFG 333
             R+ +L   +K    +  + VN    F    KL   S +F      + D  CSG G   
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM- 263

Query: 334 RKYID 338
           RK ++
Sbjct: 264 RKNVN 268

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 14/105 (13%)

Query: 341 NRQKKTQDIVDNGVP--DEQEEMAE--KENGNLQERLSKLSSFQFQVVKHAMSFPKAKRI 396
            +Q  T  ++DNG+P  DEQ E +E  K NG+   +L  +   +F V+ H++        
Sbjct: 184 TQQDDTSSVLDNGLPLKDEQSESSENYKNNGSHSTQLIAIFVLEFGVLFHSV-------F 236

Query: 397 VYSTCSIHAEENERVALDLLLDEKVKQWGWKIAKRESVIPQWPRR 441
           V  + ++  +E   + + L+  +  +  G      E+    WP +
Sbjct: 237 VGLSLAVAGDEFNTLFIVLIFHQMFEGLGLGARIAET---NWPHK 278

>TPHA0M01970 Chr13 (410065..410958) [894 bp, 297 aa] {ON} Anc_6.360
           YNR040W
          Length = 297

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 9/90 (10%)

Query: 319 GFIVDPSCSGSGIFGR---KYIDSLNRQKKTQDIVDNGVPDEQEEMAEKENGNLQERLSK 375
            F +D   +   +FG    K +DSL R K+  ++ +N     Q+E  EKE  + +  LSK
Sbjct: 199 SFFMDDPRTFDALFGGDSIKSLDSLKRSKQLSNVTNNRTDTYQQE--EKEAEDNKRLLSK 256

Query: 376 LSSFQFQVVK-HAMSFPKAKRIVYSTCSIH 404
           LS  Q Q  K H+ S   AK IV +  S H
Sbjct: 257 LSEKQLQRAKIHSNS---AKSIVQNINSNH 283

>YOR170W Chr15 (651858..652163) [306 bp, 101 aa] {OFF} Dubious
          open reading frame unlikely to encode a protein, based
          on available experimental and comparative sequence
          data; partially overlaps the verified gene LCB4
          Length = 101

 Score = 32.3 bits (72), Expect = 0.55,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 30/69 (43%)

Query: 11 LEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPFLEKVMSKSGI 70
          +EY    D +  IS  L  +V    +K  LK N   IY   +S   Y PFL  V+   GI
Sbjct: 15 MEYKPYSDDRNIISPFLFDVVFLFTKKSFLKENITLIYMDSNSVSIYLPFLSNVLHNMGI 74

Query: 71 LKDIPKKKG 79
          +      KG
Sbjct: 75 ISTCKGSKG 83

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 19/102 (18%)

Query: 210 ITSHELYKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDD 269
           I  + L  QG   I D+A   P+        D +++     GN TT +        L   
Sbjct: 38  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTTRI--------LEKA 78

Query: 270 VRIFAFEKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATP 311
            ++ A E DP  A  L K +      K++ + +GDFTK   P
Sbjct: 79  RKVVAVEFDPRMAAELTKRVHGTAAEKKLEIILGDFTKTELP 120

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 16/109 (14%)

Query: 107 KHPIKLFVLRYKSRLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDA 166
           +H IK    R+    H +L    L+     +SEL  + +++ D  P+      P    D 
Sbjct: 116 RHSIK----RFSHHFHHQLSAPPLRQPSHTMSELPMSFNTTLDRAPL------PKPDTDP 165

Query: 167 SAVMKELEKKFPQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHEL 215
           S VM    +  P+++ S EG+VPG     +F P    I P+D  TSH+ 
Sbjct: 166 SFVMPVQLEAGPEQMSSDEGVVPGY----DFEPNDRDISPRD--TSHQF 208

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 19/102 (18%)

Query: 210 ITSHELYKQGRIIIQDRASCFPAHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDD 269
           I  + L  QG   I D+A   P+        D +++     GN T  +        L   
Sbjct: 39  ILKNPLVAQG---IVDKAQIKPS--------DVVLEVGPGTGNLTVRI--------LEQA 79

Query: 270 VRIFAFEKDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATP 311
            R+ A E DP  A  L K +      K++ + +GDF K   P
Sbjct: 80  RRVVAVEMDPRMAAELTKRVHGTAAEKKLEILLGDFMKTELP 121

>SAKL0D07700g Chr4 complement(632735..634786) [2052 bp, 683 aa] {ON}
           conserved hypothetical protein
          Length = 683

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 172 ELEKKFPQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFP 231
           E +  F   V + E +V G+I  D+ IP    + PQD I    +Y  G +  +      P
Sbjct: 422 EPQVDFKYNVFNSENLVEGNI--DDAIPPHVMMDPQDSI----VYNIGMLDAE------P 469

Query: 232 AHILNPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIF 273
           A +  P +    +D+     N T+    ++F N L  + +I+
Sbjct: 470 ARMTPPVINTSSVDSMKPISNDTSMTDIFLFNNTLKPEEQIY 511

>CAGL0J06534g Chr10 (625604..630616) [5013 bp, 1670 aa] {ON} similar
           to uniprot|P52593 Saccharomyces cerevisiae YML103c
           NUP188 nuclear pore protein
          Length = 1670

 Score = 31.6 bits (70), Expect = 5.9,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 236 NPTLEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCS 295
           +P +   +I+  ++P NKT     Y+FGNGL D++     +K  + A +L   + + G S
Sbjct: 831 DPPVVISLINTITSPKNKTI----YIFGNGLFDELYDHVVQKAYDLANLL---VSIRGVS 883

Query: 296 K 296
           K
Sbjct: 884 K 884

>SAKL0D08712g Chr4 complement(724741..725679) [939 bp, 312 aa] {ON}
           similar to uniprot|P40693 Saccharomyces cerevisiae
           YNL002C
          Length = 312

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 9/99 (9%)

Query: 277 KDPERAKVLQKMIKVAGCSKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKY 336
           K P   K+ QK  K+    + + VN G F KL T   +P +   IV P      + G+  
Sbjct: 138 KGPTAVKIPQKAFKILSLLRLVEVNTGVFVKL-TEQVYPLLK--IVAPYV----VIGKPS 190

Query: 337 IDSLNR--QKKTQDIVDNGVPDEQEEMAEKENGNLQERL 373
           + S+    QK+++ +      D+++E+   +N  ++ERL
Sbjct: 191 LASIRSLIQKRSRILHKRADDDQEKEIVLNDNNIVEERL 229

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 233 HIL-NPTLEDKIIDACSAPGNKTTHVASYMFGN---GLVDDVR-IFAFEKDPERAKVLQK 287
           HIL NP +   I+D      + T        GN    +++ VR  +A E DP  A  L K
Sbjct: 38  HILKNPLVAQGIVDKAQLRPSDTVLEVGPGTGNLTVRILEQVRKAYAVEMDPRMAAELTK 97

Query: 288 MIKVAGCSKQISVNVGDFTKLATP 311
            ++     +++ + +GDF K   P
Sbjct: 98  RVRGTDGERKLEILLGDFIKTDLP 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,090,340
Number of extensions: 2207417
Number of successful extensions: 6968
Number of sequences better than 10.0: 86
Number of HSP's gapped: 7021
Number of HSP's successfully gapped: 105
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)