Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H033002.288ON96696647940.0
NDAI0G006702.288ON96895232560.0
NCAS0G037802.288ON95793531420.0
Suva_14.3242.288ON96889930110.0
KNAG0H019902.288ON97394130040.0
Smik_14.3082.288ON96590129660.0
Skud_14.3062.288ON97090129540.0
YNL023C (FAP1)2.288ON96590129510.0
TDEL0G021902.288ON93690129170.0
TBLA0B059502.288ON99590727810.0
SAKL0E07634g2.288ON97489226790.0
ZYRO0A01936g2.288ON95389426680.0
CAGL0M06919g2.288ON95695626660.0
TPHA0D015302.288ON96290625600.0
Kpol_1039.452.288ON96890025540.0
KLTH0G10406g2.288ON96389925290.0
Kwal_27.115182.288ON95389924850.0
KLLA0E08317g2.288ON92189623850.0
Ecym_33272.288ON92689123060.0
ADL213W2.288ON90889522440.0
NCAS0E036907.304ON31197771.2
CAGL0C00583g3.393ON390147743.1
YOR319W (HSH49)8.797ON213122733.4
CAGL0K06853g6.120ON53742734.7
TBLA0A100106.120ON54243727.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03300
         (966 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1851   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1258   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1214   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1164   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1161   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1147   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1142   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1141   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1128   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1075   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1036   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1032   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1031   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   990   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   988   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   978   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   961   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   923   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   892   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   868   0.0  
NCAS0E03690 Chr5 complement(725712..726647) [936 bp, 311 aa] {ON...    34   1.2  
CAGL0C00583g Chr3 (62224..63396) [1173 bp, 390 aa] {ON} weakly s...    33   3.1  
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    33   3.4  
CAGL0K06853g Chr11 complement(668252..669865) [1614 bp, 537 aa] ...    33   4.7  
TBLA0A10010 Chr1 complement(2461989..2463617) [1629 bp, 542 aa] ...    32   7.7  

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1851 bits (4794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/966 (94%), Positives = 915/966 (94%)

Query: 1   MDDSSADSVDETLNLHTHPDPKSLVLXXXXXXXXXXXXXXXXXXXVLSDNDDMMYYERAI 60
           MDDSSADSVDETLNLHTHPDPKSLVL                   VLSDNDDMMYYERAI
Sbjct: 1   MDDSSADSVDETLNLHTHPDPKSLVLEFSEDDTSSAASSDDEEMDVLSDNDDMMYYERAI 60

Query: 61  QEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNC 120
           QEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNC
Sbjct: 61  QEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNC 120

Query: 121 YHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLR 180
           YHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLR
Sbjct: 121 YHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLR 180

Query: 181 TITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCP 240
           TITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCP
Sbjct: 181 TITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCP 240

Query: 241 ELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYS 300
           ELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYS
Sbjct: 241 ELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYS 300

Query: 301 CQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACC 360
           CQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACC
Sbjct: 301 CQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACC 360

Query: 361 NKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMS 420
           NKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMS
Sbjct: 361 NKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMS 420

Query: 421 CRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRK 480
           CRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRK
Sbjct: 421 CRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRK 480

Query: 481 CHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPH 540
           CHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPH
Sbjct: 481 CHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPH 540

Query: 541 SCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHP 600
           SCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHP
Sbjct: 541 SCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHP 600

Query: 601 NGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNAT 660
           NGE                 HECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNAT
Sbjct: 601 NGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNAT 660

Query: 661 STIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQSATNYDDL 720
           STIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQSATNYDDL
Sbjct: 661 STIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQSATNYDDL 720

Query: 721 QLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNL 780
           QLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNL
Sbjct: 721 QLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNL 780

Query: 781 YAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARL 840
           YAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARL
Sbjct: 781 YAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARL 840

Query: 841 MNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENNGL 900
           MNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENNGL
Sbjct: 841 MNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENNGL 900

Query: 901 IYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENXXXXXXXXXXXXXXXG 960
           IYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN               G
Sbjct: 901 IYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPEERLETPRLETPG 960

Query: 961 LESDDE 966
           LESDDE
Sbjct: 961 LESDDE 966

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1258 bits (3256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/952 (63%), Positives = 726/952 (76%), Gaps = 20/952 (2%)

Query: 10  DETLN-LHTHPDPKSLVLXXXXXXXXXXXXXXXXX-----------XXVLSDNDDMMYYE 57
           D  LN + THPDPKSL+L                                + ++DM YYE
Sbjct: 3   DTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNDEYDQEDEYAAATAADEDMKYYE 62

Query: 58  RAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKC 117
           R IQEIA GDSY+CMICTVEMDYTC+MYACK+C R+FDYDCIREWA+KSTEKT +RIWKC
Sbjct: 63  RTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIWKC 122

Query: 118 PNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPE 177
           PNCYHVNKKVP KNR+TCWCGKVVNPE NPLNPNSCGQTCNA +C+HGC+ ICHLGPHPE
Sbjct: 123 PNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPHPE 182

Query: 178 CLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCG 237
           C R +++ C CGKH + I C+QSK+  G  ++F C++ECGLPLSCGIH CK+KCHSGLCG
Sbjct: 183 CTRMLSITCRCGKHTKDIFCYQSKTFKG-NSKFQCKDECGLPLSCGIHKCKRKCHSGLCG 241

Query: 238 SCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVGVFSCNKIR 295
            CPE LEVNEE    +KCYCG ET+KS  CKD+K P +   S DAEGNKW+GVF+C +IR
Sbjct: 242 VCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIR 301

Query: 296 NVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPT 355
            V+Y C KHSF+E C+APPT+S  K CP+SP LLKTCPCG+TPL  L+KPR  CTDP+PT
Sbjct: 302 TVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPT 361

Query: 356 CEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKC 415
           CE+ CNKPLKCGKH+CPF CH G CMDPC+QI+ + CSC Q  FL PCQF G PHCNIKC
Sbjct: 362 CESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKC 421

Query: 416 ESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKH 475
           ESLMSCRRHRC ERCCSGRP AEKRKKTLFRS D+ DETLVEA+H+CLKECNL+LSCG H
Sbjct: 422 ESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGIH 481

Query: 476 RCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGH 535
           RCQRKCHPGKCPPCLESDSNDLVCPCGKT+VEAPVRCGTKL PC F CIKV+RNE  CGH
Sbjct: 482 RCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGH 541

Query: 536 PPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQ 595
            P+PH+CHPLD+PCPPCTA VFKPCKCGK  +VRT+CFQ DVSCGKICGLPL  C HKC 
Sbjct: 542 TPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCM 601

Query: 596 KVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYV 655
           K CH  G+                 H C + CHG+TEC D PC VS K++C CGRRE+YV
Sbjct: 602 KRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYV 661

Query: 656 TCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE-KEEPENLGTERLQSFAQSA 714
           TC A S I SA   T L+C+EECE+++RHR+L+EAFGI E      +L  ERL+    +A
Sbjct: 662 TCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPTA 721

Query: 715 TNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEI 774
             +++LQLP+TE  L  +++Q  WC+QIEE++ KFMDD SRPSLHFKPMRPPQR+FIHE+
Sbjct: 722 IAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHEL 781

Query: 775 AKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEA 834
           +KA+NLY ESQD EPKRSVF+KKN   TS KP+  LS VLP+YQ FK+LEKERK ++FEA
Sbjct: 782 SKAYNLYCESQDPEPKRSVFIKKN--TTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEA 839

Query: 835 RTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLI 894
           RT+ RL+N+ + +   +    E NG +IK+LS G T+E L   F ++ KSTLIKNPQYL+
Sbjct: 840 RTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLV 899

Query: 895 IEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           +++  +G+IYPE +  IT  V  D   LVGHF+V+ K+  I + VE+C I++
Sbjct: 900 LQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDD 951

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1214 bits (3142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/935 (64%), Positives = 718/935 (76%), Gaps = 14/935 (1%)

Query: 19  PDPKSLVLXXXXXXXXXXXXXXXXXXX----VLSDNDDMMYYERAIQEIAAGDSYICMIC 74
           PDPKSLVL                          D+D M YYERAIQEIA GDSY+CMIC
Sbjct: 12  PDPKSLVLELSDDDSNGESGNSDSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVCMIC 71

Query: 75  TVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPTKNRAT 134
           TVEMDYTC+MYACK+C R+FDY+CIREWALKSTEKT +RIWKCPNCYHVNKKVP KNR T
Sbjct: 72  TVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPT 131

Query: 135 CWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCGKHERQ 194
           CWCGKVVNPE NPLNPNSCGQTCNA  C+HGCSKICHLGPHPEC R IT+KC CGKH + 
Sbjct: 132 CWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKD 191

Query: 195 ISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIK 254
           ISC+QS    G+ ++F C+E CGLPL+CG+H C+KKCHSGLCG CPE+L   E   A I+
Sbjct: 192 ISCYQSSLLRGK-DKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAHIR 250

Query: 255 CYCGLETKKSFPCKDVKAP--TTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVESCVA 312
           CYCG + + +  C+DV  P   +LS++ +G KWVGVF C+ IRNV+Y C +HSFVE C+A
Sbjct: 251 CYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIA 310

Query: 313 PPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKHRCP 372
           PPT+ GTK CPFSP LLKTCPCG+TPL  L + R KCTDP+PTC++ C KPLKCG+H CP
Sbjct: 311 PPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCP 370

Query: 373 FTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTERCCS 432
           F CH GPCMDPC+QIDKK CSC+Q  FL PCQF  +P C  KCESLMSCRRHRCTERCC+
Sbjct: 371 FICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCA 430

Query: 433 GRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPCLES 492
           GRP AE RKK LFRS D+ DE+LVE QH+CLKECNLMLSCGKH+CQRKCHPGKCPPCLES
Sbjct: 431 GRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLES 490

Query: 493 DSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPCPPC 552
           DSNDLVCPCG+T++EAPVRCGTKL PC +PCIKV+R E  CGH P+PH+CHPL++PCPPC
Sbjct: 491 DSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPC 550

Query: 553 TATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGEXXXXXXXXX 612
           TA+VFKPCKCGK DKVRT+CFQ DVSCGKICGLPL  C+H CQK CH  GE         
Sbjct: 551 TASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQIC 610

Query: 613 XXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALITRL 672
                   H CLK CHG T+C D PC VS KI+C CGR+E+YVTC ATSTI SAA  T +
Sbjct: 611 KKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKTHI 670

Query: 673 DCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQSATNYDDLQLPYTEPALVAY 732
           +C+EECE+++RHR+L+EAFGIV+     +L  E+L+  A+ AT +++LQLPY E  L  Y
Sbjct: 671 ECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLSIY 730

Query: 733 TKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRS 792
            KQ  WC+QIEE+L K MDD +RPSLHFKPMRPPQR+FI E AK+FNLYAE+QDREPKRS
Sbjct: 731 AKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPKRS 790

Query: 793 VFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITL--DDTLE 850
           VF+KK +DG+S KP + L D LP+YQ FK+LEKERK K+FEARTT RL+N+    +D + 
Sbjct: 791 VFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQEDNVY 850

Query: 851 ERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIEN--NGLIYPESHNE 908
             K    +G +IK +S G T+E L   F +F  STLI NPQYLII++  + LIYPE++ E
Sbjct: 851 HAK---YSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQE 907

Query: 909 ITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIE 943
           ++ GV  DL+ LVGHF+ I KE  I D VE+C++E
Sbjct: 908 MSAGVERDLETLVGHFDFISKENFIADGVELCDVE 942

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/899 (61%), Positives = 673/899 (74%), Gaps = 8/899 (0%)

Query: 50  NDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEK 109
           +DDM YYERAIQEIA GDSYICMICTVEMDYTC+M+ACKKC R+FDY CIREWALKSTEK
Sbjct: 51  DDDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEK 110

Query: 110 TKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKI 169
           T ++IWKCPNCYH+ KKVPT+NR TCWCGKVVNP+ NPL+PNSCGQTCNAP C+HGCSKI
Sbjct: 111 TVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKI 170

Query: 170 CHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKK 229
           CHLGPHPEC RT+ +KC CGKH + I C+QSK+    +  F C+EECGLPLSCGIH CKK
Sbjct: 171 CHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAM---KKHFDCQEECGLPLSCGIHKCKK 227

Query: 230 KCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVG 287
           KCHSGLCG CPEL+   ++    IKCYCG+ +K S  C +V  P +   S+D  GN+W+G
Sbjct: 228 KCHSGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIG 287

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VF+C  IR V+Y+C KHSF+E C++PPTV+G K CPF P+LLKTCPCGRT L  L+KPR 
Sbjct: 288 VFACKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRK 347

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
            CTDP+PTC + C+KPLKCGKH CPF CH+G CMDPC+Q D   C+C QS FL PC F+ 
Sbjct: 348 HCTDPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQE 407

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
           +PHCNIKCESLMSCRRHRC +RCCSGRP A +RKK +FRS D+ DE+LVEAQH+CLK CN
Sbjct: 408 KPHCNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCN 467

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKTV+ APVRCGTKL  C + CIKV+
Sbjct: 468 LTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVV 527

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           R ES CGH P+PH+CHPLD  CPPCT TVFKPCKCGK+DKVRTVCFQ DVSCG  CG PL
Sbjct: 528 RGESECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPL 587

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             CHH CQK CH                     H C K CHG +EC D PC    KI+C 
Sbjct: 588 SGCHHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCK 647

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKE-EPENLGTER 706
           CGR E  V C A S + S     +LDCNEECE +KR +ELREAFGI E+  E  N   + 
Sbjct: 648 CGRIEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDT 707

Query: 707 LQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPP 766
           L+     AT +++LQLP+TE  L  Y KQ  WC QIE ++ K M D +R SLHFKPMRPP
Sbjct: 708 LKKLVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPP 767

Query: 767 QRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKE 826
           QR+FI E+AKA+NLY+ESQDREP RSVF+KK D+  S +P L L++  P+Y++FK+L+KE
Sbjct: 768 QRHFIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKE 827

Query: 827 RKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886
           RK ++F+ARTTA+L+N  + D   + +  +NNG +++ L NG  ++ L  FF    K TL
Sbjct: 828 RKIQEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTL 887

Query: 887 IKNPQYLIIENN--GLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIE 943
           +  PQYLII++    L+YPE++ E++     D+D+LVGHF+ + KE  + DS+ +C+I+
Sbjct: 888 VVKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSID 946

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/941 (59%), Positives = 681/941 (72%), Gaps = 20/941 (2%)

Query: 19  PDPKSLVLXXXXXXXXXXXXXXXXXXXV---------LSDNDDMMYYERAIQEIAAGDSY 69
           PDPKSLVL                               ++ D+ YYERA++EIA GD Y
Sbjct: 8   PDPKSLVLNFSSDDEDSATEANITYSEEEEEEIATSDTEEDQDLPYYERAVREIAKGDLY 67

Query: 70  ICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWKCPNCYHVNKKVPT 129
            CMICTVEMDYTCKM+AC+KC R+FDYDC+REWA+KST+KT +RIWKCPNCY VNKKVPT
Sbjct: 68  TCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKVPT 127

Query: 130 KNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHPECLRTITMKCDCG 189
           KNR TCWCGKVVNPE NPL+PNSCGQTC+A +CIHGCSKICHLGPHPECLRT ++KC CG
Sbjct: 128 KNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCRCG 187

Query: 190 KHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLCGSCPELLEVNEEK 249
           K  ++I CF++K + GR N F C E C   L CGIH C+K CHSGLCGSCPE L V E  
Sbjct: 188 KATKEIPCFETKGRRGR-NLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEGD 246

Query: 250 CATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCNKIRNVEYSCQKHSFVES 309
             +I CYCG  T+ S  CKDV      S++A G++W+GV++C  IR+VEYSC++HSF E 
Sbjct: 247 DVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSFFEE 306

Query: 310 CVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVPTCEACCNKPLKCGKH 369
           C+APPTV+GTK+CPFSP  LKTC CG+TPL AL K R +C DP+P CE+ C+K LKCGKH
Sbjct: 307 CIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKCGKH 366

Query: 370 RCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIKCESLMSCRRHRCTER 429
            CPF CH+GPCMDPCIQIDK  C+C ++ FL PC F+G PHC +KCESL+SCRRH+C ER
Sbjct: 367 TCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKCAER 426

Query: 430 CCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSCGKHRCQRKCHPGKCPPC 489
           CCSGRP AE+R+K   R  D+NDETL+EA+HVCLK CNL LSCG+H+CQRKCHPGKCPPC
Sbjct: 427 CCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKCPPC 486

Query: 490 LESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVCGHPPVPHSCHPLDQPC 549
           LESDSNDLVCPCGKT+V APVRCGTKL  C  PCIKV+   S CGH P+PH+CHPLDQPC
Sbjct: 487 LESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLDQPC 546

Query: 550 PPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHKCQKVCHPNGEXXXXXX 609
           PPCTATVFKPCKCGK  +VRT+CFQKDVSCG+ CG PL  CHH CQK CH  G+      
Sbjct: 547 PPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQATCK 606

Query: 610 XXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRESYVTCNATSTIDSAALI 669
                      H+C KSCHG   C D  C    KI CPCGR+E  VTC ATST+ S+   
Sbjct: 607 QVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSSLFT 666

Query: 670 TRLDCNEECEVVKRHRELREAFGIVEK-----EEPENLGTERLQSFAQSATNYDDLQLPY 724
            RL+C+EECE   RHR+L+EAFGI +K        E  GT RL+  A  AT +++LQ P+
Sbjct: 667 ERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGT-RLEGLASKATTFEELQFPF 725

Query: 725 TEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFNLYAES 784
           TE  +  Y +Q  WC +IEE L  FMD+  + SLHFKPM+PPQR FI E+AKA+NLY+E+
Sbjct: 726 TESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYSEA 785

Query: 785 QDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNIT 844
           QD EPKRSVF+KKNDDG+S KP   LS++ P+YQ+FK LEKERK + F A+TT  L+N+ 
Sbjct: 786 QDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLINVK 845

Query: 845 LDDTLEERKKF--ENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQY--LIIENNGL 900
           L+D +    +   +NN  +IKN+S G TL+ L   F K+ + TLI+NPQY  L  EN+ +
Sbjct: 846 LNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENSAI 905

Query: 901 IYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCN 941
           +YPE +  I+    ND++ LVGH N IV +  + DS E+C+
Sbjct: 906 VYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCD 946

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/901 (60%), Positives = 672/901 (74%), Gaps = 12/901 (1%)

Query: 50  NDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEK 109
           +DDM YYER+IQEI+ GDSYICMICTVEMDYTC+M+ACK+C R+FDY CIREWA+KSTEK
Sbjct: 47  DDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEK 106

Query: 110 TKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKI 169
           T +RIWKCPNCYHV KKVP  NR TCWCGKVVNP+ NPL+PNSCGQTC+AP+CIHGCSK 
Sbjct: 107 TVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKT 166

Query: 170 CHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKK 229
           CHLGPHPEC R + + C CGKH + I C+QSK+    +  F C+EECGLPLSC +H CK+
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM---KKNFKCQEECGLPLSCSVHNCKR 223

Query: 230 KCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVG 287
           KCH+GLCG CPEL+   +     IKCYCG  ++ S  C + + P +   S+D  GN+W+G
Sbjct: 224 KCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIG 283

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VF+C  IR V++SC+KHSF+E C++PP+V+G K CPF P+LLKTCPCGRT L+ L+KPR 
Sbjct: 284 VFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRK 343

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
            C DP+PTC + C+KPLKCGKH CPF CH+  CMDPC+QID   C+C QS F  PC F+G
Sbjct: 344 HCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQG 403

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
            P CNIKCESLMSCRRHRCT+RCCSGRP A KR+K  FRS D+ DE+LVEA+H+CLK CN
Sbjct: 404 RPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCN 463

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG H+CQRKCHPGKCPPCLESDSNDL+CPCGKTVV APVRCGT+L  C  PCIKV+
Sbjct: 464 LTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVV 523

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           R ES CGH P+PH+CHPL  PCPPCT TVFKPCKCGK+DKVRTVCFQKDVSCG  CGL L
Sbjct: 524 RGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLL 583

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             C H CQK CH  G                  H C K CHG TEC D PCP   KI+C 
Sbjct: 584 HFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCK 643

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGT--- 704
           CGR E  VTC+A S +  A   + LDC+EECE +KR +ELREAFGI  KEE  N+ +   
Sbjct: 644 CGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGI--KEESNNVTSNEL 701

Query: 705 ERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMR 764
           + L+     AT +++L LP+TE  L  Y+KQ  WC QIE +L K MDD +R SLHFKPMR
Sbjct: 702 DALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMR 761

Query: 765 PPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLE 824
           PPQR+FI E+AKA+ LY+ESQDREP RSVF+KK D+GTS KP L L + LP+Y++FK+L+
Sbjct: 762 PPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQ 821

Query: 825 KERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884
           KERK ++F++RTTA+L+N  + D   + +  +NNG +++NL  G T+E L  FF    K 
Sbjct: 822 KERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKH 881

Query: 885 TLIKNPQYLIIENN--GLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942
           TL+ NPQYLI+++    L+YPE++   +     D+++LVGHF+ + KE  + DS+ +C+ 
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCST 941

Query: 943 E 943
           +
Sbjct: 942 D 942

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/901 (60%), Positives = 669/901 (74%), Gaps = 12/901 (1%)

Query: 50  NDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEK 109
           +DD+ YYERAIQEIA GDSYICMICTVEMDYTC+M+ACKKC R+FDY CIREWALKSTEK
Sbjct: 52  DDDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEK 111

Query: 110 TKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKI 169
           T ++IWKCPNCYHV KKVPT+NR TCWCG VVNP+ N L+PNSCGQTCNAP C+HGC KI
Sbjct: 112 TVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKI 171

Query: 170 CHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKK 229
           CHLGPHPEC R + +KC CG+H + I C+QSK+    R RF+C+EECGL LSCG+H CKK
Sbjct: 172 CHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAM---RRRFNCQEECGLSLSCGVHKCKK 228

Query: 230 KCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVG 287
           KCHSGLCGSCPE +  ++     IKCYCG   + S  C + + P +   S+D  GN+W G
Sbjct: 229 KCHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAG 288

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VF+C  IR V+Y+C KHSF+E C++PPT+SG K CPF P+LLKTCPCGRT L  L+KPR 
Sbjct: 289 VFACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRK 348

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
            C DP+PTC + C+KPLKCGKH CPFTCH+G CMDPC+QID   CSC QS F  PC F+ 
Sbjct: 349 HCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQE 408

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
            P CNIKCESLMSCRRHRC +RCCSGRP A +RKK+ FRS D+ DE+LVEA+H+CLK CN
Sbjct: 409 SPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCN 468

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG H+CQRKCHPGKCPPCLESDSNDL+C CGKTVV APVRCGTKL  C  PCIKV+
Sbjct: 469 LTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVV 528

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           R ES CGH P+PH+CHP +  CPPCT TVFKPC+CGK+DKVRTVCFQ DVSCG  CG+PL
Sbjct: 529 RGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPL 588

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             C+H CQK CH  G+                 H C K CHG TEC D PC    KI+C 
Sbjct: 589 SGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCE 648

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERL 707
           CGR +  +TC+A     S    + LDCNEECE +KR +ELREAFG+   E P N+    L
Sbjct: 649 CGRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGV--SEGPNNVIRNEL 706

Query: 708 QSFAQ---SATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMR 764
            + ++    A  +++LQLP+TE  L  Y+KQ  WC QIE +L K MD   R SLHFKPMR
Sbjct: 707 DALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMR 766

Query: 765 PPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLE 824
           PPQR+FIHE+AKA+NLYAESQDREP RSVF+KK D+ TS KP L L++  P+Y++FK+ +
Sbjct: 767 PPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQ 826

Query: 825 KERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884
           KERK ++F+ARTTA+L+N  + D   + +  +NNG +++NL +G T+E L  FF    K 
Sbjct: 827 KERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKH 886

Query: 885 TLIKNPQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942
           TL+ NPQYLI+++  + LIYPE++   +     D+++LVGHF+ + KE  + DS+ +C++
Sbjct: 887 TLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSV 946

Query: 943 E 943
           +
Sbjct: 947 D 947

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/901 (60%), Positives = 668/901 (74%), Gaps = 12/901 (1%)

Query: 50  NDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEK 109
           +DDM YYERAIQEI++GDSY+CMICTVEMDYTC+M+ACK+C R+FDY CIREWALKSTEK
Sbjct: 47  DDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEK 106

Query: 110 TKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKI 169
           T +RIWKCPNCY+V+K+VP KNR TCWCGKVVNP+ NPL+PNSCGQTCNA  C+HGCSKI
Sbjct: 107 TVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKI 166

Query: 170 CHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKK 229
           CHLGPHPEC R + + C CGKH + I C+QSK     +  F+C+E CGLPLSC IHTCKK
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVM---KKNFNCQEVCGLPLSCSIHTCKK 223

Query: 230 KCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVG 287
           KCH GLCG CPE++   +     IKCYCG  T+ +  C + K P +   S+D  GN+W+G
Sbjct: 224 KCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIG 283

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VF+C   R V+YSC+KHSF+ESC++PPT++G K CPF P+ LKTCPCGRT L  L+KPR 
Sbjct: 284 VFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRK 343

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
            C DP+PTC++ C KPLKCGKH CPFTCH+  CM+PC+QID   C+C QS F  PC F+G
Sbjct: 344 HCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQG 403

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
            P CNIKCESLMSCRRHRCT+RCCSGRP A +RKK LFR+ D+ DE+LVEA+H+CLK CN
Sbjct: 404 RPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCN 463

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCG TVV APVRCGTKL  C  PCIKV+
Sbjct: 464 LTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVV 523

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           R ES CGH P+PH+CH LD  CPPCT TVFKPCKCGK+ KVRTVCFQ DVSCG  CG+PL
Sbjct: 524 RGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPL 583

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             C+H CQK CH  G                  HEC K CHG TEC D PC    KI C 
Sbjct: 584 SYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCK 643

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGT--- 704
           CGR +  VTC A S   S    + LDCNEECE +KR +EL+EAFGI  KEE  N  +   
Sbjct: 644 CGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGI--KEETNNFTSNEL 701

Query: 705 ERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMR 764
           + L+     AT +++LQLP+TE AL  Y+KQ  WC QIE +L K MDD +R SLHFKPMR
Sbjct: 702 DALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMR 761

Query: 765 PPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLE 824
           PPQR+FI E+AKA+ LY+ESQDREP RSVF+KK D+G S KP L L++  P+Y++FK+L+
Sbjct: 762 PPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQ 821

Query: 825 KERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884
           KERKA++F+ARTTA+L+N  + DT  + +  + NG +++NL  G T E L  FF    K 
Sbjct: 822 KERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKH 881

Query: 885 TLIKNPQYLIIENN--GLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942
           TL+ NPQYLI+++    L+YPE++   +     D+++LVGHF+ + KE  + DS+ +C+ 
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCST 941

Query: 943 E 943
           E
Sbjct: 942 E 942

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/901 (59%), Positives = 670/901 (74%), Gaps = 8/901 (0%)

Query: 47  LSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKS 106
           + D  DM YYERA+QEIA GD Y+CMICTVEMDYTCKMYAC+ C R+FDY+CIREWALKS
Sbjct: 32  VRDEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKS 91

Query: 107 TEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGC 166
           TEKT +R+WKCPNCY VNK+VP KNR TCWCGK VNP+ NPL+PNSCGQTC+AP+C HGC
Sbjct: 92  TEKTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGC 151

Query: 167 SKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHT 226
           SK CHLGPHP+C+RTIT KC CGKH R+  C+Q+ S  G+ ++F C E CGLPL+CGIH 
Sbjct: 152 SKQCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGK-SQFQCNEVCGLPLACGIHK 210

Query: 227 CKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWV 286
           C++ CHSG+CG CP +L     K   I+CYCGLE + SF CKDV+  + LS+D +G+ W+
Sbjct: 211 CERLCHSGICGPCPAVLNAKSNK-LKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWI 269

Query: 287 GVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPR 346
           G F C+ IR +EY+C++HSFVE C   P++SG   CPFSP LLKTCPCGRT L  L++PR
Sbjct: 270 GAFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPR 329

Query: 347 LKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFE 406
             CT P+P C++ C K L CG+H CPFTCH+GPCMDPCIQI+   CSCH++ +  PCQF+
Sbjct: 330 KSCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFK 389

Query: 407 GEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKEC 466
            +P C+ KCESLMSCRRHRCTERCC GRP AE+R+KT   S ++ DE+ VE++H+CLK+C
Sbjct: 390 EQPRCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDC 449

Query: 467 NLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKV 526
           NL LSCG H+CQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGT+L PC +PCI+V
Sbjct: 450 NLTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRV 509

Query: 527 IRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLP 586
           I+N   CGH P+PH+CHPL++PCP CTA VFKPCKCGK+DKVRT+CFQ DVSCG  CG P
Sbjct: 510 IQNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKP 569

Query: 587 LLTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISC 646
           L  C H CQK CH  GE                 H+C   CHG+ +C D PCP+S KI C
Sbjct: 570 LDNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKC 629

Query: 647 PCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE-KEEPENLGTE 705
            C  +ES++TC A S   S A  T L C+EECE  KRH +LREAFGI    + P    T 
Sbjct: 630 ECEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTA 689

Query: 706 RLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRP 765
            L++ A  A ++++L+LP++EPAL  + KQ  WC QIE +L  FMD+  + SLHFKPMRP
Sbjct: 690 SLENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRP 749

Query: 766 PQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEK 825
            QR+FIHE+AK++NLY ESQDREPKRSVF+KK D+G S KP ++L D LP+YQ FK+ EK
Sbjct: 750 AQRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEK 809

Query: 826 ERKAKQFEARTTARLMN-ITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884
           E+KA++FEA+TT   +N I  ++   ER K  NN   +KN+S G T E L   F    K 
Sbjct: 810 EKKAQRFEAQTTTEFVNFIPKEEPQLERAK--NNAFKLKNVSTGTTKEDLERIFADHLKP 867

Query: 885 TLIKNPQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942
           TL+KNPQ+ I ++  NGLIYPE + EI+  V  DL+ LVGHF+ + KE  IGD +E+C+I
Sbjct: 868 TLVKNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHI 927

Query: 943 E 943
           +
Sbjct: 928 D 928

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/907 (58%), Positives = 663/907 (73%), Gaps = 14/907 (1%)

Query: 46  VLSDND---DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREW 102
           V +DN+   D+MYYERA++EIA GDSY CMICTVEMD+TCKMYAC+ C R+FDYDCIREW
Sbjct: 59  VDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREW 118

Query: 103 ALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVC 162
           ALKST+KT ++ WKCPNCYH +KKVP K+R TCWCGKVVNP+ NPL+PNSCGQTCNA +C
Sbjct: 119 ALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANIC 178

Query: 163 IHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSC 222
            H C K CHLG HPEC + + + C CG+  + I C +S+ Q   ++ F C++ECGL L C
Sbjct: 179 PHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQ---KSIFHCDQECGLTLPC 235

Query: 223 GIHTCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDA 280
           GIH C++KCHSGLCGSCPELL ++E     IKCYCGL + K   CKDV  P++  +SR+ 
Sbjct: 236 GIHKCRRKCHSGLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQ 294

Query: 281 EGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLN 340
           E  +WVG+F C ++R+V Y+C +H FVE C+APPT+  T  CPFSPNLLKTCPCG+T L 
Sbjct: 295 EDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQ 354

Query: 341 ALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFL 400
            +   R KCTDP+PTC+  CNK LKCGKHRCPFTCH G CMDPCIQIDK  C+C +  FL
Sbjct: 355 DMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFL 414

Query: 401 TPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQH 460
            PCQF+G+P C  KCESLMSCRRHRC E CCSGRP AE+RKKT+ RSSD NDETLVEA+H
Sbjct: 415 VPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEH 474

Query: 461 VCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCL 520
           VCLK+CNL LSCG H CQRKCHPG CPPCLESDSNDLVCPCGKTV+ APVRCGT L PC 
Sbjct: 475 VCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCK 534

Query: 521 FPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCG 580
           +PCIKVIR ES CGH P+PHSCH LDQPCP CTA VFKPCKCGK+DKVRT+CFQ+DVSCG
Sbjct: 535 YPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCG 594

Query: 581 KICGLPLLTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPV 640
             CGLPL  C+HKCQK CH  GE                 H C + CH +  C D PC V
Sbjct: 595 LPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTV 654

Query: 641 STKISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE--KEE 698
              + C CGRR+    C++TSTIDS  + + L+C+EEC ++ R  EL+ AFGIV    ++
Sbjct: 655 PVTVVCDCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDD 714

Query: 699 PENLGTERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSL 758
             ++  ER+Q+    A  Y++L+LP+ E  L  Y KQP WC QIE +L KFMD+  + SL
Sbjct: 715 KTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSL 774

Query: 759 HFKPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQ 818
           HFK M+ PQR F+H +A A+ +Y+ESQD EP RSVF+KK  +GTS KP L L + LP+Y+
Sbjct: 775 HFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYE 834

Query: 819 NFKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFF 878
           +FK+++KE+K +++EART   L+N+   +T  ++   + NG +IKNL  G T E L   F
Sbjct: 835 SFKEVQKEKKKQEYEARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIF 893

Query: 879 NKFFKSTLIKNPQYLIIE--NNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDS 936
            +  K TL+K+PQYL+++  ++G I P  + EI+  V  D++ L+G F+ + KE  IGD 
Sbjct: 894 GESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDI 953

Query: 937 VEMCNIE 943
           VE+CNI+
Sbjct: 954 VELCNID 960

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/892 (56%), Positives = 632/892 (70%), Gaps = 15/892 (1%)

Query: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112
           + YYE+ I EI  GDSY CMICT+EMDYTC MYAC +C R++D++CIREWALKS++K+ +
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172
           + WKCPNCY+VN ++P KNR TCWCGKVV+PE NP++PNSCGQTCNAP+C HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232
           GPHPEC+RT  +KC CGKH + + C+QS+ +   +  + C E C L L CG+H C++KCH
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEE---KASYQCGEPCNLLLPCGVHKCQRKCH 224

Query: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCN 292
           SG CG+C E +         I CYCG+ET++   CKDVK+    S++  G  W+GVFSC 
Sbjct: 225 SGPCGNCEETIS------GKIMCYCGMETREQIICKDVKS-VAKSKNKSGEIWIGVFSCA 277

Query: 293 KIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDP 352
            +R+VEYSC  HSF ESC APPT SG   CPFSP LLKTCPCG TPL  L  PR KCTDP
Sbjct: 278 HLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDP 337

Query: 353 VPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCN 412
           +PTCE  CNKPLKCGKH CPF CH+GPCMDPC+ +DK  CSCH   FL PCQF  E HCN
Sbjct: 338 IPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCN 397

Query: 413 IKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSC 472
            KCESLMSCRRHRCTERCCSGR LA KR+KT+F + D  DE+LVEAQH+CLK CNL LSC
Sbjct: 398 TKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSC 457

Query: 473 GKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESV 532
           G H C+RKCHPGKC PCLESDSNDL CPCGKTVV APVRCGTKL PC  PCIK ++ ++V
Sbjct: 458 GIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTV 517

Query: 533 CGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHH 592
           CGHPP+PH CH L+QPCP CTA ++K CKC K +KVRT+CFQ DVSCGKICGLPL  C H
Sbjct: 518 CGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSH 577

Query: 593 KCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRE 652
            C++ CH  G+                 H+C   CH   +C D  C V  K++C CGR+E
Sbjct: 578 TCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKE 637

Query: 653 SYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQ 712
           S + C+A +   S+ L+  L C+++CE  KRHR L EAFGI EK        E L+   +
Sbjct: 638 SILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEK---LTAPVEELRDLVE 694

Query: 713 SATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIH 772
           SA ++D+L LP+TE  L  Y+KQ  WC QIE  L K M D +R SLHFKPM+ PQR FIH
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 773 EIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQF 832
           E+A A+ LY+ESQDREPKRSVF+KK ++ + + P L L + LP+Y +FK+L+KERK K+ 
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKKVENKSHI-PLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 833 EARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQY 892
           E  TT RL N T+DD  +     E N  ++K ++ G+T + LS+   ++ + TLI+NP Y
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 893 LIIENNG-LIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIE 943
             +EN   LIYPE H  I++ V ND+  L  + + I KE+ I + V++  I+
Sbjct: 874 QTLENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKID 925

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/894 (56%), Positives = 631/894 (70%), Gaps = 13/894 (1%)

Query: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112
           MMYYERA++EIA GD+Y+CMICTVEMDYTCKM+AC KC R+FDYDCIREWALKST +T +
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172
           + WKCPNC   + KVP K+R TCWCGKVVNP+ NPL+PNSCGQTC+AP+C HGCSK+CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232
           GPHPEC R I++KC CG+H R + C  S+  SGR  +F+CEE CGL L CG+H C KKCH
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRC--SEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCH 233

Query: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCN 292
           SGLCG C E L    +K A IKCYCGL    S  C DV+     S D +GN W+GVF C 
Sbjct: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCK 293

Query: 293 KIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDP 352
            +R VEY+C +HSFVESC   P++     CPFSPN+L++CPCGRTPLN L + R+KCTD 
Sbjct: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353

Query: 353 VPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCN 412
           +PTCE+ C K L CGKH CP+ CH G CMDPC+Q +K  C C    FL PCQF  +P CN
Sbjct: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413

Query: 413 IKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSC 472
            KCESLMSCRRHRCTE+CCSG+P AE+RKKT F S ++ DE+LVEA+HVCLK CNL L+C
Sbjct: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473

Query: 473 GKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESV 532
           G+H+CQRKCHPG+CPPCLESD NDLVCPCGKTVVEAPVRCGTKL PC + CI V+R+   
Sbjct: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533

Query: 533 CGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHH 592
           CGH P+PH CHP ++ CPPCTA V KPCKCGK+  VRT+CFQ+DVSCG+IC  PL +C H
Sbjct: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593

Query: 593 KCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRE 652
            CQK CH +G                  H+C K CHG   C D PCP S  I C CGR+E
Sbjct: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652

Query: 653 SYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQ 712
           S   C   S   SA++   L C+EECE VKR  +L++A G+ E  +      E   S A 
Sbjct: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDS---SVENTVSNAL 709

Query: 713 SATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIH 772
            A+N+++L LP+ E  L  Y++Q  +C+ IE +L  F+DD  + SLHFKPM+P QR+F+H
Sbjct: 710 VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVH 769

Query: 773 EIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQF 832
           E+AKA+ LY+ESQD EPKRSV++KK  +G S KP++ L + LP+YQ FK+ EKE K +++
Sbjct: 770 ELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRY 829

Query: 833 EARTTARLMNIT--LDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNP 890
           E +    L+N     + T+E  K    NG +I+NL++G   E L   + +  K TL++NP
Sbjct: 830 EMQNVTNLVNFVPKFEPTVELAK---YNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886

Query: 891 QYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942
            Y  +   N  LI+PES++++T     D++ LVGHF+ I KE  IGD VE+C +
Sbjct: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQV 940

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/956 (54%), Positives = 644/956 (67%), Gaps = 19/956 (1%)

Query: 2   DDSSADSVDETLNLHTHPDPKSLVLXXXXXXXXXXXXXXXXXXXVLSDND-----DMMYY 56
           D  +  + DE  +   HPD  SLV+                    LSD D     DM YY
Sbjct: 3   DGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELSEELSDLDEGDEKDMAYY 62

Query: 57  ERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKERIWK 116
           E+A+QEI  GDSY C+ICTVE+DYTCK+YAC+KC R++DY+CIREWA KST K  +++W 
Sbjct: 63  EKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLWA 122

Query: 117 CPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHLGPHP 176
           CPNC++  K +P KNR TCWCG+ VNPE NPLNPNSCGQTCNA +C HGCS+ICHLGPH 
Sbjct: 123 CPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPHQ 182

Query: 177 ECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCHSGLC 236
           EC R +++KC CGK  + I CFQ +  S     F+CE  C   L CGIH C +KCH+GLC
Sbjct: 183 ECTRMMSIKCSCGKVTKDIVCFQRRLYS---KGFNCETVCDKLLPCGIHKCNRKCHTGLC 239

Query: 237 GSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPT--TLSRDAEGNKWVGVFSCNKI 294
           GSCPE + +++     I+CYCG  +K    CKDV+ P     S+D +G +W+GVF C+KI
Sbjct: 240 GSCPETI-ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298

Query: 295 RNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDPVP 354
           R V Y C +HSF E C APP++SG   C FSP  LKTCPCG+  L  LSKPR KCTD +P
Sbjct: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358

Query: 355 TCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCNIK 414
           TC   C K LKCGKH+CPF CH G CMDPC QI+K  C+C Q  F  PC F     CN+K
Sbjct: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418

Query: 415 CESLMSCRRHRCTERCCSGRPLAEKRKKTL-FRSSDINDETLVEAQHVCLKECNLMLSCG 473
           CESLMSCRRHRCTERCC+GRPLAE+R+KT+     D+ DE+ +E  H+CLK+CNL LSCG
Sbjct: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478

Query: 474 KHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESVC 533
            H+C RKCH GKCPPCLESDSNDLVCPCGKT+VEAPVRCGTKL  C +PCI+V+R E+ C
Sbjct: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538

Query: 534 GHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHHK 593
           GH P+PH CHP D PCP CTATVFKPCKCGK  +VRTVCF KDVSCGK+CG  L TC+HK
Sbjct: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598

Query: 594 CQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGRRES 653
           CQK CH  G                  H C K CH   EC D PC    KI+CPCGR E 
Sbjct: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658

Query: 654 YVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTE---RLQSF 710
            VTC   S    A   TR+ C+EEC V++RH +L+EAFGIV+K  P+N   E   RL+  
Sbjct: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDK--PQNTHNEEMARLEQV 716

Query: 711 AQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYF 770
             +A+ + DL LP+TEP +  Y +  NWC  IE  L K +DDN+R SLHFKPMRPPQRYF
Sbjct: 717 ISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYF 776

Query: 771 IHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAK 830
           I E+AKA+NLY+ESQD EP RSVF+KKN DG+S KP L +S+  P+YQ++KKLEKE+K  
Sbjct: 777 IRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQA 836

Query: 831 QFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNP 890
            FE+ TT RL+N T + + E       NG ++ N+    + + L   F  + KSTL+  P
Sbjct: 837 NFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEP 896

Query: 891 QYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           Q+ I+      +IYP  + EI+  V  D++ LV HF+ ++KE L+   VE+CNIEN
Sbjct: 897 QFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIEN 952

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/906 (53%), Positives = 624/906 (68%), Gaps = 17/906 (1%)

Query: 49  DNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTE 108
           ++D ++YYE+ I++I+ GD Y CMICT+EMDYTCKMYAC+ C R+FDY+CI+EWA KS  
Sbjct: 41  EDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSAS 100

Query: 109 KTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSK 168
           KT +++WKCPNC H +K++P +NR TCWCGKV+NP+ N L+PNSCGQTCN   C+HGC  
Sbjct: 101 KTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKN 160

Query: 169 ICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCK 228
            CHLGPH EC    T+KC CG++E+ I C Q K +S + N + C E C LPL+CG+H CK
Sbjct: 161 FCHLGPHGECSVITTLKCKCGRNEKDIFCHQLK-KSNKNNVYQCNEVCQLPLACGVHKCK 219

Query: 229 KKCHSGLCGSCPELL--------EVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDA 280
           + CHSGLCG+CPE+L        E NE +    KCYCG  +K    CK +    T S+++
Sbjct: 220 RVCHSGLCGACPEILSSEQIQSVESNENR--KFKCYCGENSKNEIMCKKLAITGTFSKNS 277

Query: 281 EGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLN 340
           EG+KW+G F+C   R V Y+C +HSF+E C A  ++SG K CP++P LL +CPCG+T L 
Sbjct: 278 EGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLK 337

Query: 341 ALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFL 400
            L++ R KCTDP+PTCE  C K LKCGKH CP+ CHNG CMDPCIQ++   CSC Q  FL
Sbjct: 338 QLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFL 397

Query: 401 TPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQH 460
            PC FE  P C  KCESLMSCRRHRC ++CC+G+P A+KRKK L    ++NDE+LVEA H
Sbjct: 398 VPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVH 457

Query: 461 VCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCL 520
           +CLKECNL LSCG H C RKCHPG+CP CL SDSNDLVCPCGKTV+EAPVRCG+KL PC 
Sbjct: 458 ICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCP 517

Query: 521 FPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCG 580
           F CIKVI     CGH P PH CHP  +PCPPCTA V +PCKCGK   V+ VCFQ+  SCG
Sbjct: 518 FECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCG 577

Query: 581 KICGLPLLTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPV 640
           +IC   L  CHHKCQ  CH  G+                 H+C   CHGS+ C D PC  
Sbjct: 578 EICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNE 637

Query: 641 STKISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPE 700
            TK+SC CGR++ Y  C AT   +S+A I  L C+E+CE   RH +LR+AFG     +  
Sbjct: 638 VTKVSCKCGRKQEYRKCYATLD-NSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTS 696

Query: 701 NLGTERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHF 760
           N   + +QS  +  + Y++L+LPY +  +  Y+KQ  WC QIE++L KF+ D ++ +LHF
Sbjct: 697 NKNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHF 756

Query: 761 KPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNF 820
           KPM+P QR+F+ E++ +FNLY+ESQD EPKRSVF+K+  D  +  P + L +VLP++  F
Sbjct: 757 KPMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGF 814

Query: 821 KKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNK 880
           KKLEKERK + FE+ +  + +N    + + +    + NG  IK +S GIT E LSE F K
Sbjct: 815 KKLEKERKIQHFESTSQRKYINYEPKEVIVKSSN-DTNGFFIKKISPGITEEDLSEVFGK 873

Query: 881 FFKSTLIKNPQYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVE 938
             KSTLIKN  Y I+   ++ +IYPE +N IT+ V+ DL++LVGHF+ I KE LI DS+ 
Sbjct: 874 ALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIM 933

Query: 939 MCNIEN 944
           +CN+E 
Sbjct: 934 LCNVEG 939

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/900 (54%), Positives = 622/900 (69%), Gaps = 15/900 (1%)

Query: 50  NDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEK 109
           N+D+M+YERAI++IA GD Y CMICT+E+D T KMYAC  C R+FDYDCIREWA+KS++K
Sbjct: 63  NEDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQK 122

Query: 110 TKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKI 169
           + +++WKCPNC H + K+P +NR TCWCGK VNP+ NP  PNSCGQTCNA  CIH CS  
Sbjct: 123 SLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHF 182

Query: 170 CHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKK 229
           CHLGPHP+C RT T+ C+CGKH + + C+       R  +F+C E+C + LSCGIH C +
Sbjct: 183 CHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSR 242

Query: 230 KCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVG 287
            CHSG CG CPEL+         + CYCG  T     C +VK   +   S+D EGN W+G
Sbjct: 243 VCHSGSCGPCPELIT------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIG 296

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VF CNKIR VEY+C+ HSF E+C +PPT+SGTK CP+SP LLKTCPCG+T L+     R 
Sbjct: 297 VFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQ 356

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
           KCTDP+ TCE  C+KPLKCGKH+CPFTCHNGPCMDPC QI+ + CSC+   F  PCQF  
Sbjct: 357 KCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHE 416

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
           +P CN+KCESLMSCRRHRCT RCCSG+P+A+KRKK LF  +D+ DE+LVEA+H+CLK+CN
Sbjct: 417 KPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCN 476

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG H C RKCH GKCPPCLESDS+DLVCPCGKTVVEAPVRCGTKL  C+FPCIK I
Sbjct: 477 LKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYI 536

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
                CGH P  H CHP D PCPPCT  VFKPCKCGK  K + +CFQ+  SCGK+C   L
Sbjct: 537 EGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKL 596

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             CHH CQ  CH  GE                 H C + CHG + C D PC V  ++ C 
Sbjct: 597 DGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCG 656

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERL 707
           CGRR+  + C ATST  S  L   L C++ C   +R  ELR AFG+    E      ERL
Sbjct: 657 CGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERL 716

Query: 708 QSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQ 767
           +   +  T+Y++L+LP++E  L  Y+KQ NWC QIEEL+ KF++D ++PSLHFKPM  PQ
Sbjct: 717 KKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQ 776

Query: 768 RYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKER 827
           R FIH + +A+ +Y+ESQDREPKRSV+LKKN    +  P + L + LP+YQ++KK+EKER
Sbjct: 777 RNFIHALVEAYEMYSESQDREPKRSVYLKKNK--YTRIPNISLEEALPLYQSYKKIEKER 834

Query: 828 KAKQFEARTTARLMNIT-LDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886
           K + FE++     +N    + +L    K+  NG +IK ++ G T + L+  F    K TL
Sbjct: 835 KVQSFESKKNVTYLNYQPPERSLTPDVKY--NGFLIKGITFGTTTDDLNTLFGVHLKPTL 892

Query: 887 IKNPQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           IK+ QY I+ +  + ++YP+ +  I++ V  D++ L GHF+ + KE ++G+SVEMCNI +
Sbjct: 893 IKDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITD 952

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/899 (52%), Positives = 607/899 (67%), Gaps = 17/899 (1%)

Query: 48  SDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKST 107
            D  D  YYE+ I+EIA GD Y CMICTVEMD+TC MYAC +C R+FDY+CIREWA+KST
Sbjct: 56  GDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKST 115

Query: 108 EKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCS 167
           +K+  + WKCPNCY   K VP KNR TCWCGK ++PE NPLNPNSCGQTC+AP+C+HGCS
Sbjct: 116 QKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCS 175

Query: 168 KICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTC 227
             CHLGPHP C+R +  KC CGK  + + C +++     +  F C   CGL L CG+H C
Sbjct: 176 STCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKH---QELFRCGNPCGLTLPCGVHKC 232

Query: 228 KKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVG 287
           +++CH+G+CG CPE +         I CYCGLE+  S  C+DVK  +  S+D  G KW+G
Sbjct: 233 QRECHNGVCGECPETIA------KEINCYCGLESLPSIKCQDVKIQSK-SQDGSGKKWIG 285

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
            F+C++IR VEYSC++HSF E C APP+++G   CP+SP  LKTCPCG TPL  +  PR 
Sbjct: 286 AFACSRIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRT 345

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
           KCTDP+PTC+A C K L CG+HRCPF CH G CM+ C   DK  CSC+   F+ PC+F+G
Sbjct: 346 KCTDPIPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQG 405

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
            P CN KCESLMSCRRHRC ERCC GR LA+ R+K +F + D  DE+LVEAQH+CLK+CN
Sbjct: 406 PPRCNTKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCN 465

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
           L LSCG+H CQRKCHPG CPPCLESDSNDLVCPCGKTV  APVRCGT L PC  PCIK +
Sbjct: 466 LKLSCGRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTL 525

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           +    CGHPP+PH+CH LD+PCP CTA VFK CKCGK  KVRT+CFQ +VSCG++CG  L
Sbjct: 526 QGPLDCGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQL 585

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
           ++CHH C K CH  GE                 H C   CH  + C D PC V+ ++ C 
Sbjct: 586 VSCHHSCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCG 645

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERL 707
           CG R S+ TC A    D A     L+C E+C   +R  EL EAFG+  +      G   L
Sbjct: 646 CGHRSSFATCAAHEGQDPADQ-RPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDL 704

Query: 708 QSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQ 767
            + A+  T + +L LP+TE +L  + KQ NWC QIEE L + M D S+PSLHFKPM+PPQ
Sbjct: 705 AALAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQ 764

Query: 768 RYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKER 827
           R+FIHE+A+A+ LY ESQD+EPKRSV++KK  D  S KP+L L + LP+YQ+FK  +KER
Sbjct: 765 RHFIHELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKER 822

Query: 828 KAKQFEARTTARLMNITLDDTLEERKKFEN-NGLIIKNLSNGITLEFLSEFFNKFFKSTL 886
           K K+ E  TT R++N T   T E        NGL+I+ +  G   + +   F  + K TL
Sbjct: 823 KLKELERSTTTRILNYT--STGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTL 880

Query: 887 IKNPQYLIIENNG-LIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           IK+P YL +++   +++ E++   +  V  D++ +VGH ++I K+  + + V +C +E 
Sbjct: 881 IKDPNYLKLDSGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQ 939

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/899 (52%), Positives = 615/899 (68%), Gaps = 14/899 (1%)

Query: 47  LSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKS 106
           + + +D  YYE+ ++EI  GD Y CMICTVEMD+TC MYAC  C R+FD++CIREWALKS
Sbjct: 37  IDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKS 96

Query: 107 TEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGC 166
           T+K+  + WKCPNCY   K+VP KNR TCWCGK V PE NPLNPNSCGQTC+A +C HGC
Sbjct: 97  TQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGC 156

Query: 167 SKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHT 226
           S ICHLGPHP C+R + +KC+CGK  + + C ++       + F C+  CGL L CGIH 
Sbjct: 157 SSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEA---GKFVDSFICDSPCGLTLPCGIHK 213

Query: 227 CKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWV 286
           C++KCHSG+CG CPE +        TI CYC LE+K S  C +V+     SRD+ GNKWV
Sbjct: 214 CQRKCHSGICGECPESIY------GTINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWV 266

Query: 287 GVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPR 346
           G FSC  IR VE+SC+KHSF E C APP++SG   CPFSP  LKTCPCGR+PL  +   R
Sbjct: 267 GAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSR 326

Query: 347 LKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFE 406
            +CTDP+PTC++ C K L+CGKH+CPF CH G CM+ C+  DK  CSCH   F+ PC+F+
Sbjct: 327 SQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQ 386

Query: 407 GEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKEC 466
            +  CN KCE+LMSCRRHRC ERCC GR LA+ R+K +F + D  DE+LVEAQH+CLK+C
Sbjct: 387 EKARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQC 446

Query: 467 NLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKV 526
           NL LSCGKH C+RKCHPG C PCLESDSNDLVCPCGKTVV APVRCGT L  CL PCIK 
Sbjct: 447 NLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKT 506

Query: 527 IRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLP 586
           ++  + CGHPP+PH CHPL++PCP CTA VFK CKC K DKVRT+CFQ DVSCG++CG  
Sbjct: 507 LQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQ 566

Query: 587 LLTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISC 646
           L  C H CQK CH  GE                 H C   CH  T C D PC     I C
Sbjct: 567 LAGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKC 626

Query: 647 PCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTER 706
            CG R + VTC A     + A  T L+CN +C+V +RH EL EAFGI       +   E 
Sbjct: 627 NCGHRSTTVTCGANEN-RAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLED 685

Query: 707 LQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPP 766
           L++ A+  + + +L LP++E  L  ++KQ  WC QIEE L + M+D ++PSLHFKPMRPP
Sbjct: 686 LEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPP 745

Query: 767 QRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKE 826
           QR+FIHE+ +A++LY ESQD+EPKRSVF+KK  D  S +P++ L   LP+Y +FK  ++E
Sbjct: 746 QRHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLYYSFKSAQRE 803

Query: 827 RKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886
           +K K+ E  TT R++N  + D  +       NGL+++N+ NGI  + + E F+++ K TL
Sbjct: 804 KKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTL 863

Query: 887 IKNPQYLIIENNG-LIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           +K+P YL++ +   L+Y + ++  +  V ND++ +VGH + IVKE+L+ + V    +++
Sbjct: 864 LKDPHYLLLASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQS 922

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/896 (51%), Positives = 589/896 (65%), Gaps = 18/896 (2%)

Query: 52  DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTK 111
           ++ YYE+ ++EI  GD Y+CMICTVE+D TC+MYAC  C R+FDY+C+REWALKST KT 
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 112 ERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICH 171
           ++ WKCPNCY +N K+P + R+TCWCGKVVNP+ N L+PNSCGQTCNA  C+HGCSK+CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 172 LGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKC 231
           LGPHPECL  + +KC CGKH +QI C +SK      N ++C + CGL L CG HTC+K C
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG---NSYNCGDVCGLLLPCGKHTCQKTC 207

Query: 232 HSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSC 291
           H+G CG C  +++        + CYCG + K    C D++     S+D  G KW+GV+SC
Sbjct: 208 HTGFCGPCESIIKTE------LPCYCGSDVKSGIQCSDLRV-LDYSKDVSGKKWIGVYSC 260

Query: 292 NKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTD 351
            ++R + YSC  H++VE C+AP  +  ++ CPFSP  LKTCPCG+T L  L KPR KCTD
Sbjct: 261 GEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTD 320

Query: 352 PVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHC 411
            +PTC   C K L CGKH CPF+CH G CMDPC+ I K PC+CH   FLTPCQ    P C
Sbjct: 321 TIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRC 380

Query: 412 NIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLS 471
           NIKCES MSCRRH+C E CCSG+P A+KR+KTLF   D+N+ETLVE +HVCLK+CNL LS
Sbjct: 381 NIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLS 440

Query: 472 CGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNES 531
           CG H C  KCHPGKCPPCLESD NDLVCPCGKTVV APVRCGTKL PC  PCIK+    +
Sbjct: 441 CGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPA 500

Query: 532 VCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKD--VSCGKICGLPLLT 589
            CGH   PH CHP    CPPCTA V K C+C K+  +RT+C   D  V+CG  CGLPL T
Sbjct: 501 PCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLAT 560

Query: 590 CHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCG 649
           CHHKCQK CH  GE                 H C + CHG++ C +  C     I+C C 
Sbjct: 561 CHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCN 620

Query: 650 RRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQS 709
           RR   V C AT    S +   +L C+EEC  ++RH EL EAFG+ EK  P+N   E+L+S
Sbjct: 621 RRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEK--PKNT-KEQLES 677

Query: 710 FAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRY 769
               A  +DDL +PY+E  L  Y KQ NWC+QI  +  KF++D  + SLH KPMR PQR 
Sbjct: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737

Query: 770 FIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKA 829
           FI E+A A+ LY+ESQDREP RSV+LKK     S KP L L D   +YQ FK LEKER  
Sbjct: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 830 KQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKN 889
           + +  + T  L+NI   +T         N ++I  + +   ++ +    + F K TL+K 
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 890 PQYLIIE--NNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIE 943
           PQY  ++  N+ LI+PE+++ IT+   +D++ ++      ++++++   VEMC ++
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVD 912

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/891 (49%), Positives = 578/891 (64%), Gaps = 16/891 (1%)

Query: 48  SDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKST 107
           +D+D + YYE+AI++I  G  Y C+ICTVE+D TC+MYAC  C R++DY+CI EWA KS+
Sbjct: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82

Query: 108 EKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCS 167
           +++ +  WKCPNCYH   KV  K R+TCWCGK +NPEKN   PNSCGQTC A +C HGC+
Sbjct: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142

Query: 168 KICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTC 227
             CHLGPHP+C+  + +KC CGK   QISC+Q+K+    + + SC+  CGLPL CG+HTC
Sbjct: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV---KPKLSCKLPCGLPLPCGVHTC 199

Query: 228 KKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVG 287
           +K CHSG CG C  ++          KCYCG     S  CKDV A T +SR  +  KW+G
Sbjct: 200 QKICHSGPCGRCNTVMS------GKFKCYCGSNHLDSIICKDV-AVTKMSRSGKHKKWIG 252

Query: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347
           VFSC  IR V Y C++HSF ESC   P+     QCP+SPN+ KTC CG T L  + + R 
Sbjct: 253 VFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKRE 312

Query: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407
           KCTDP+PTC+  C KPL CGKH CP TCH G CMDPC+QI+++ CSC +  FLTPCQF+G
Sbjct: 313 KCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDG 372

Query: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467
           +P CNIKCE+LMSCRRHRC +RCCSG+PLA  R  T+    D NDE+L+EA+H+C K CN
Sbjct: 373 KPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCN 432

Query: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527
             LSCG H C  KCHPGKCPPCLESDSNDLVCPCGK+V+ APVRCGT    C +PCI  +
Sbjct: 433 RKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTL 492

Query: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587
           R    CGH    H CHP  + CPPCTA V+KPCKCGK    RT+CFQ D+SCG+ C   L
Sbjct: 493 RGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKL 552

Query: 588 LTCHHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCP 647
             CHH CQK CHP GE                 H C  +CHG   C D PC     +SC 
Sbjct: 553 TNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCG 612

Query: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERL 707
           CGRR   V C A    +SA     L C+++C  V++H+ L +    +   E  N      
Sbjct: 613 CGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQT---LRSSESTNKAEHGS 669

Query: 708 QSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQ 767
            S     T+Y+DL LPY+E  +  ++KQ  WC+ I++ LI+ ++D SR SLHFKPM+ PQ
Sbjct: 670 SSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQ 729

Query: 768 RYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKER 827
           R F+HE++KAF LY+ESQDREPKRSVF+K     TS  PA+ LS+ L +YQ  K  +KER
Sbjct: 730 RQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKER 787

Query: 828 KAKQFEARTTARLMNITLDDTLEERK-KFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886
           +  + +  TT  L++I +DD  + +  +   N ++I  +   +T+E +   F++  K TL
Sbjct: 788 RDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTL 847

Query: 887 IKNPQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSV 937
           +K+PQ+ +I +N  IYP +  EI+  V  D+  LV +F+ + + + IG +V
Sbjct: 848 LKDPQFRLINSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/895 (48%), Positives = 574/895 (64%), Gaps = 19/895 (2%)

Query: 51  DDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKT 110
           + + YYE+ + E+  G++Y C+ICTVEMD +C MYAC +C R++DY+CIR WALK+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 111 KERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKIC 170
            +R WKCPNCYHVN+KVP KNR TCWCGK VN + N +NPNSCGQTC AP+C HGCSK+C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 171 HLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKK 230
           HLGPH EC+  I  KC CGK   +I C+++K  + +RN FSC++ CGLP+ CGIH C++ 
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAK--AAKRN-FSCDQPCGLPMPCGIHKCERV 190

Query: 231 CHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFS 290
           CH+G CG C       EE    IKCYCGL T+    C +V      S+ ++   W+G F+
Sbjct: 191 CHNGPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSV-VARSKVSKYKSWIGAFA 243

Query: 291 CNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCT 350
           C+++R V YSC KHSF E C+APP++     CP+SP    TCPCG+T L  L   R  CT
Sbjct: 244 CDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACT 303

Query: 351 DPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPH 410
           D + +C   C K L CG H CP TCH+G CMDPC+ I ++ C+C Q  FL PCQF   P 
Sbjct: 304 DHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPS 363

Query: 411 CNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLML 470
           C  KCESLMSCRRHRC ERCCSGRP + KR     R S  +DE+ VEAQHVCLK+CN +L
Sbjct: 364 CTAKCESLMSCRRHRCAERCCSGRPHSVKRNSRRRRESP-DDESEVEAQHVCLKDCNRVL 422

Query: 471 SCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNE 530
            CG H C  KCH GKCPPCLESDSNDL+CPCGKT+V APVRCGTKL  C  PC   + + 
Sbjct: 423 LCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDT 482

Query: 531 SVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTC 590
             CGH P  H+CHPLD+PCPPCT TV K C+CGK +++RT C+  DVSC + C  PL  C
Sbjct: 483 WPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSYC 541

Query: 591 HHKCQKVCHPNGEXXXXXXXXXXXXXXXXXHECLKSCHGSTECSDSPCPVSTKISCPCGR 650
           +H CQ  CH +G+                 H C   CHG T C +SPC     I+C CG 
Sbjct: 542 NHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGH 601

Query: 651 RESYVTCNATSTIDSAALITR-LDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQS 709
           + S   C+  +  D     ++ L C+E+C   +RH++L  AFG+VEK   E    +    
Sbjct: 602 KSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEE---DEALL 658

Query: 710 FAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRY 769
            AQ + ++DDL LP+TE  L  +TKQ  WC QIE+ LIK MDD+S  +LHFKPMR  QR 
Sbjct: 659 LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718

Query: 770 FIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKA 829
           F+HE++ +F LY+ESQD EPKRSV++KK   G S  PA+ LS   P+Y +FKKLE+E KA
Sbjct: 719 FVHELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTSFKKLEREFKA 776

Query: 830 KQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKN 889
              E+  T +L+++ +DD+ E +     N +++  L++  +   L + F  +F  TL+  
Sbjct: 777 NS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNC 835

Query: 890 PQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIEN 944
           PQY++    G I+P  +  ++     DL  L G+F ++ +E+ +   +  C +++
Sbjct: 836 PQYVVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDS 890

>NCAS0E03690 Chr5 complement(725712..726647) [936 bp, 311 aa] {ON}
           Anc_7.304 YDL189W
          Length = 311

 Score = 34.3 bits (77), Expect = 1.2,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 11/97 (11%)

Query: 723 PYTEPALVAYTKQPN---WCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIHEIAKAFN 779
           P ++  ++A   +PN   +   +E +LI  ++ +S PS    PM    R   H++A+  N
Sbjct: 8   PLSDVMIIALFDKPNDRDFIINLENILINLIN-SSDPSYQLTPMNSYYRLLTHQVAQYHN 66

Query: 780 LYAESQDREPKRSVFLKKN----DDGTSLKPALRLSD 812
           L   + D    R V  K +    DD   L  AL+ SD
Sbjct: 67  LAHVAND---TRLVIYKDDSFQFDDKKPLLQALKQSD 100

>CAGL0C00583g Chr3 (62224..63396) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|P38272 Saccharomyces cerevisiae
           YBR130c SHE3 required for mother cell-specific
           expression of HO
          Length = 390

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 66/147 (44%), Gaps = 20/147 (13%)

Query: 802 TSLKPALRLSDVLPVYQNFKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLI 861
           T+L+   +  +VL   Q+    E E      + +   R +N  L+D   E K+ +NN L 
Sbjct: 111 TNLQLTSQYQEVLKKLQDAVDREAEWSETVSKLQVHNREINTALEDKTAELKECDNNLLA 170

Query: 862 IKNLSNGITLE-------------FLSEFFNKFFKSTLIKNPQYLIIENNGLIYPESHNE 908
           IK     IT E              L     ++ KS + KN    I+++    Y ++ N+
Sbjct: 171 IKKEYEQITTENSKLASDYKELSKSLGSLRGQYAKSKIRKN----ILQSLQEEYKQACND 226

Query: 909 ITQGVYNDLDML---VGHFNVIVKEEL 932
             + V N+LDM+   +GH+N   K++L
Sbjct: 227 EIEAVRNNLDMVESKIGHYNSDEKQKL 253

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 32.7 bits (73), Expect = 3.4,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 30/122 (24%)

Query: 804 LKPALRLS----DVLPVYQNFKKLEKERKAKQFEARTTARLMNITL---DDTLEERKKFE 856
           + P LR+      VL  YQ +  +E      Q +A+   ++MN T+   D  ++ R+   
Sbjct: 32  INPVLRIKYPKDKVLQAYQGYAFIEF---YNQGDAQYAIKIMNNTVRLYDRLIKVRQVTN 88

Query: 857 NNG------------------LIIKNLSNGITLEFLSEFFNKFFKSTLIKNPQYLIIENN 898
           + G                  L IKNL++ I  + L + FNKF K  LI+ P+   + N 
Sbjct: 89  STGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGK--LIREPEIFYLSNG 146

Query: 899 GL 900
            L
Sbjct: 147 KL 148

>CAGL0K06853g Chr11 complement(668252..669865) [1614 bp, 537 aa]
           {ON} highly similar to uniprot|P38137 Saccharomyces
           cerevisiae YBR222c Peroxisomal-coenzyme A synthetase
          Length = 537

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 889 NPQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKE 930
           N  + + +N  +I PE+  E+T   Y DL  +VGHF  I K+
Sbjct: 9   NDTFRVSDNVAVIVPETGLEVT---YRDLSHMVGHFQTIFKD 47

>TBLA0A10010 Chr1 complement(2461989..2463617) [1629 bp, 542 aa]
           {ON} Anc_6.120 YBR222C
          Length = 542

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 889 NPQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEE 931
           N  + + +N  +I P+++ ++T   Y DL  +VGHF  + K+E
Sbjct: 12  NDTFKVSDNVAVIIPDTNTQVT---YRDLSHMVGHFQQVFKDE 51

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,535,145
Number of extensions: 4491731
Number of successful extensions: 12053
Number of sequences better than 10.0: 63
Number of HSP's gapped: 11271
Number of HSP's successfully gapped: 69
Length of query: 966
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 847
Effective length of database: 39,836,145
Effective search space: 33741214815
Effective search space used: 33741214815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)