Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H032902.289ON24524512970.0
KNAG0H019802.289ON2492508091e-109
NCAS0G03850singletonON2512517951e-107
NCAS0G037702.289ON2512517951e-107
CAGL0M06897g2.289ON2482517891e-106
Skud_14.3052.289ON2492507651e-102
Suva_14.3232.289ON2532497611e-102
YNL024C2.289ON2462497581e-101
Smik_14.3072.289ON2462497541e-101
NDAI0G006802.289ON2552567511e-100
SAKL0E07612g2.289ON2522466681e-87
Ecym_33282.289ON2542526662e-87
Kwal_27.115132.289ON2512476541e-85
KLTH0G10428g2.289ON2512486523e-85
ADL212W2.289ON2512516444e-84
KLLA0E08295g2.289ON2662396403e-83
KAFR0C042501.325ON3912321536e-11
Suva_4.5321.325ON4161511422e-09
TDEL0D019401.325ON4052071394e-09
YBR271W (EFM2)1.325ON4191541394e-09
Skud_2.4031.325ON4171511351e-08
NDAI0B047301.325ON4321431322e-08
ZYRO0G20548g1.325ON3971621313e-08
KNAG0B067204.352ON2831821295e-08
TPHA0L003404.352ON3411561287e-08
Kwal_47.166354.352ON3221871271e-07
KAFR0E042804.352ON3151801242e-07
KNAG0C018001.325ON4211571234e-07
CAGL0I09438g1.325ON4061861217e-07
TBLA0D052001.325ON3991531217e-07
KLLA0E21539g1.325ON4001461191e-06
NCAS0B074101.325ON4142031191e-06
Smik_2.4141.325ON4171511191e-06
CAGL0M00572g4.352ON3271781163e-06
Kpol_1066.171.325ON4351601155e-06
NCAS0J021504.352ON3221521145e-06
Skud_10.3524.352ON3362581136e-06
SAKL0G18106g4.352ON3351391137e-06
Kwal_14.25501.325ON4181091138e-06
NDAI0J028604.352ON3471431111e-05
Kpol_1028.814.352ON3361861102e-05
Suva_12.2204.352ON3371741092e-05
TPHA0I026501.325ON4211491074e-05
Smik_10.4224.352ON3401891048e-05
YJR129C4.352ON3391801003e-04
SAKL0D06798g1.325ON4211521003e-04
KLTH0D17996g4.352ON317169993e-04
TDEL0D006404.352ON327184976e-04
ZYRO0B14916g4.352ON298135950.001
Ecym_55131.325ON39697960.001
Ecym_11274.352ON320149910.004
AER240W1.325ON390104880.009
AER161C4.352ON316142830.037
TBLA0B061504.352ON316136830.038
KLTH0H10560g1.325ON417101810.083
KLLA0B04444g4.352ON308145800.094
CAGL0M09801g6.79ON256178780.15
KNAG0F030806.79ON258230750.31
TPHA0G036303.564ON102253760.42
ZYRO0D14542g6.79ON263187720.97
KNAG0E019002.259ON37585720.98
KLLA0F12430g8.155ON267151693.1
KNAG0F018306.240ON31558664.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03290
         (245 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   504   0.0  
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   316   e-109
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               310   e-107
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   310   e-107
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   308   e-106
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   299   e-102
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   297   e-102
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   296   e-101
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   295   e-101
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   293   e-100
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   261   1e-87
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   261   2e-87
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   256   1e-85
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   255   3e-85
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   252   4e-84
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   251   3e-83
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    64   6e-11
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    59   2e-09
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    58   4e-09
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    58   4e-09
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    57   1e-08
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    55   2e-08
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    55   3e-08
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    54   5e-08
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    54   7e-08
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    54   1e-07
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    52   2e-07
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    52   4e-07
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    51   7e-07
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    51   7e-07
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    50   1e-06
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    50   1e-06
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    50   1e-06
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    49   3e-06
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    49   5e-06
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    49   5e-06
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    48   6e-06
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    48   7e-06
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    48   8e-06
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    47   1e-05
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    47   2e-05
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    47   2e-05
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    46   4e-05
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    45   8e-05
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    43   3e-04
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    43   3e-04
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    43   3e-04
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    42   6e-04
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    41   0.001
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    42   0.001
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    40   0.004
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    39   0.009
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    37   0.037
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    37   0.038
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    36   0.083
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    35   0.094
CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {...    35   0.15 
KNAG0F03080 Chr6 (584425..585201) [777 bp, 258 aa] {ON} Anc_6.79...    33   0.31 
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...    34   0.42 
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    32   0.97 
KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.2...    32   0.98 
KLLA0F12430g Chr6 complement(1143594..1151609) [8016 bp, 2671 aa...    31   3.1  
KNAG0F01830 Chr6 complement(347294..348241) [948 bp, 315 aa] {ON...    30   4.6  

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  504 bits (1297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/245 (100%), Positives = 245/245 (100%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY
Sbjct: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60

Query: 61  LIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLME 120
           LIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLME
Sbjct: 61  LIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLME 120

Query: 121 RNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLL 180
           RNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLL
Sbjct: 121 RNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLL 180

Query: 181 EKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLF 240
           EKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLF
Sbjct: 181 EKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLF 240

Query: 241 ELKRK 245
           ELKRK
Sbjct: 241 ELKRK 245

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  316 bits (809), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/250 (61%), Positives = 193/250 (77%), Gaps = 8/250 (3%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           MNE+FG +  L+  RPIEH GS D+SF G+L+PA++I+EDGG SGCGGKVW+AGELLC+Y
Sbjct: 1   MNEIFGSFGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDY 60

Query: 61  LIEKSDSENLLCDG------SIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           ++EKSD ++LL +         +NI+ELGSGTGLVG+CV L+EKQ FHK IKV+ITDI  
Sbjct: 61  IVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQ 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           LVPLM++NI LN +    +A+EL WG+ L   +   S       V++VDL++AADCVY E
Sbjct: 121 LVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHS--EGLSKVTSVDLILAADCVYLE 178

Query: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234
           KAFPLLEK LLDLTNC  PP+ILMAYRKRR ADKRFF +I K+F V EI DFS++++Y+K
Sbjct: 179 KAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLK 238

Query: 235 QRTHLFELKR 244
           QRTHLFEL R
Sbjct: 239 QRTHLFELIR 248

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  310 bits (795), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 150/251 (59%), Positives = 195/251 (77%), Gaps = 7/251 (2%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M+ +FG++ GL+  RP+EHLG++DLSF G+L   +KI+EDGG SGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  LIEKSDSENLL----CDGS--IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           ++EKS +E+LL     DG    +N+LELGSGTGLVG+CVGL+EK RFHK+I V ITDI  
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           LVPLM+RNI LN ++   VA+ L WG+ L   +  ++VD N    + VDL++AADCVY E
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVD-NLPKTNVVDLILAADCVYLE 179

Query: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234
            AFPLLE+ LLDLT  + PP+ILM+YRKRRKADK FF +I+KNFDVIE+ DF+ +E Y+K
Sbjct: 180 DAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLK 239

Query: 235 QRTHLFELKRK 245
            RTHLF+L R+
Sbjct: 240 MRTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  310 bits (795), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 150/251 (59%), Positives = 195/251 (77%), Gaps = 7/251 (2%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M+ +FG++ GL+  RP+EHLG++DLSF G+L   +KI+EDGG SGCGGKVWIAGELLC++
Sbjct: 1   MDGIFGDFEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDF 60

Query: 61  LIEKSDSENLL----CDGS--IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           ++EKS +E+LL     DG    +N+LELGSGTGLVG+CVGL+EK RFHK+I V ITDI  
Sbjct: 61  ILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQ 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           LVPLM+RNI LN ++   VA+ L WG+ L   +  ++VD N    + VDL++AADCVY E
Sbjct: 121 LVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVD-NLPKTNVVDLILAADCVYLE 179

Query: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234
            AFPLLE+ LLDLT  + PP+ILM+YRKRRKADK FF +I+KNFDVIE+ DF+ +E Y+K
Sbjct: 180 DAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLK 239

Query: 235 QRTHLFELKRK 245
            RTHLF+L R+
Sbjct: 240 MRTHLFQLARR 250

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  308 bits (789), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/251 (60%), Positives = 191/251 (76%), Gaps = 9/251 (3%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M ++ G +  LI++RP+EH+G +DL+F+G L P +KIYEDGG SGCGGKVWIAGELLCE+
Sbjct: 1   MEDILG-FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEF 59

Query: 61  LIEKSDSENLLCDG------SIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           ++EKS    LL D       S  N+LELGSGTGLVG+CVGL+ K++  + +K  ITDI  
Sbjct: 60  ILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQ 119

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           LVPLME+N+ LN I     AKEL+WG+ LP E+    V       S++DLV+AADCVY E
Sbjct: 120 LVPLMEKNVELNLIDQQVFAKELLWGEALPIEF--APVKTGHATTSSLDLVLAADCVYLE 177

Query: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234
           KAFPLLEK LLDLT CDNPP+ILMAYRKRRKADK FF +IRKNF+VI I+DF ++++Y+K
Sbjct: 178 KAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLK 237

Query: 235 QRTHLFELKRK 245
           QRTHLF+L RK
Sbjct: 238 QRTHLFQLVRK 248

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 186/250 (74%), Gaps = 9/250 (3%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  R  EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MDTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  LIEKSDSENLLCDGS-----IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGL 115
           ++EKS   +LL + +      K +LELGSGTGLVG+CVGL+EK  FH   KV +TDI  L
Sbjct: 61  ILEKS-LHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKL 119

Query: 116 VPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
           VPL+ERNI L+K+    +A+EL WG+ L  ++     D      +NVDLV+AADCVY EK
Sbjct: 120 VPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQ---TNNVDLVLAADCVYLEK 176

Query: 176 AFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQ 235
           AFPLLE+ LLDLTNC +PP+ILMAY+KRRKADK FF +I++NFDV+EI DFS  + Y+KQ
Sbjct: 177 AFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQ 236

Query: 236 RTHLFELKRK 245
           RTHLF+L RK
Sbjct: 237 RTHLFQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  297 bits (761), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 186/249 (74%), Gaps = 7/249 (2%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  R  EH G  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MDGIFGGFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  LIEKSD----SENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLV 116
           ++EKSD    SE +        +LELGSGTGLVG+CVGL+EK +FH + KV +TDI  LV
Sbjct: 61  ILEKSDDHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLV 120

Query: 117 PLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKA 176
           PLMERNI L+K+    +A+EL WG+ L  ++     D     V+NVDLV+AADCVY EKA
Sbjct: 121 PLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQ---VNNVDLVLAADCVYLEKA 177

Query: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236
           FPLLEK LLDLTNC +PP+ILMAY+KRRKADK+FF +I++NFDV+EI DF   + Y+KQ+
Sbjct: 178 FPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQK 237

Query: 237 THLFELKRK 245
           THLF+L RK
Sbjct: 238 THLFQLVRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 185/249 (74%), Gaps = 7/249 (2%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M  +FG +  L+  RP EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  LIEKSD----SENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLV 116
           ++EKS     S+ +      K +LELGSGTGLVG+CVGL+EK  FH   KV +TDI  L+
Sbjct: 61  ILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 117 PLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKA 176
           PL++RNI L+++    +A+EL WG+ L +++   S        +NVDLV+AADCVY E+A
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADF---SPQEGAMQANNVDLVLAADCVYLEEA 177

Query: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236
           FPLLEK LLDLT+C NPP+ILMAY+KRRKADK FF +I++NFDV+EI DFS  E Y+K+R
Sbjct: 178 FPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKER 237

Query: 237 THLFELKRK 245
           THLF+L RK
Sbjct: 238 THLFQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  295 bits (754), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/249 (59%), Positives = 186/249 (74%), Gaps = 7/249 (2%)

Query: 1   MNEVFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEY 60
           M+ +FG +  L+  RP EHLG  DLSF G+L PA+KI EDGG SGCGGKVWIAGELLCEY
Sbjct: 1   MDSIFGGFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEY 60

Query: 61  LIEKSDSENL--LCDGS--IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLV 116
           ++EKS    L    DG    K +LELGSGTGLVG+CVGL+EK  +H   KV +TDI  LV
Sbjct: 61  ILEKSVDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLV 120

Query: 117 PLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKA 176
           PL++RNI L+K+    +A+EL WG+ L +++     D      +NVDLV+AADCVY EKA
Sbjct: 121 PLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQ---TNNVDLVLAADCVYLEKA 177

Query: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236
           FPLLEK LLDLT+C +PP+ILMAY+KRRKADK FF +I++NFDV+EI +FS  + Y+KQR
Sbjct: 178 FPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQR 237

Query: 237 THLFELKRK 245
           THLF+L RK
Sbjct: 238 THLFQLIRK 246

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 190/256 (74%), Gaps = 12/256 (4%)

Query: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59
           M+++FG  +  L+  RP+EHLG++DLSF G+L   +KI+EDGG SGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 60  YLIEKSDSENLLC-----DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           +++EKS+S++LL          + I+ELGSGTGLVG+C+GL+EK  FHKDI   ITDI  
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQL-----PSEYMTTSVDGNCDNVSNVDLVVAAD 169
           +VPLM++NI LN I +   A+EL WG+ L     PSE+ +   + +      VDL++AAD
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEH-SRDKEEDFREEKKVDLILAAD 179

Query: 170 CVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSH 229
           CVY EKAFPLLEK LLDLT  + PP ILMAYRKRRKADK FF +I+KNFD++EI DF  +
Sbjct: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 230 EKYMKQRTHLFELKRK 245
           E Y+KQRTHLF+L R+
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  261 bits (668), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 181/246 (73%), Gaps = 14/246 (5%)

Query: 8   YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDS 67
           +  L+ +RP EHLG +DLSF G+LSP +KI+EDGG SGCGGKVWIAGELLCE+L+EKSD 
Sbjct: 11  FNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLEKSDQ 70

Query: 68  ENLLCD--------GSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLM 119
           + L             IK I+ELGSGTGLVG+C+GL+ KQ   KD+ + +TDI  LV LM
Sbjct: 71  QGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQLVTLM 130

Query: 120 ERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPL 179
           +RNI LN++ +    KEL WG+ L  E+  T       N   VDL++AADCVY EKAFPL
Sbjct: 131 DRNIKLNEL-EHVFPKELWWGEPLKPEFAPTR-----SNQRQVDLILAADCVYLEKAFPL 184

Query: 180 LEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHL 239
           LE  LLDLT+C +PPIILM+Y+KRRKADK FF +I+KNFDV+EI++F+  + Y+KQ+THL
Sbjct: 185 LEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHL 244

Query: 240 FELKRK 245
           F+L RK
Sbjct: 245 FQLVRK 250

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  261 bits (666), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 174/252 (69%), Gaps = 15/252 (5%)

Query: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59
           M +VF   +  L+ T PIEHLG++DLSF G+L P +KIYEDGG SGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 60  YLIEKSDSENLLCD-----GSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           +L+EKS    LL            +LELGSGTGLVG+C+G+        D+ V ITDI  
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           L PLM RN+ +N +      +EL WG +LP+E+            S VDL++AADCVY E
Sbjct: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD--------SPVDLILAADCVYLE 172

Query: 175 KAFPLLEKILLDLT-NCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYM 233
           KAFPLLE  LL+LT N +  P++LM+YRKRRKADK+FF++I+K+F + E+ DF  +++Y+
Sbjct: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYI 232

Query: 234 KQRTHLFELKRK 245
           KQRTH+F+L R+
Sbjct: 233 KQRTHIFQLVRR 244

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  256 bits (654), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 172/247 (69%), Gaps = 17/247 (6%)

Query: 7   EYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSD 66
           +++ L+ +RP+EHLG +DLSF GQ+ PA+KI+EDGG +GCGGK+W+AGELLC+YL+E SD
Sbjct: 10  QFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLENSD 69

Query: 67  SENLLCDGSIK--------NILELGSGTGLVGICVGLMEKQRFHKD-IKVSITDIGGLVP 117
           ++ +L    ++        NILELGSGTGLVG+C G +   + H D  KV ITDI  LV 
Sbjct: 70  AKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSV--AQLHGDRTKVYITDIDRLVG 127

Query: 118 LMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAF 177
           LME N+ LN +A+    + L WG+ L  ++      G       VDLV+AADCVY E AF
Sbjct: 128 LMETNVNLNHLAETVSVEILSWGEPLKEKF------GPDAKADKVDLVLAADCVYLETAF 181

Query: 178 PLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRT 237
           PLLEK LLDLT  D PP +LM+YRKRRKADK FF  IRKNF ++ I +F  ++ Y+K++T
Sbjct: 182 PLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQT 241

Query: 238 HLFELKR 244
           HLF+L R
Sbjct: 242 HLFQLVR 248

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  255 bits (652), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 168/248 (67%), Gaps = 17/248 (6%)

Query: 6   GEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKS 65
            ++  L+ +RP+EH G +DL+F G++ PA+KI+EDGG SGCGGK+WIAGELLCEYL+E S
Sbjct: 9   AQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLENS 68

Query: 66  DSENLLC--------DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVP 117
           D   +L         D    NILELGSGTGLVG+C G + +     + KV ITDI  LV 
Sbjct: 69  DDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQLVR 127

Query: 118 LMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSN-VDLVVAADCVYAEKA 176
           LME N+ LN +A    A++L WG+ L  E+         D +SN  DLV+AADCVY E A
Sbjct: 128 LMEGNVELNGLASVVSAEKLWWGEPLKYEF-------GPDAISNKTDLVLAADCVYLETA 180

Query: 177 FPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQR 236
           FPLLEK LLDLT  + PP++LM+YRKRRKAD+ FF  IRKNF V+ I  F   + ++KQR
Sbjct: 181 FPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQR 240

Query: 237 THLFELKR 244
           THLF+L R
Sbjct: 241 THLFQLIR 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  252 bits (644), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 174/251 (69%), Gaps = 16/251 (6%)

Query: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59
           M E F   +  L++ RPIEHLG +DLS+ GQL P +KI+EDGG SGCGGKVWIAG LLCE
Sbjct: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60

Query: 60  YLIEKSDSENLLC-----DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114
           +++EKS    +L      +   KNI+ELGSGTGLVG+CVGL  K     D  V ITDI G
Sbjct: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120

Query: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174
           L PLM++N+ LN +      + L WG+ L  E+    +D          LV+AADCVY E
Sbjct: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPID----------LVLAADCVYLE 170

Query: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234
           KAFPLLEK LLDLT  ++ P++LM+Y+KRRKADK+FF++I+K FD+IEI DF S+E Y +
Sbjct: 171 KAFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRR 230

Query: 235 QRTHLFELKRK 245
           QRT+LF+L RK
Sbjct: 231 QRTYLFQLVRK 241

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  251 bits (640), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 174/239 (72%), Gaps = 14/239 (5%)

Query: 11  LIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENL 70
           L+  RPIEHLG  D+SF+G+L   + I EDGG SGCGGKVWIAGELLCEY++EKSD E+L
Sbjct: 37  LVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHL 96

Query: 71  LC----DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLN 126
           L     DG+  ++LELGSGTGLVG+CVGLM++   + D +V I+DI  L+ LME NI +N
Sbjct: 97  LSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVN 156

Query: 127 KIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLD 186
            + D   A+ L WG  LP  ++   VD          LV+AADCVY E AFPLLEK LL+
Sbjct: 157 GLDDKVHAEVLWWGNPLPDVFVKKPVD----------LVLAADCVYLEAAFPLLEKTLLE 206

Query: 187 LTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLFELKRK 245
           LT+ +N PIILMAY+KRRKADK FF +I+KNF ++EI DF + +KY+KQRTHLF+L R+
Sbjct: 207 LTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 111/232 (47%), Gaps = 32/232 (13%)

Query: 29  GQLSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTG 87
             L   +K++E    +   G K W +  +L   L ++ D EN L   + K ILELGSGTG
Sbjct: 175 NNLKKIVKLFEPSLTNDNLGWKTWGSSLILSNILCDRID-ENFLKSFNGKRILELGSGTG 233

Query: 88  LVGICVGL-MEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSE 146
           LVGI V   +E+     + ++ +TD+  +V  +E+NI +N++A+  V+  L W    P  
Sbjct: 234 LVGISVASKLEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTN--PES 291

Query: 147 YMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPI-------ILMA 199
           +++   D      +  D+++ +D +Y+ K    +  ++ +  + DN          I   
Sbjct: 292 FVSNYGD------TRFDVLLISDPIYSSKHPQWVVNMIDNFLSQDNHQARCYLQIPIRDK 345

Query: 200 YRKRRKADKRFFVRIRKNFDVIE------IDDFSSHEKYMKQRTHLFELKRK 245
           +   R+  K+  V   KNF+V++       DD+   + Y +      ELKRK
Sbjct: 346 FANERENLKKLLV--DKNFEVVKEMYSKGFDDWGEVKYYYR------ELKRK 389

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 13/151 (8%)

Query: 31  LSPAMKIYEDG-GASGCGGKVW----IAGELLCEYLIEKSDSENLLCDGSIKNILELGSG 85
           L+ A+ +YE    A   G K W    I  +LL +YL          C      +LELGSG
Sbjct: 201 LNSAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYLHTTGMPPAANCGTKRIKVLELGSG 260

Query: 86  TGLVGICVGLMEKQRFH-KDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLP 144
           TGLVG+      K+ +   +I++ +TD+  +V  +++N+LLN + D   A+ L W    P
Sbjct: 261 TGLVGLSWAAKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTN--P 318

Query: 145 SEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
             ++         +  + D+++ AD +Y+ +
Sbjct: 319 QNFI-----NQFGHEMDFDIILVADPIYSPQ 344

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (46%), Gaps = 23/207 (11%)

Query: 15  RPIEHLGSADLSFDGQLSPAMKIYEDG-GASGCGGKVWIAGELLCEYLIEKSDSENLLCD 73
           R  +   S   +F+G  SP ++IYE    A   G K W A  +L + LI      N+L +
Sbjct: 182 RTAQPAMSRKFTFEGLPSP-IEIYEPSLTADNLGWKTWGASFILSQKLI------NVLAE 234

Query: 74  GSIK---NILELGSGTGLVGICVGLMEKQRF-HKDIKVSITDIGGLVPLMERNILLNKIA 129
            +      +LELGSGTGL GI       Q++ +   ++ +TD+  +V  +++N+ +NK+ 
Sbjct: 235 STFNFKPRVLELGSGTGLAGISWLCKWVQKYGNGHTEIFLTDLPVIVANLQKNVEVNKVE 294

Query: 130 DATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTN 189
                  L W    P++++ +  D         D+++ +D +Y+     L+  ++    +
Sbjct: 295 SFATVSALDWTD--PTDFINSYTD------DEFDILIVSDPIYSPNHPELVVNMIKKFLS 346

Query: 190 CDNPPIILMAYRKRRKADKRFFVRIRK 216
                 + +  R R  A+++   R+R+
Sbjct: 347 SQGQCYLEIPLRPRYAAERK---RLRQ 370

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 82/154 (53%), Gaps = 16/154 (10%)

Query: 31  LSPAMKIYEDG-GASGCGGKVWIAGELLCEYLIEKSD-----SENLLCDGSIKNI--LEL 82
           LS ++ ++E    A   G K W +  +L + +++  D     + N+L +  IK I  LEL
Sbjct: 201 LSTSIPLHEPSLTADNLGWKTWGSSLILSQLVVDHLDYLHTTNVNMLANSDIKQIKVLEL 260

Query: 83  GSGTGLVGICVGLMEKQRF-HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQ 141
           G+GTGLVG+   L  K+ +  ++I++ +TD+  +V  +++N+ LN + D   A+ L W  
Sbjct: 261 GAGTGLVGLSWALKWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTN 320

Query: 142 QLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
             P +++      N       D+++ AD +Y+ +
Sbjct: 321 --PHDFIDKFGHEN-----EFDVILIADPIYSPQ 347

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 13/151 (8%)

Query: 31  LSPAMKIYEDG-GASGCGGKVW----IAGELLCEYLIEKSDSENLLCDGSIKNILELGSG 85
           L+ A+ +YE    A   G K W    I  +LL +YL          C+     +LELGSG
Sbjct: 202 LNNAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYLHTVGVHITASCNQKKIKVLELGSG 261

Query: 86  TGLVGICVGLMEKQRFHKD-IKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLP 144
           TGLVG+      K+ +  D +++ +TD+  +V  +++N+ LN + D   A+ L W    P
Sbjct: 262 TGLVGLSWASKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTN--P 319

Query: 145 SEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
            +++      N       D+++ AD +Y+ +
Sbjct: 320 QDFIDRFGHEN-----EFDIILVADPIYSPQ 345

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 73/143 (51%), Gaps = 11/143 (7%)

Query: 34  AMKIYEDG-GASGCGGKVWIAGELLCEYLIEKSDS-ENLLCDGSIKNILELGSGTGLVGI 91
            +++YE    A   G K W +  +L + L+   ++ +N     SI+ +LELG+GTGLVGI
Sbjct: 219 VIQLYEPSLTADNLGWKTWGSSLILSQELVNDLETNKNNKKSKSIRRVLELGAGTGLVGI 278

Query: 92  CVGLMEKQRF-HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTT 150
                 +Q + ++ I++ +TD+  +V  + +N+  N + D  VA  L W    P +++  
Sbjct: 279 AWACKWRQLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTN--PEDFIKK 336

Query: 151 SVDGNCDNVSNVDLVVAADCVYA 173
             D         D ++ AD +Y+
Sbjct: 337 YSD------EKFDTILIADPIYS 353

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 23/162 (14%)

Query: 31  LSPAMKIYEDG-GASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLV 89
            S  ++IYE    A   G K W +  +L + LI+     N      +  +LELGSGTGL 
Sbjct: 188 FSRNIEIYEPSLTADNLGWKTWGSSFILSQKLIKIVPHFN---PTKLHRVLELGSGTGLA 244

Query: 90  GICVGLMEKQRFH--KDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEY 147
           GI   LM+    H   +I++  TD+  +VP + +N+ +N I+D +V   L W    P ++
Sbjct: 245 GIS-WLMKWIEIHGNSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWT--CPEDF 301

Query: 148 MTTSVDGNCDNVSN--VDLVVAADCVYAEKAFPLLEKILLDL 187
           +        D  S+   D+++ +D +Y+    P   K+++D+
Sbjct: 302 V--------DKYSSEKFDIIIVSDPIYS----PNHPKLVVDM 331

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (43%), Gaps = 28/182 (15%)

Query: 4   VFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYED----GGASGCGGKVWIAGELLCE 59
           V+  YV L+ +RP+       L +    +  + I E        +  G + W A   L +
Sbjct: 60  VYEMYVDLLSSRPLRPDEPNVLVYRLGDTVRVSIREMPRLISAVNTTGFRTWRAATSLSK 119

Query: 60  YLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLM 119
            L+E  +    L  G  K +LELG GTGL  I VG++++   +K + V+  D G L  + 
Sbjct: 120 LLVEHRE----LTRG--KTVLELGCGTGLSSITVGVLDE---YKKLYVTDGDTGILSEVT 170

Query: 120 ERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVS-NVDLVVAADCVYAEKAFP 178
             N+ LNK+      + L+W  +              D V  ++D+VV AD  Y    FP
Sbjct: 171 TPNLSLNKVERDVQCQRLVWASE--------------DRVPGDIDVVVGADITYDPTVFP 216

Query: 179 LL 180
            L
Sbjct: 217 EL 218

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 73/156 (46%), Gaps = 31/156 (19%)

Query: 38  YEDGGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLME 97
           Y    A   G + W A   L +YLI+         +  ++N LELGSGTG+V I  GL++
Sbjct: 133 YLISAAGTTGFRTWEAAVYLTKYLIDLG----FPPETVMENTLELGSGTGMVSI--GLVK 186

Query: 98  KQRFHKDIKVSITDIGGLVPLME----RNILLNKI--ADATVAKELMWGQ-QLPSEYMTT 150
           K   +KD   ++    G   L+E    RN++LN I  +D+   ++L W +  +P      
Sbjct: 187 K---YKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNEDHIPD----- 238

Query: 151 SVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLD 186
                     N+DL+VAAD  Y     P L   +LD
Sbjct: 239 ----------NLDLIVAADVTYDSSVIPSLCHCILD 264

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 84/187 (44%), Gaps = 29/187 (15%)

Query: 5   FGEYVGLID--------TRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGG-KVWIAGE 55
           F +YV L+         T  I +  S+D++ D Q  P +       ASG  G + W A  
Sbjct: 88  FEQYVQLLPLSSPSPTFTDIIRYRFSSDVAVDVQEQPYLLC-----ASGTTGFRTWEAAL 142

Query: 56  LLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIK-VSITDIGG 114
            L EYL++   ++          ILELG+GTGL    V L+  Q F   +K + +TD  G
Sbjct: 143 YLAEYLVQ---NQEYYAQDRFSRILELGAGTGL----VSLVWSQLFQATMKELYVTD--G 193

Query: 115 LVPLMERNILLN-KIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYA 173
              L+E+ I  N ++ + T A        L  +Y    +    D V +VD+V+AAD  Y 
Sbjct: 194 DSTLVEQAIRYNFQLNNVTAAP----ANTLDCQYKFQRLWWGEDVVPDVDIVLAADVTYD 249

Query: 174 EKAFPLL 180
               P L
Sbjct: 250 ASVVPSL 256

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 80/180 (44%), Gaps = 31/180 (17%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQR 100
              S  G + W A   LC+Y I   D+E+L        +LELG+GTGL   C   + K +
Sbjct: 110 SAMSTTGFRTWEAASYLCDY-ISNVDTESL---NGCSTVLELGAGTGL---CSLTLLKGK 162

Query: 101 FHKDI-KVSITD------IGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVD 153
           F  D+ KV +TD       G L+   + N + ++I      + L+WG+            
Sbjct: 163 FQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE------------ 210

Query: 154 GNCDNVSN-VDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRR-KADKRFF 211
              D++ N +D V+ AD  Y +  F  L K L      ++  + L+A   R  + D++F 
Sbjct: 211 ---DSIPNDIDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFL 267

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 13/157 (8%)

Query: 24  DLSFDGQLSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSD-SENLLCDGSIKNILE 81
           D  F  +L   + +YE    +   G K W +  +L   LI+K    E          +LE
Sbjct: 200 DFKFQ-RLQTTVTLYEPSLTNDNLGWKTWGSSLILSRILIDKLPFPEPPKVGHPPFRVLE 258

Query: 82  LGSGTGLVGICVGLMEKQRF---HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELM 138
           LGSGTGLVGI      ++ +     ++++ +TD+  +V  +++N+ LNK+  A VA  L 
Sbjct: 259 LGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLD 318

Query: 139 WGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
           W    P  ++        +   + DL++ AD +Y+ +
Sbjct: 319 WTN--PYNFIE-----RYNGEQSFDLILVADPIYSPE 348

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 18/186 (9%)

Query: 43  ASGCGGKVW----IAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEK 98
           A   G K W    I GE++  YL  ++ S     +  ++  LELG+GTGLVGI      +
Sbjct: 207 ADNLGWKTWGSSLILGEIVVSYL--ENLSSTFESNRKVRT-LELGAGTGLVGIAWAAKWR 263

Query: 99  QRF-HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCD 157
            +F +   ++ +TD+  +V  ++ N+ +N + D   A  L W    P  +  T   GN  
Sbjct: 264 DKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTN--PDTF--TEKYGN-- 317

Query: 158 NVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRI--R 215
                D +V AD +Y+ +    +  +++     +    + +  R+R   ++ +  R+   
Sbjct: 318 --ERFDYIVIADPIYSPQHPEWVVNMIVKFLEVNGICHLEIPLRERYSKERDYLWRLLEE 375

Query: 216 KNFDVI 221
            N DV+
Sbjct: 376 HNLDVV 381

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 24/153 (15%)

Query: 29  GQLSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIK-NILELGSGT 86
             L   +K+YE    S   G K W +  +L   +      EN  C GS K  +LELGSGT
Sbjct: 190 NNLEKTIKLYEPALTSDNLGHKTWGSSLVLANRI---PTLEN--CSGSSKPRVLELGSGT 244

Query: 87  GLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIA--DATVAKELMWGQQLP 144
           GLVGI   +     F    +V +TD+  +VP +  N  LN ++  ++ +A  L W     
Sbjct: 245 GLVGITYTISHSNEFS---QVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDW----- 296

Query: 145 SEYMTTSVDGNCDNVSNV--DLVVAADCVYAEK 175
                T+ D   +   ++  D+++ AD +Y+ +
Sbjct: 297 -----TNHDSFVEKYGDIQFDIILIADPIYSPQ 324

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 69/146 (47%), Gaps = 21/146 (14%)

Query: 31  LSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLV 89
           L  ++K+YE    S   G K W +  +L         S+ ++   + K +LELGSGTGLV
Sbjct: 200 LDTSIKLYEPALTSDNLGLKTWGSSLML---------SQKIIGIPAGKRVLELGSGTGLV 250

Query: 90  GICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMT 149
           GI   L      + D  + +TD+  ++P ++ N+ LN + D T A  L W   L      
Sbjct: 251 GISYALT--HSINGDSVIFLTDLPEILPNLQYNVRLNNLNDVT-ADVLDWTDPL----SF 303

Query: 150 TSVDGNCDNVSNVDLVVAADCVYAEK 175
           T   GN       D +V AD +Y+ +
Sbjct: 304 TEKYGN----EPFDTIVIADPIYSPQ 325

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 34  AMKIYEDG-GASGCGGKVWIAGELLCEY---LIEKSDSENLLCDGSIKNILELGSGTGLV 89
            +++YE    A   G K W A  +L +    L+EK+  +  +       +LELGSGTGLV
Sbjct: 207 VIQLYEPSLTADNLGWKTWGASLILSQKVVNLLEKNKDQKHI---HPLRVLELGSGTGLV 263

Query: 90  GICVGLMEKQRF-HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYM 148
           GI      +Q F  ++I++ +TD+  +V  +++N+  N +     A  L W    P +++
Sbjct: 264 GIAWASKWRQSFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTN--PDDFI 321

Query: 149 TTSVDGNCDNVSNVDLVVAADCVYA----EKAFPLLEKILLDLTNCDNPPIILMAYRKRR 204
               D         D+++ AD +Y+    E    +L + L D   C     +   Y + R
Sbjct: 322 EKHGD------EKFDVILVADPIYSPNHPEWVVNMLCRFLKDNGVCHFEIPLRDKYARER 375

Query: 205 KADKRFFVRIRKNFDVIEIDDFS 227
           +   +     R NF VI  +DF+
Sbjct: 376 ELLSQLLE--RNNFSVIS-EDFT 395

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (50%), Gaps = 13/151 (8%)

Query: 31  LSPAMKIYEDG-GASGCGGKVWIAGELLCEYLIEK---SDSENLLCDGSIK-NILELGSG 85
           L  A+ +YE    A   G K W +  +L + ++++   +D + +   G+ +  +LELGSG
Sbjct: 202 LRNAIPLYEPSLTADNLGWKTWGSSLILSQLVVDRLHTADMDFVANRGTKRIKVLELGSG 261

Query: 86  TGLVGICVGLMEKQRFHKD-IKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLP 144
           TGLVG+      K+ +  D  ++ +TD+  +V  +++N+ LN + D   A+ L W    P
Sbjct: 262 TGLVGLSWASKWKELYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTN--P 319

Query: 145 SEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
             ++      N       D+++ AD +Y+ +
Sbjct: 320 QSFIDRFGYEN-----EFDIILIADPIYSPQ 345

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 45  GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKD 104
             G + W A   L  YLI++  S N++   S   ILELGSGTGLV +       Q+ +  
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCAS-NVVAAPS--RILELGSGTGLVSLLY-----QQLYPF 180

Query: 105 IKVSITDIGGLVPLMER---NILLNKIADATVAKELMWGQQLPSEYMTTSVDGNC-DNVS 160
            K+++TD G    + +R   N+ LN +      K+L+WG +          D N  DN  
Sbjct: 181 DKLTMTD-GDWDVVRKRIPGNLSLNDLKPGLEVKQLVWGPR----------DANSGDNQW 229

Query: 161 NVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNF 218
           + DL++ +D  Y ++    L + L  L   D     L+    R +A    F +  + +
Sbjct: 230 DYDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFEKYMREY 287

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 29/160 (18%)

Query: 31  LSPAMKIYEDG-GASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKN-------ILEL 82
           L   +K+YE    A   G K W +  +L + ++      N L +    N       ILEL
Sbjct: 216 LDQTVKLYEPSLTADNLGWKTWGSSLILSQKMV------NFLNNYKYSNQSDDKLRILEL 269

Query: 83  GSGTGLVGICVGLMEKQRFH-------KDIKVSITDIGGLVPLMERNILLNKIADATVAK 135
           G+GTGLVGI      K+           + ++ +TD+  +V  ++RNI +N + D   A 
Sbjct: 270 GAGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDLPEIVGNLQRNISINNLNDIARAS 329

Query: 136 ELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
            L W    P  ++    +         D+++ AD +Y+ K
Sbjct: 330 VLDWTN--PKSFIQEYSN------EKFDIILVADPIYSPK 361

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 32/152 (21%)

Query: 36  KIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGL 95
           K Y     +  G + W A   L +YL++  D+  L+ D    NILELG+GTGLV + +  
Sbjct: 112 KPYLISAMNTTGFRTWAASVYLSKYLVDHEDA--LINDDD--NILELGAGTGLVSLTIAS 167

Query: 96  MEKQRFHKDIKVSITD-----IGGLVPLMERNILLNKI-ADATVAKELMW----GQQLPS 145
           M+K + +K  ++ +TD     + G    M+ N  +N++  D  +  + +W     Q +P 
Sbjct: 168 MDKMKDNKLRRMYVTDGDSELVSG---QMQDNFQMNEVNVDNHIKLQKLWWNSPDQPIPE 224

Query: 146 EYMTTSVDGNCDNVSNVDLVVAADCVYAEKAF 177
                           V++V+ AD  Y    F
Sbjct: 225 R---------------VNVVIGADVTYDSTCF 241

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 108/258 (41%), Gaps = 39/258 (15%)

Query: 4   VFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYED----GGASGCGGKVWIAGELLCE 59
           ++ +Y+ L+ TR  +      + +       ++I E       AS  G + W A   + +
Sbjct: 86  LYEKYIELLSTRKPDPTMKEVVRYRFDEKVKIRIEETPNLISAASTTGFRTWEAALYMGD 145

Query: 60  YLIEKSDSENLLC---DGSIKNILELGSGTGLVGICVGLMEKQR-FHKDIKVSITDIGGL 115
           +LI K   +  L    D    N+LE+G+GTG+V +   L+EK R F   + V+  D   +
Sbjct: 146 FLINKPLQQLALMQKEDRKKLNVLEIGAGTGIVSLV--LLEKYREFVNRMYVTDGDSNLV 203

Query: 116 VPLMERNILLNKI-----ADATVAKELMWGQ-QLPSEYMTTSVDGNCDNVSNVDLVVAAD 169
              ++RN  LN        D  + + L WG  ++P                ++DLVVAAD
Sbjct: 204 ERQLKRNFELNDALCENGPDVKLQR-LWWGSDRIPD---------------DIDLVVAAD 247

Query: 170 CVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFV----RIRKNFDVIEIDD 225
             Y    FP L + L +        + L++   R ++  + F     +I  N+ V+    
Sbjct: 248 VTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQECNKIGLNYTVV---S 304

Query: 226 FSSHEKYMKQRTHLFELK 243
            + H+K  + R      K
Sbjct: 305 STEHDKDSESRMKTLTFK 322

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 59/139 (42%), Gaps = 16/139 (11%)

Query: 43  ASGCGG-KVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRF 101
           ASG  G + W A   L ++L + SD            ++ELG+GTG+V +    ++  R 
Sbjct: 137 ASGTTGFRTWEAALYLSQHLCKNSDEIMDELGKDQITVVELGAGTGIVSMTWAKLQHNRL 196

Query: 102 HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSN 161
            K + V+  D   +   M RN  LN +       + +W               N D+V +
Sbjct: 197 EK-LYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWW--------------NSDDVPD 241

Query: 162 VDLVVAADCVYAEKAFPLL 180
            DL++AAD  Y     P L
Sbjct: 242 NDLILAADVTYDSSVIPDL 260

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 25/109 (22%)

Query: 31  LSPAMKIYEDGGAS-GCGGKVWIAGELL----CEYLIEKSDSENLLCDGSIKNILELGSG 85
           L+ +++++E    S   G K W A  +L    C+ L     SENL        ILELG+G
Sbjct: 204 LATSIELHEPALTSDNLGLKTWGASLVLARKICQKLSTFEPSENL-------RILELGAG 256

Query: 86  TGLVGIC-------VGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNK 127
           TGLVGI        VG  +K R H      +TD+  +VP +++N+ LNK
Sbjct: 257 TGLVGIAFIQKILEVGSTQKFRVH------LTDLPDIVPNLQKNVDLNK 299

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 68/143 (47%), Gaps = 17/143 (11%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQR 100
            G S  G + W     L ++LI  ++ E  L + +  +++ELG+GTGLV +C+   + Q+
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLI--NNCEKYLIEKT--DVIELGAGTGLVSLCILENDLQK 191

Query: 101 FHKDIKVSITDIGG--LVPLMERNILLNKIA---DATVAKELMWGQQLPSEYMTTSVDGN 155
             K  KV +TD     +  ++ +N  LN +    +  + ++L W    P+E +    +G 
Sbjct: 192 GIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWND--PNEKIAGEDNG- 248

Query: 156 CDNVSNVDLVVAADCVYAEKAFP 178
                 + LVV AD  Y     P
Sbjct: 249 -----KIGLVVGADITYDNSVIP 266

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 82/186 (44%), Gaps = 35/186 (18%)

Query: 4   VFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYED----GGASGCGGKVWIAGELLCE 59
           ++ +Y+GL++    +   +  + +    S  +K+ E       A   G + W A   +  
Sbjct: 93  LYEKYIGLLNLGQPDPTNTDVIQYRFNDSIKIKLEETPYVVSAAGTTGFRTWEAALFMTS 152

Query: 60  YLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLM 119
           + +E    + +    S KNILELG+GTGLV I  GL ++     D K+ +TD  G   L+
Sbjct: 153 FFVETGYLDTM----SKKNILELGAGTGLVSI--GLCKQYEDSID-KIYVTD--GDSQLV 203

Query: 120 ERNILLN------KIADATVAKELMWGQQLPSEYMTTSVDGNCDNVS-NVDLVVAADCVY 172
           E  +L N         D  + ++L W               N D+V  ++DL+VAAD  Y
Sbjct: 204 EGQLLKNFNENELSHNDRVILQKLWW---------------NVDDVPLDLDLIVAADVTY 248

Query: 173 AEKAFP 178
                P
Sbjct: 249 DSSVVP 254

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 79/174 (45%), Gaps = 17/174 (9%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIK-NILELGSGTGLVGICVGLMEKQ 99
             AS  G + W A   + ++L+ +   E +  D   K N+LE+G+GTG+V + V L + +
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEPLLELVHGDDKKKLNVLEIGAGTGIVSL-VLLHKYR 187

Query: 100 RFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNV 159
            +   + V+  D   +   + RN  LN   DA       W +Q P   +     G+    
Sbjct: 188 EYVSKMYVTDGDSDLVETQLRRNFELN---DA-------WREQSPDIRLQRLWWGSDRVP 237

Query: 160 SNVDLVVAADCVYAEKAFPLLEKIL---LDLTNCDNPPIILMAYRKRRKADKRF 210
             V+LVVAAD  Y    FP L + L   L +++C     +L A  +    DK F
Sbjct: 238 DEVNLVVAADVTYDSTIFPELCQCLAECLAMSHC--KVCLLSATIRSYSTDKEF 289

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 70/149 (46%), Gaps = 18/149 (12%)

Query: 35  MKIYEDG-GASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNI--LELGSGTGLVGI 91
           +K+YE    A   G K W +  +L +YLI   +    + +  ++ +  LELG+GTGLVGI
Sbjct: 202 VKLYEPSLTADNLGWKTWGSSLVLSQYLINNFNKYINVNNCHVRKVRVLELGAGTGLVGI 261

Query: 92  CVGLMEKQRFH-------KDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLP 144
             G   K+          +++++ +TD+  +   + +N+  N+++D      L W    P
Sbjct: 262 SWGCKWKEEVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTD--P 319

Query: 145 SEYMTTSVDGNCDNVSNVDLVVAADCVYA 173
           + +  T  +           ++ AD +Y+
Sbjct: 320 TSFTNTHTE------EPFQYILIADPIYS 342

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 81/189 (42%), Gaps = 37/189 (19%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLC------DGSIKNILELGSGTGLVGICVG 94
             AS  G + W A   + ++LI K   E  L       D    N+LE+G+GTG+V + + 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 95  LMEKQRFHKDI-KVSITDIGGLVPLMERNILLN-KIADATVA-------KELMWGQ-QLP 144
               Q +   + K+ +TD  G   L+ER +  N ++ DA          + L WG  ++P
Sbjct: 187 ----QNYRNFVNKMYVTD--GDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWGSDKVP 240

Query: 145 SEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRR 204
                           ++DLVV AD  Y    FP L K L +    +   + L++   R 
Sbjct: 241 D---------------DIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRS 285

Query: 205 KADKRFFVR 213
           ++  + F +
Sbjct: 286 ESTDKLFAQ 294

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 73/180 (40%), Gaps = 24/180 (13%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLC----DGSIK-NILELGSGTGLVGICVGL 95
             AS  G + W A   + ++LI K   E        DG  K N+LE+G+GTG+V + + L
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQELAPVQGQDDGKKKLNVLEVGAGTGIVSLVI-L 185

Query: 96  MEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVA----KELMWGQQLPSEYMTTS 151
            +   F   + V+  D   +   ++RN  LN            + L WG     E     
Sbjct: 186 QKYHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWGSDRVPE----- 240

Query: 152 VDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFF 211
                    ++DLVV AD  Y     P L + L +    D   + L++   R ++  + F
Sbjct: 241 ---------DIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLF 291

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 70/152 (46%), Gaps = 16/152 (10%)

Query: 31  LSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLV 89
           LS  + +YE    S   G K W A  +L + +  + +S      G++  +LELGSGTGLV
Sbjct: 203 LSHRVSLYEPSLTSDNLGLKTWGASLILSQKICNRFNSI-FAGTGNLLRVLELGSGTGLV 261

Query: 90  GICVG--LMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIAD----ATVAKELMWGQQL 143
           GI       E +      ++ +TD+  +VP +++N+ +N +      A  A  L W    
Sbjct: 262 GITFSCKYKESKTALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTN-- 319

Query: 144 PSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
           P  +     D         D+++ AD +Y+ +
Sbjct: 320 PVSFTEKYGD------DKFDVILIADPIYSPQ 345

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 65/169 (38%), Gaps = 32/169 (18%)

Query: 24  DLSFDGQLSPAMKIYEDGGASGCGG-KVWIAGELLCEYLIEKSDSENLLCDGSIKNILEL 82
           +L+ D Q  P +       ASG  G + W +   L EYL E          G     LEL
Sbjct: 105 ELAIDVQEQPYLLC-----ASGTTGFRTWESALYLSEYLAENFPE---FSAGKFSRALEL 156

Query: 83  GSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIAD-------ATVAK 135
           G+GTGLV I    + K  + K++ V+  D   +      N  LN I         A   +
Sbjct: 157 GAGTGLVSIAWAKLFKG-YIKELIVTDGDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQ 215

Query: 136 ELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKIL 184
            L WG+               D V  VD+V+AAD  Y     P L   L
Sbjct: 216 RLWWGE---------------DAVPEVDIVLAADVTYDSSVIPSLTHCL 249

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 76/184 (41%), Gaps = 35/184 (19%)

Query: 4   VFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKI------YEDGGASGCGGKVWIAGELL 57
           ++ +YV L+D +      +  + +  ++SP +K+      Y    +   G + W A   L
Sbjct: 89  LYEKYVALLDVKQPSATTTDVIQY--RISPQVKVKIEETPYLISASGTTGFRTWEAALYL 146

Query: 58  CEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITD-IGGLV 116
             YL         + +GS   +LELG+GTG+V   + L    R     K+ +TD    L 
Sbjct: 147 SLYLATSCP----ITEGS--KVLELGAGTGMVSATLALTNPGRLD---KLYVTDGDWHLT 197

Query: 117 PLMERNILLNKIADA-TVAKELMWGQQLPSEYMTTSVDGNCDNV-SNVDLVVAADCVYAE 174
               +N  LN I  + T  ++L W               N D V + +D VVAAD  Y  
Sbjct: 198 QQARKNFSLNGIETSNTYFEQLRW---------------NEDPVPTKLDYVVAADVTYDS 242

Query: 175 KAFP 178
              P
Sbjct: 243 TVVP 246

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 55/135 (40%), Gaps = 31/135 (22%)

Query: 47  GGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIK 106
           G + W A   LC+YL  +           +  +LE+G+GTGLV   + L   Q       
Sbjct: 117 GHRTWEASLYLCQYLFRQD------WLPQVNEVLEIGAGTGLVSTALALAGHQ------- 163

Query: 107 VSITDIGGL-VPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLV 165
           V+ TD   + V  + +   LN++     A+ L WG Q P +                DLV
Sbjct: 164 VTSTDGDPMVVEQLRKTFNLNEV--NIEAQVLEWGLQKPPK---------------SDLV 206

Query: 166 VAADCVYAEKAFPLL 180
           VAAD  Y     P L
Sbjct: 207 VAADVTYDTAVIPSL 221

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 79  ILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKELM 138
           +LELG+GTGLVGI   +  +       ++ +TD+  +VP +  NI LN + +   A EL 
Sbjct: 240 VLELGAGTGLVGISYAIAHQA---STPQIILTDLPDIVPNLRSNIKLNNLKNVHAA-ELD 295

Query: 139 WGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEK 175
           W     +++ T       D     D+++ +D +Y+ +
Sbjct: 296 W-----TDHSTFIAQHGGD---KFDMILVSDPIYSPQ 324

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 56/149 (37%), Gaps = 47/149 (31%)

Query: 43  ASGCGG-KVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRF 101
           ASG  G + W A   LC YL E               +LELG+GTG+V +    ++  +F
Sbjct: 126 ASGSTGFRTWEAALYLCHYLCESRPR--------FGTMLELGAGTGIVSLTWHKLQSGQF 177

Query: 102 HKDIKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVD-------- 153
                                     +  AT   + + G+QL   +++  VD        
Sbjct: 178 --------------------------MTYATDGDKNIIGKQLKETFISNGVDLDKGNVHL 211

Query: 154 ----GNCDNVSNVDLVVAADCVYAEKAFP 178
                N D++   D+++AAD  Y   A P
Sbjct: 212 QRLLWNVDSIPKNDIILAADVTYDHTAIP 240

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 13/104 (12%)

Query: 77  KNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLNKIADATVAKE 136
           K +LELG+GTGLVGI   L        D  V +TD+  +VP +  N+ LN + +   A  
Sbjct: 230 KRVLELGAGTGLVGIAYALA---NIDAD-DVFVTDLPEIVPNLRHNLALNNLTNVR-ASV 284

Query: 137 LMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLL 180
           L W    P+ ++    +         D +  AD +Y+     LL
Sbjct: 285 LDWSD--PTSFLHEHGE------LQFDAIFVADPIYSPNHPQLL 320

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 52/142 (36%), Gaps = 32/142 (22%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKN--ILELGSGTGLVGICVGLMEK 98
             A   G + W A   L +YL          C   ++    LELG+GTGLV +      +
Sbjct: 123 AAAGTTGHRTWEAALYLADYL----------CRVPLRQSVALELGAGTGLVSLA---WLR 169

Query: 99  QRFHKDIKVSITDIGGLVPLMERNILLNKIADATVA--KELMWGQQLPSEYMTTSVDGNC 156
            R      ++  D   L   +  N+ LN +  +  A  + L W               N 
Sbjct: 170 SRPESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWW---------------NV 214

Query: 157 DNVSNVDLVVAADCVYAEKAFP 178
           D V   D+V+AAD  Y     P
Sbjct: 215 DEVPQNDIVLAADVTYDSTVLP 236

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 57/136 (41%), Gaps = 26/136 (19%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQR 100
            G    G + W A   +  YL+E              N++E+G+GTG+V I +  M+ Q 
Sbjct: 120 SGNGTTGLRTWEAALYMILYLLEHPVR---------GNVVEIGAGTGMVSIGIMKMQGQN 170

Query: 101 FHKDIKVSITDIGGLVP--LMERNILLNKIADATVAK--ELMWGQQLPSEYMTTSVDGNC 156
                 V +TD    V    + +N  LN I D T  K  ++ W     +E    + DG  
Sbjct: 171 IS---SVLVTDGDEYVANKQLPKNFQLNGIVDDTRVKFQKIRW-----NEDHLVNGDG-- 220

Query: 157 DNVSNVDLVVAADCVY 172
               NVD +V AD  Y
Sbjct: 221 ---PNVDYLVGADVTY 233

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 7/101 (6%)

Query: 29  GQLSPAMKIYEDGGAS-GCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTG 87
           G L   +K++E    S   G K W A  +L   L E         D     ILELG+GTG
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCENFSKFERQRD---LRILELGAGTG 254

Query: 88  LVGICVGL--MEKQRFHKDIKVSITDIGGLVPLMERNILLN 126
           LVGI + L  +E    H +  + +TD+  +V  ++ N+ +N
Sbjct: 255 LVGISLVLKMLESNSGH-NCSMHLTDLPEIVTNLKENVKIN 294

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 35.4 bits (80), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 60/145 (41%), Gaps = 23/145 (15%)

Query: 47  GGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLM-EKQRFHKDI 105
           G + W A   LC Y+ +       +   S+  +LELG GTG++ I   ++ + Q   K  
Sbjct: 115 GFRTWEAALFLCHYMTQHPGL--FVTHDSL--MLELGCGTGIISILYKMIKDSQGDCKAG 170

Query: 106 KVSITD-IGGLVPLMERNILLN----KIADATVA-KELMWGQQLPSEYMTTSVDGNCDNV 159
            + +TD    L+  +  N  LN       D  +  + L W +   S Y            
Sbjct: 171 TIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNEDELSNY------------ 218

Query: 160 SNVDLVVAADCVYAEKAFPLLEKIL 184
           + +DL++AAD  Y     P L K L
Sbjct: 219 NEIDLILAADVTYDTSVIPDLVKCL 243

>CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {ON}
           similar to uniprot|Q05874 Saccharomyces cerevisiae
           YLR285w
          Length = 256

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 78/178 (43%), Gaps = 25/178 (14%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQR 100
           G +   G  +W AG     +L    D    L   S KN+LELG+ + L  +  GL+  +R
Sbjct: 54  GSSPLWGHLLWNAGIYTARHL----DKYPELV--SNKNVLELGAASALPSLVAGLIGAKR 107

Query: 101 FHKDIKVSITDI--GGLVPLMERN---ILLNKIADATVAKELMWGQQLPSEYMTTSVDGN 155
                   +TD     L+  ++ N   I+ +++ +    +  +WG +   + +T  +DG+
Sbjct: 108 ------AVVTDYPDADLMANIQYNVNTIIPDELKENVRVEGYIWGNEY--DPLTIHLDGD 159

Query: 156 CDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRR--KADKRFF 211
                  DL++ +D V+       L +   DL   +   +++ +  +    +AD +FF
Sbjct: 160 ----KKFDLIILSDLVFNHNQHDKLLQTTKDLLATNGKALVVFSPHRPHLLEADLQFF 213

>KNAG0F03080 Chr6 (584425..585201) [777 bp, 258 aa] {ON} Anc_6.79
           YLR285W
          Length = 258

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 90/230 (39%), Gaps = 28/230 (12%)

Query: 4   VFGEYVGLIDTRPIEHLGSADLSFDGQLSPAMKIYED----GGASGCGGKVWIAGELLCE 59
           +F E  G +   P  H    D      +S + + + D    G +   G  +W +G    +
Sbjct: 12  LFEEPEGFLPPPPEPHYAEYDREMISPMSKSKQRHIDLKLVGSSPLWGHLLWNSGIYTAK 71

Query: 60  YLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLM 119
           +L +  +   L+ D   KN+LELG+   L  +  GL+  +R    +     D   L+ ++
Sbjct: 72  HLDKHPE---LVLD---KNVLELGAAGALPSVVAGLIGAKRV---VSTDYPD-ADLMSVI 121

Query: 120 ERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDN-VSNVDLVVAADCVYAEKAFP 178
             N    K  +    +  +WG         + V  + +N      LV+ +D V+      
Sbjct: 122 RENA---KSLENVSVEGYIWGNDY------SDVLSHLENPAEKFQLVILSDLVFNHTEHH 172

Query: 179 LLEKILLDLTNCDNPPIILMAYRKRR--KADKRFFVRIRKN--FDVIEID 224
            L K   DL + D   +++ +  +     AD  FF   +    FDV  I+
Sbjct: 173 KLLKTTRDLLSADGKALVVFSPHRPWLLDADLAFFETAKNEYGFDVERIE 222

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
           Anc_3.564 YGL241W
          Length = 1022

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 172 YAEKAFPLLEKILLD--LTNCDNPPII------LMAYRKRRKADKRFFVRIRK 216
           YAEK  PLL KI+ D   TN D  P++      LM + K++  D    V I K
Sbjct: 619 YAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKKKPVDSTLPVEISK 671

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 72/187 (38%), Gaps = 37/187 (19%)

Query: 41  GGASGCGGKVWIAGELLCEYLIEKSDSENLLCDGSIKNILELGSGTGLVGICVGLMEKQR 100
           G +   G  +W AG    ++L    D    L  G  KN+LELG+   L  +  GL+    
Sbjct: 53  GKSPLWGHMLWNAGIYTAKHL----DKHPGLVKG--KNVLELGAAAALPTVVCGLIGAN- 105

Query: 101 FHKDIKVSITDIGGLVPLMERNILLNKIAD--------------ATVAKELMWGQQLPSE 146
                KV  TD     P + +NI  N   +                V +  +WG +   E
Sbjct: 106 -----KVVSTDYPE--PELIQNIQYNVDHELYGGKPFSQDSNDRKVVVEGYIWGNEY--E 156

Query: 147 YMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRR-- 204
            + +   G     S  DL++ +DCV+       L + + DL   D   +++ +  + R  
Sbjct: 157 PILSHTGG-----SKFDLIILSDCVFNHTEHRKLLRCIKDLLANDGKALVVFSPHRPRLL 211

Query: 205 KADKRFF 211
             D  FF
Sbjct: 212 DVDLSFF 218

>KNAG0E01900 Chr5 (393289..394416) [1128 bp, 375 aa] {ON} Anc_2.259
           YIL110W
          Length = 375

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 118 LMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAF 177
           L ER++ L+ ++ +       WG++     +  S+   C+  +   LV+ ++ +Y  +  
Sbjct: 260 LAERHVTLDFVSGS-------WGRKFTD--IVHSLLPQCEGTTAASLVLTSETIYQPENL 310

Query: 178 PLLEKILLDLTN-CDNPPIILMAYR 201
           PL+ + LLDL      P  +L+A +
Sbjct: 311 PLITETLLDLKGYIGGPTTVLVAAK 335

>KLLA0F12430g Chr6 complement(1143594..1151609) [8016 bp, 2671 aa]
            {ON} similar to uniprot|P33892 Saccharomyces cerevisiae
            YGL195W GCN1 Positive regulator of the Gcn2p kinase
            activity forms a complex with Gcn20p proposed to
            stimulate Gcn2p activation by an uncharged tRNA
          Length = 2671

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 105  IKVSITDIGGLVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGN 155
            I +SITD  GL PL+++ + L K  D  VAK ++  ++LP+ +  T++D N
Sbjct: 2090 IFLSITDYEGLHPLLQQIMSLLKHED--VAKRIVVLERLPTFFDNTTLDYN 2138

>KNAG0F01830 Chr6 complement(347294..348241) [948 bp, 315 aa] {ON}
           Anc_6.240 YGL138C
          Length = 315

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 26/58 (44%)

Query: 139 WGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLDLTNCDNPPII 196
           W     SEY     +G+ +   N+D  V     YA+K   L+++ L + TN   P  I
Sbjct: 241 WTSHFTSEYEDREQEGSDETRKNIDTAVDIFAEYADKPHQLVKEWLANGTNMSFPKWI 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.140    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,598,984
Number of extensions: 1143359
Number of successful extensions: 2769
Number of sequences better than 10.0: 65
Number of HSP's gapped: 2739
Number of HSP's successfully gapped: 65
Length of query: 245
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 138
Effective length of database: 41,212,137
Effective search space: 5687274906
Effective search space used: 5687274906
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)