Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H031401.399ON30330316280.0
KNAG0H016901.399ON30330315560.0
Smik_14.3221.399ON30330315510.0
YNL006W (LST8)1.399ON30330315510.0
Suva_14.3421.399ON30330315500.0
Skud_14.3211.399ON30330315470.0
TDEL0B059701.399ON30330315410.0
ZYRO0E04620g1.399ON30330315320.0
CAGL0H03729g1.399ON30330315190.0
Kpol_487.71.399ON30330315060.0
SAKL0D08756g1.399ON30330314900.0
NCAS0G036001.399ON32730714920.0
NDAI0C026001.399ON30330314630.0
KLLA0D04840g1.399ON30330314600.0
KLTH0H12122g1.399ON30330314530.0
Kwal_0.2121.399ON30330314490.0
Ecym_12931.399ON30330314370.0
AAL009C1.399ON30330314340.0
TPHA0O007101.399ON30430413730.0
TBLA0D048701.399ON32732711941e-165
Kpol_1070.117.231ON6662922372e-21
KLLA0F27511g7.231ON6233012338e-21
ADL082C7.231ON5693022321e-20
NCAS0D047806.363ON6212322292e-20
Kwal_27.120538.544ON7552792302e-20
YIL046W (MET30)7.231ON6402922292e-20
TDEL0H021307.231ON5842942274e-20
KNAG0D016907.231ON6543092259e-20
CAGL0M05335g8.544ON8062842251e-19
KLTH0E12606g8.544ON7552792241e-19
ZYRO0A12980g8.544ON8243032232e-19
KLTH0E10120g8.435ON8262572232e-19
Suva_9.1547.231ON6382902222e-19
Smik_9.1447.231ON6302992213e-19
SAKL0F08404g7.231ON6433032203e-19
ZYRO0D16742g7.231ON6082912195e-19
Smik_2.3388.544ON8002852196e-19
KLTH0A04114g7.231ON6583092186e-19
TBLA0F042406.363ON7272302187e-19
ZYRO0A09636g8.435ON8082592152e-18
Skud_9.1237.231ON6392952133e-18
Skud_2.3248.544ON8022862134e-18
SAKL0H12760g8.435ON8412482134e-18
Ecym_25236.363ON6462312124e-18
AEL269C7.534ON4552192114e-18
Kwal_27.115858.435ON8232542124e-18
CAGL0C00737g8.435ON8162502115e-18
TBLA0H036208.544ON8122892116e-18
NCAS0C027108.435ON8152772091e-17
YBR198C (TAF5)8.544ON7982832091e-17
CAGL0L00781g7.231ON6732992091e-17
TDEL0B030208.544ON8313102081e-17
AEL246C8.544ON8152902081e-17
Ecym_70388.544ON8002902082e-17
TPHA0C011507.231ON6872992072e-17
Smik_12.2798.435ON8172472072e-17
SAKL0H09988g8.544ON7492822072e-17
Ecym_43437.231ON5833092062e-17
AGL234W6.363ON6292312053e-17
CAGL0E00561g6.363ON8362372054e-17
Kpol_1028.416.340ON5123342044e-17
KLLA0F10263g6.363ON6822472044e-17
KNAG0A037008.544ON8172862045e-17
Kwal_23.57697.231ON6273042036e-17
Smik_3.1726.340ON5153362028e-17
NCAS0B022008.544ON8222872028e-17
Suva_4.4528.544ON8002872028e-17
KAFR0C038302.663ON3812731991e-16
TPHA0G023802.431ON3182981971e-16
KAFR0I018807.231ON5912932001e-16
KNAG0E023102.431ON3193011961e-16
KLLA0E23453g8.544ON8262821992e-16
SAKL0A01276g6.340ON5153361973e-16
TPHA0M020006.363ON6992351983e-16
KAFR0C047406.363ON6652381973e-16
TPHA0L010808.435ON8352701973e-16
NCAS0A055206.363ON6713251974e-16
YLR222C (UTP13)8.435ON8172471974e-16
Suva_10.3168.435ON8182471974e-16
TBLA0D041307.231ON5743001965e-16
Kpol_1031.498.435ON7602741965e-16
TBLA0F005206.363ON6632541956e-16
KAFR0H017508.435ON7832911957e-16
Kpol_1028.236.363ON7442351958e-16
YCR072C (RSA4)6.340ON5153361948e-16
TPHA0M018306.340ON5153371948e-16
NDAI0C054908.544ON8592921949e-16
SAKL0H15532g8.324ON9412521941e-15
ZYRO0D08206g6.340ON5152971931e-15
TPHA0L016908.544ON8322901941e-15
TDEL0A077806.363ON6572361931e-15
ZYRO0D17292g6.363ON7182371921e-15
NDAI0A026107.231ON7673051921e-15
KNAG0D002506.363ON6553071922e-15
Skud_3.1566.363ON7132401922e-15
KLTH0A06380g6.325ON9152211922e-15
KAFR0E031808.544ON8143011912e-15
NDAI0E034408.435ON8572541912e-15
CAGL0J03476g6.340ON5173191902e-15
Suva_3.1096.340ON5153401903e-15
YCR084C (TUP1)6.363ON7132401903e-15
KLTH0A07282g6.363ON7252361903e-15
Kwal_23.62406.325ON9132211903e-15
Kwal_56.239208.324ON9372911903e-15
Suva_3.1216.363ON7002401894e-15
SAKL0A00660g6.363ON6602371894e-15
Kwal_23.64296.363ON7502361895e-15
Skud_3.1456.340ON5153391885e-15
Kpol_1024.428.544ON8432821885e-15
Kpol_297.72.431ON3182981855e-15
NDAI0I003506.340ON5153341875e-15
KLLA0C08547g6.340ON5153361876e-15
Skud_12.2858.435ON8172481886e-15
ZYRO0G20152g2.431ON3192981847e-15
Smik_3.1836.363ON7092401877e-15
TDEL0A075506.340ON5153191867e-15
KAFR0F043506.340ON5153361868e-15
KNAG0A025108.435ON8492481879e-15
TBLA0F041306.340ON5143441869e-15
TDEL0B020108.435ON8052521869e-15
Smik_12.1928.324ON9432541861e-14
Kpol_1048.598.544ON8502781861e-14
NCAS0A134307.231ON6082941851e-14
Ecym_24986.340ON5422991841e-14
Ecym_60982.431ON3182441812e-14
KLLA0F13244g8.435ON8142611852e-14
Skud_12.1988.324ON9432541852e-14
KNAG0I028406.340ON5192981842e-14
TPHA0C008108.324ON9372321842e-14
NCAS0D046106.340ON5152951822e-14
SAKL0A10406g1.534ON7112851833e-14
Ecym_41348.435ON8102551833e-14
TBLA0I025708.435ON8481571833e-14
Suva_13.2952.431ON3192981793e-14
Skud_13.2752.431ON3192981793e-14
Smik_13.3052.431ON3192981793e-14
YMR116C (ASC1)2.431ON3192981793e-14
CAGL0C03608g6.363ON6433051814e-14
Suva_10.2228.324ON9432541815e-14
NCAS0A151707.534ON4742121805e-14
YLR129W (DIP2)8.324ON9432341815e-14
TBLA0B091002.431ON3172981776e-14
NDAI0G025808.324ON9582981807e-14
KLTH0A06754g6.340ON5143341771e-13
KAFR0A005102.431ON3192971732e-13
KLTH0G12276g8.324ON9372911762e-13
ZYRO0F11110g7.322ON12012141762e-13
TDEL0A020702.431ON3192971722e-13
TBLA0A039508.324ON9362521743e-13
CAGL0M04279g8.324ON9402311744e-13
KNAG0H001802.663ON3892651724e-13
NCAS0C039908.67ON7303001734e-13
Kwal_23.63246.340ON5142981725e-13
Smik_11.2332.663ON4152871716e-13
NDAI0H027102.431ON3182961696e-13
Kpol_1036.698.324ON9362311726e-13
NCAS0C032608.324ON9832981727e-13
Smik_13.3442.380ON3472301697e-13
AER263C6.340ON5132971709e-13
CAGL0K09284g6.325ON9112351711e-12
Kpol_1054.601.534ON7193001701e-12
YKL213C (DOA1)1.534ON7152821701e-12
KNAG0G024508.324ON9422921701e-12
Suva_13.3252.380ON3472301671e-12
NCAS0G043001.534ON7252801691e-12
YKL021C (MAK11)2.663ON4682861682e-12
CAGL0I03718g7.322ON12012141692e-12
Smik_3.1576.325ON9242081682e-12
AFR199C2.431ON3342991662e-12
NCAS0D044806.325ON9152211682e-12
TDEL0F045008.324ON9382481682e-12
SAKL0E03960g2.431ON3202951652e-12
Skud_3.1336.325ON9162951672e-12
ZYRO0F10406g8.324ON9382321673e-12
Suva_3.936.325ON9202991673e-12
KAFR0J025506.325ON9062371673e-12
KAFR0A006002.450ON8943061663e-12
KLLA0D16390g8.324ON9362371664e-12
Skud_13.3072.380ON3472301644e-12
Suva_11.2052.663ON4152871645e-12
Suva_6.518.67ON7632921655e-12
YCR057C (PWP2)6.325ON9232151646e-12
KAFR0H022608.324ON9382291647e-12
Skud_6.638.67ON7812921638e-12
Skud_11.2072.663ON4152891628e-12
NCAS0A042702.431ON3182961618e-12
KNAG0F038707.534ON4651811628e-12
YMR146C (TIF34)2.380ON3472301619e-12
SAKL0A01738g6.325ON9092211631e-11
TPHA0D038306.325ON9122101621e-11
NDAI0H030302.380ON3501881601e-11
NCAS0F033405.429ON4482641611e-11
SAKL0F15972g7.534ON4701761611e-11
KLTH0H15752g2.380ON3502341601e-11
TBLA0C018408.672ON4232461611e-11
NDAI0B051901.247ON6682561611e-11
KLTH0A00880g7.534ON4712521602e-11
AGR180W8.435ON8062441612e-11
KLTH0D11132g8.672ON4372371602e-11
TDEL0D013101.247ON7092131602e-11
Kpol_1028.546.325ON9052351602e-11
NCAS0F018502.431ON3182961582e-11
Suva_16.1598.672ON4512461592e-11
ACR166W2.663ON3892841582e-11
KAFR0E039005.429ON4392551592e-11
Ecym_24018.672ON4262261583e-11
Kpol_2001.657.322ON12062141593e-11
Kwal_26.87768.672ON4332361583e-11
KLLA0C08976g6.325ON9112351593e-11
YDL145C (COP1)7.322ON12012141593e-11
TPHA0B011201.247ON7192121583e-11
KNAG0I025406.325ON9182351583e-11
Smik_4.907.322ON12012141594e-11
KLLA0E07965g2.663ON3903011574e-11
Smik_11.101.534ON7172821584e-11
TBLA0F022307.322ON12162141584e-11
TPHA0P014903.25ON4592781565e-11
TPHA0D045007.322ON12082881585e-11
KLTH0D04466g2.431ON3192291555e-11
NDAI0I004606.325ON9172371575e-11
Suva_4.997.322ON12012901575e-11
Ecym_42558.324ON9372761575e-11
Smik_5.200na 1ON3912911556e-11
TBLA0I022806.325ON9272351576e-11
SAKL0F10648g7.322ON12032141576e-11
AGL196C8.324ON9352911576e-11
Skud_16.1318.672ON4512461556e-11
NDAI0A020907.322ON12002141567e-11
NCAS0A139407.322ON12052141568e-11
Ecym_28087.534ON4652341558e-11
AER255C5.429ON4672221558e-11
ZYRO0F07282g8.672ON4272391549e-11
YKR036C (CAF4)1.247ON6432191559e-11
Skud_4.1097.322ON12012141559e-11
KAFR0L013907.322ON12062141559e-11
Suva_11.71.534ON7192821551e-10
NCAS0C044503.25ON4612781541e-10
Smik_16.4427.534ON4702381541e-10
Ecym_80901.247ON7162861541e-10
KNAG0B027207.322ON12042151541e-10
YPL151C (PRP46)8.672ON4512461531e-10
CAGL0L03201g1.247ON5792641531e-10
KLLA0B14410g1.534ON7062931531e-10
Smik_6.708.67ON7832921531e-10
ADR264C2.380ON3462411521e-10
Smik_6.3488.672ON4512401522e-10
Suva_16.5107.534ON4652511522e-10
ZYRO0F14960g8.585ON3192041512e-10
CAGL0F06853g2.663ON3882691522e-10
TDEL0C022407.322ON12012141532e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H03140
         (303 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...   631   0.0  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...   603   0.0  
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...   602   0.0  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...   602   0.0  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...   601   0.0  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...   600   0.0  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....   598   0.0  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...   594   0.0  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...   589   0.0  
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...   584   0.0  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...   578   0.0  
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...   579   0.0  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}     568   0.0  
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...   566   0.0  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...   564   0.0  
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...   562   0.0  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...   558   0.0  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...   556   0.0  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...   533   0.0  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...   464   e-165
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    96   2e-21
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    94   8e-21
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    94   1e-20
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     93   2e-20
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    93   2e-20
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    93   2e-20
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    92   4e-20
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    91   9e-20
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    91   1e-19
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    91   1e-19
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    91   2e-19
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    91   2e-19
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    90   2e-19
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    90   3e-19
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    89   3e-19
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    89   5e-19
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    89   6e-19
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    89   6e-19
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    89   7e-19
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    87   2e-18
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    87   3e-18
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    87   4e-18
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    87   4e-18
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    86   4e-18
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    86   4e-18
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    86   4e-18
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    86   5e-18
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    86   6e-18
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    85   1e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    85   1e-17
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    85   1e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    85   1e-17
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    85   1e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    85   2e-17
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    84   2e-17
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    84   2e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    84   2e-17
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    84   2e-17
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    84   3e-17
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    84   4e-17
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    83   4e-17
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    83   4e-17
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    83   5e-17
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    83   6e-17
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    82   8e-17
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    82   8e-17
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    82   8e-17
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    81   1e-16
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    80   1e-16
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    82   1e-16
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    80   1e-16
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    81   2e-16
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    80   3e-16
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    81   3e-16
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    80   3e-16
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    80   3e-16
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    80   4e-16
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    80   4e-16
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    80   4e-16
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    80   5e-16
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    80   5e-16
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    80   6e-16
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    80   7e-16
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    80   8e-16
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    79   8e-16
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    79   8e-16
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             79   9e-16
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    79   1e-15
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    79   1e-15
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    79   1e-15
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    79   1e-15
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    79   1e-15
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     79   1e-15
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    79   2e-15
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    79   2e-15
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    79   2e-15
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    78   2e-15
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    78   2e-15
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    78   2e-15
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    78   3e-15
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    78   3e-15
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    78   3e-15
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    78   3e-15
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    78   3e-15
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    77   4e-15
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    77   4e-15
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    77   5e-15
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    77   5e-15
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    77   5e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    76   5e-15
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       77   5e-15
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    77   6e-15
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    77   6e-15
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    75   7e-15
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    77   7e-15
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    76   7e-15
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    76   8e-15
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    77   9e-15
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    76   9e-15
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    76   9e-15
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    76   1e-14
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    76   1e-14
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    76   1e-14
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    75   1e-14
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    74   2e-14
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    76   2e-14
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    76   2e-14
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    75   2e-14
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    75   2e-14
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     75   2e-14
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    75   3e-14
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    75   3e-14
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    75   3e-14
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    74   3e-14
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    74   3e-14
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    74   3e-14
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    74   3e-14
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    74   4e-14
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    74   5e-14
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    74   5e-14
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    74   5e-14
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    73   6e-14
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    74   7e-14
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    73   1e-13
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    71   2e-13
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    72   2e-13
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    72   2e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    71   2e-13
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    72   3e-13
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    72   4e-13
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    71   4e-13
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    71   4e-13
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    71   5e-13
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    70   6e-13
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    70   6e-13
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    71   6e-13
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    71   7e-13
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    70   7e-13
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    70   9e-13
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    70   1e-12
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    70   1e-12
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    70   1e-12
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    70   1e-12
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    69   1e-12
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    70   1e-12
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    69   2e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    70   2e-12
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    69   2e-12
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    69   2e-12
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    69   2e-12
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    69   2e-12
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    68   2e-12
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    69   2e-12
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    69   3e-12
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    69   3e-12
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    69   3e-12
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    69   3e-12
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    69   4e-12
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    68   4e-12
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    68   5e-12
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    68   5e-12
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    68   6e-12
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    68   7e-12
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    67   8e-12
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    67   8e-12
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    67   8e-12
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    67   8e-12
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    67   9e-12
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    67   1e-11
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    67   1e-11
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    66   1e-11
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    67   1e-11
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    67   1e-11
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    66   1e-11
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    67   1e-11
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    67   1e-11
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    66   2e-11
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    67   2e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    66   2e-11
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    66   2e-11
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    66   2e-11
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    65   2e-11
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    66   2e-11
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    65   2e-11
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    66   2e-11
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    65   3e-11
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    66   3e-11
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    65   3e-11
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    66   3e-11
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    66   3e-11
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    65   3e-11
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    65   3e-11
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    66   4e-11
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    65   4e-11
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    65   4e-11
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    65   4e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    65   5e-11
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    65   5e-11
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    64   5e-11
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       65   5e-11
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    65   5e-11
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    65   5e-11
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    64   6e-11
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    65   6e-11
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    65   6e-11
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    65   6e-11
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    64   6e-11
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    65   7e-11
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    65   8e-11
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    64   8e-11
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    64   8e-11
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    64   9e-11
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    64   9e-11
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    64   9e-11
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    64   9e-11
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    64   1e-10
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      64   1e-10
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    64   1e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    64   1e-10
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    64   1e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    64   1e-10
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    64   1e-10
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    64   1e-10
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    64   1e-10
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    63   1e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    63   2e-10
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    63   2e-10
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    63   2e-10
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    63   2e-10
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    64   2e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    63   2e-10
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    63   2e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    63   2e-10
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    63   2e-10
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    62   3e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    63   3e-10
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    63   3e-10
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    63   3e-10
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    62   3e-10
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      62   4e-10
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    62   4e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    62   4e-10
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    62   4e-10
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    62   5e-10
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               61   6e-10
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    61   7e-10
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    61   7e-10
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    60   8e-10
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    61   8e-10
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    61   8e-10
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    62   8e-10
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    61   8e-10
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    61   9e-10
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    61   1e-09
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    60   1e-09
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    61   1e-09
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    60   1e-09
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    60   1e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    60   1e-09
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    60   1e-09
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    60   1e-09
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    60   2e-09
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    60   2e-09
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    60   2e-09
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    60   2e-09
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    60   2e-09
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    60   2e-09
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    60   2e-09
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    60   2e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    60   2e-09
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    57   2e-09
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    60   2e-09
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    60   2e-09
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    59   3e-09
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    60   3e-09
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     59   3e-09
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    60   3e-09
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    59   3e-09
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    59   3e-09
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    59   3e-09
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    59   3e-09
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    59   4e-09
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    59   4e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     59   4e-09
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    59   4e-09
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    59   4e-09
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    59   4e-09
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     59   4e-09
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    59   4e-09
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    59   5e-09
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    59   5e-09
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    59   5e-09
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    59   5e-09
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    58   6e-09
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    59   6e-09
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    59   6e-09
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    59   6e-09
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    59   7e-09
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    58   7e-09
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    58   7e-09
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    59   7e-09
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    58   8e-09
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    58   8e-09
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    58   8e-09
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    58   9e-09
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    58   9e-09
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    58   9e-09
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    57   9e-09
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    57   1e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    58   1e-08
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    58   1e-08
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    58   1e-08
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    58   1e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    57   1e-08
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    58   1e-08
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    58   1e-08
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    57   1e-08
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    57   1e-08
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    58   1e-08
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    57   1e-08
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    58   1e-08
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    57   1e-08
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    57   1e-08
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    57   1e-08
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    57   1e-08
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    58   1e-08
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    57   2e-08
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    57   2e-08
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    57   2e-08
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    57   2e-08
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      57   2e-08
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    57   2e-08
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    57   2e-08
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    57   2e-08
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    57   2e-08
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    57   2e-08
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    57   2e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      56   2e-08
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    57   2e-08
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    56   3e-08
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    56   3e-08
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    57   3e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    56   3e-08
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    57   3e-08
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    56   3e-08
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    56   3e-08
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    57   3e-08
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    56   3e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    56   3e-08
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    56   3e-08
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    56   3e-08
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    57   3e-08
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    56   3e-08
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    56   3e-08
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    56   3e-08
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    56   4e-08
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    56   4e-08
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    56   4e-08
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    56   4e-08
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    56   4e-08
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    56   4e-08
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    56   5e-08
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    55   5e-08
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    55   5e-08
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    56   5e-08
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    56   5e-08
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    55   5e-08
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    55   5e-08
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    55   5e-08
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    55   5e-08
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    56   6e-08
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    55   6e-08
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    55   6e-08
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    55   6e-08
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    56   6e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    55   6e-08
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    55   6e-08
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    55   6e-08
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    55   7e-08
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    55   7e-08
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    55   7e-08
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    55   8e-08
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    55   8e-08
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    55   8e-08
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    55   8e-08
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    55   9e-08
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    55   1e-07
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    55   1e-07
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    54   1e-07
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    55   1e-07
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    55   1e-07
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    55   1e-07
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    55   1e-07
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    54   1e-07
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    54   1e-07
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    54   1e-07
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    54   2e-07
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    54   2e-07
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    54   2e-07
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    54   2e-07
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    54   2e-07
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    54   2e-07
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    54   2e-07
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    54   2e-07
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    54   2e-07
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    54   2e-07
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    54   2e-07
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    54   2e-07
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    54   2e-07
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    54   2e-07
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     54   2e-07
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    53   2e-07
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    54   2e-07
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    54   2e-07
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    54   2e-07
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    54   3e-07
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    54   3e-07
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    53   3e-07
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    54   3e-07
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    54   3e-07
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    53   3e-07
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    53   3e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    53   3e-07
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    53   3e-07
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    54   3e-07
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    53   3e-07
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    54   3e-07
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    53   3e-07
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    54   3e-07
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    53   3e-07
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    53   4e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    53   4e-07
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    52   4e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    53   4e-07
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    53   4e-07
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    53   4e-07
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    53   4e-07
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    53   5e-07
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    53   5e-07
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    53   5e-07
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    53   5e-07
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    53   5e-07
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    52   5e-07
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    53   5e-07
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    53   5e-07
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    52   5e-07
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    52   5e-07
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    53   5e-07
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    52   6e-07
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    53   6e-07
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    52   6e-07
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    52   6e-07
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    53   6e-07
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    52   6e-07
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    52   6e-07
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    52   6e-07
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    52   6e-07
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    52   6e-07
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    52   6e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    52   6e-07
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    52   6e-07
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    52   7e-07
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    52   7e-07
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    52   7e-07
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    52   7e-07
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    52   7e-07
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    52   8e-07
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    52   8e-07
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    52   8e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    52   8e-07
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    52   8e-07
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    52   8e-07
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    52   8e-07
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    52   9e-07
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    52   9e-07
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    52   9e-07
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    52   9e-07
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    52   9e-07
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    52   9e-07
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    52   1e-06
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    52   1e-06
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    52   1e-06
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    52   1e-06
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    52   1e-06
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    52   1e-06
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    50   1e-06
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    51   1e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    52   1e-06
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    52   1e-06
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    52   1e-06
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    52   1e-06
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    51   1e-06
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    52   1e-06
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    51   1e-06
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    51   1e-06
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    51   1e-06
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    51   1e-06
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    51   1e-06
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    51   1e-06
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    51   2e-06
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    51   2e-06
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    51   2e-06
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    51   2e-06
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    51   2e-06
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    51   2e-06
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    51   2e-06
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    51   2e-06
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    51   2e-06
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    51   2e-06
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    51   2e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    51   2e-06
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    51   2e-06
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    51   2e-06
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    51   2e-06
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    51   2e-06
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    51   2e-06
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    50   2e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    51   2e-06
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    51   2e-06
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    51   2e-06
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    50   2e-06
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    50   2e-06
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    50   2e-06
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       50   2e-06
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    50   2e-06
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    51   2e-06
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    50   2e-06
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    50   2e-06
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    50   3e-06
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    50   3e-06
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    50   3e-06
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    50   3e-06
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    50   3e-06
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     50   3e-06
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    50   3e-06
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   3e-06
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    50   3e-06
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    50   3e-06
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    50   3e-06
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    50   3e-06
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    50   3e-06
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    50   3e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    50   3e-06
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    50   3e-06
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    50   3e-06
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    50   3e-06
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    50   3e-06
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    50   3e-06
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    50   4e-06
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    50   4e-06
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    50   4e-06
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    49   4e-06
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    50   4e-06
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    49   4e-06
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    49   4e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    50   4e-06
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    49   4e-06
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    50   4e-06
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    49   4e-06
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    50   4e-06
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    50   4e-06
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    49   4e-06
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    49   4e-06
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    50   4e-06
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    50   4e-06
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    50   5e-06
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    50   5e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    50   5e-06
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    49   5e-06
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    50   5e-06
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    49   5e-06
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    49   5e-06
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    50   5e-06
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    49   5e-06
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    49   5e-06
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    50   5e-06
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    49   6e-06
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    49   6e-06
ZYRO0F14146g Chr6 (1162473..1163828) [1356 bp, 451 aa] {ON} simi...    49   6e-06
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    49   6e-06
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    49   6e-06
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    49   6e-06
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    49   6e-06
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    49   6e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    49   6e-06
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    49   7e-06
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    49   7e-06
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    49   7e-06
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    49   7e-06
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    49   7e-06
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    49   8e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    49   8e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    49   8e-06
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    49   8e-06
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    49   9e-06
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    49   9e-06
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    49   9e-06
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    49   1e-05
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    49   1e-05
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    49   1e-05
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    49   1e-05
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    49   1e-05
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    49   1e-05
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    49   1e-05
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    49   1e-05
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    49   1e-05
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    48   1e-05
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    49   1e-05
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     49   1e-05
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    49   1e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    49   1e-05
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    49   1e-05
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    48   1e-05
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    48   1e-05
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    48   1e-05
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    48   1e-05
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    49   1e-05
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    49   1e-05
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    49   1e-05
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    49   1e-05
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    48   2e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    48   2e-05
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    48   2e-05
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    48   2e-05
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    48   2e-05
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    48   2e-05
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    48   2e-05
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    48   2e-05
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    48   2e-05
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    48   2e-05
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    48   2e-05
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    48   2e-05
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    48   2e-05
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    47   2e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    47   3e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    47   3e-05
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    47   3e-05
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    47   3e-05
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    47   3e-05
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    47   3e-05
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    47   3e-05
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    47   3e-05
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    47   3e-05
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    47   3e-05
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    47   3e-05
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    47   4e-05
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    47   4e-05
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    47   4e-05
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    47   4e-05
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    47   4e-05
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    47   4e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    47   4e-05
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    47   4e-05
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      47   4e-05
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    47   4e-05
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    46   4e-05
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    47   4e-05
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    47   5e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    47   5e-05
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    47   5e-05
ABL096W Chr2 (217132..218472) [1341 bp, 446 aa] {ON} Syntenic ho...    46   5e-05
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    47   5e-05
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    47   5e-05
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    46   5e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    47   5e-05
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    46   5e-05
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    47   5e-05
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    47   6e-05
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    46   6e-05
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    46   7e-05
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    46   7e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    46   7e-05
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    46   7e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    46   7e-05
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    46   7e-05
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    46   7e-05
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    46   7e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    46   7e-05
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    46   8e-05
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    46   8e-05
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    46   8e-05
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    46   8e-05
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   8e-05
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    46   9e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    46   9e-05
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    45   9e-05
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    46   9e-05
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    46   9e-05
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    45   1e-04
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    45   1e-04
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    45   1e-04
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    45   1e-04
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    45   1e-04
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    45   1e-04
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    45   1e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    45   1e-04
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    45   1e-04
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    45   1e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    45   1e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   1e-04
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    45   1e-04
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    45   1e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    45   1e-04
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    45   1e-04
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    45   1e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    45   1e-04
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    45   2e-04
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    45   2e-04
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    45   2e-04
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    45   2e-04
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    45   2e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    45   2e-04
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    45   2e-04
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    45   2e-04
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    45   2e-04
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    45   2e-04
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    45   2e-04
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    45   2e-04
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    45   2e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    44   2e-04
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    45   2e-04
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    44   2e-04
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    44   2e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    44   2e-04
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    44   3e-04
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    44   3e-04
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    44   3e-04
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    44   3e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    44   3e-04
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    44   3e-04
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    44   3e-04
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    44   3e-04
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    44   3e-04
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    44   3e-04
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    44   3e-04
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    44   3e-04
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    44   4e-04
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    44   4e-04
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    44   4e-04
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    44   4e-04
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    44   4e-04
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    44   4e-04
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    44   4e-04
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    44   4e-04
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    44   4e-04
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    44   4e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    44   4e-04
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    43   4e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    44   4e-04
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    44   5e-04
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    44   5e-04
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    44   5e-04
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    43   5e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    44   5e-04
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    44   5e-04
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    43   5e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    44   5e-04
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    44   5e-04
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    44   5e-04
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    44   5e-04
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    44   5e-04
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    44   5e-04
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    44   5e-04
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    43   6e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    43   6e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    43   6e-04
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    43   6e-04
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    43   6e-04
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    43   6e-04
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    43   7e-04
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    43   7e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    43   7e-04
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    43   7e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    43   7e-04
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    43   7e-04
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    43   7e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    43   7e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    43   8e-04
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    43   8e-04
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    43   8e-04
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    43   8e-04
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    43   8e-04
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    42   8e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    43   8e-04
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    42   9e-04
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    42   9e-04
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    43   0.001
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    42   0.001
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    42   0.001
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    43   0.001
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    42   0.001
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    42   0.001
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    42   0.001
TDEL0D02290 Chr4 complement(442275..443876) [1602 bp, 533 aa] {O...    42   0.001
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    42   0.001
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    42   0.001
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    42   0.001
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.001
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    42   0.001
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    42   0.001
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    42   0.001
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    42   0.001
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    42   0.001
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    42   0.002
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    42   0.002
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    42   0.002
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    41   0.002
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    41   0.002
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.002
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    42   0.002
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    41   0.002
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    42   0.002
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    41   0.002
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    41   0.002
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    42   0.002
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    41   0.002
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    41   0.002
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    41   0.002
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    41   0.002
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    41   0.002
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    41   0.003
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    41   0.003
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    41   0.003
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    41   0.003
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    41   0.003
TPHA0C00610 Chr3 complement(112452..113798) [1347 bp, 448 aa] {O...    41   0.003
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    41   0.003
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    41   0.003
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    41   0.003
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               41   0.003
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    40   0.003
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    41   0.003
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    41   0.003
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    41   0.003
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    41   0.003
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    40   0.003
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    40   0.003
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    40   0.004
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    41   0.004
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    40   0.004
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    41   0.004
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.004
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    40   0.004
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    40   0.004
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    40   0.004
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    40   0.004
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    40   0.004
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    40   0.005
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    40   0.005
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    40   0.005
ZYRO0C12188g Chr3 (953145..959606) [6462 bp, 2153 aa] {ON} simil...    40   0.005
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    40   0.005
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    40   0.005
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    40   0.006
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    40   0.006
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    40   0.006
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    40   0.006
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               40   0.006
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    40   0.006
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    40   0.006
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    40   0.007
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    40   0.007
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    40   0.007
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    40   0.007
Ecym_5534 Chr5 complement(1080033..1082465) [2433 bp, 810 aa] {O...    40   0.007
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    40   0.007
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    40   0.007
Ecym_3559 Chr3 complement(1060241..1061944) [1704 bp, 567 aa] {O...    40   0.007
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    40   0.007
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    40   0.007
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    40   0.008
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    39   0.008
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    40   0.008
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    39   0.008
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    40   0.008
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    40   0.008
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    40   0.008
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    40   0.008
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    40   0.009
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    39   0.009
ZYRO0G00946g Chr7 complement(72544..74184) [1641 bp, 546 aa] {ON...    39   0.009
SAKL0F15730g Chr6 (1278090..1279715) [1626 bp, 541 aa] {ON} simi...    39   0.009
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    39   0.009
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    39   0.009
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    39   0.009
Ecym_8312 Chr8 complement(636090..638663) [2574 bp, 857 aa] {ON}...    39   0.010
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    39   0.010
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    39   0.011
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    39   0.011
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    39   0.011
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    39   0.011
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    39   0.011
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    39   0.011
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    39   0.011
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.012
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    39   0.012
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    39   0.013
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    39   0.013
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.013
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    39   0.014
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    39   0.014
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    39   0.014
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    39   0.014
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    39   0.015
Kpol_1006.15 s1006 complement(54320..55933) [1614 bp, 537 aa] {O...    39   0.015
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    39   0.015
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    39   0.016
TPHA0D01010 Chr4 complement(204354..206117) [1764 bp, 587 aa] {O...    39   0.017
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    39   0.017
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    39   0.017
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    39   0.017
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    38   0.018
TBLA0D04560 Chr4 (1130244..1131584) [1341 bp, 446 aa] {ON} Anc_7...    39   0.018
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    39   0.018
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    38   0.019
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    39   0.019
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    39   0.019
Kwal_0.49 s0 (20604..22358) [1755 bp, 584 aa] {ON} YJL069C (UTP1...    39   0.020
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    38   0.020
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    38   0.020
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    39   0.021
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    39   0.021
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    38   0.021
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    38   0.021
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    38   0.021
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    38   0.021
Smik_4.319 Chr4 (570640..573624) [2985 bp, 994 aa] {ON} YDR080W ...    39   0.022
CAGL0K10692g Chr11 (1040242..1041759) [1518 bp, 505 aa] {ON} sim...    38   0.022
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    38   0.022
Kwal_0.356 s0 (169040..170620) [1581 bp, 526 aa] {ON} YFR021W (A...    38   0.023
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    38   0.023
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    38   0.024
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    38   0.024
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    38   0.024
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    38   0.025
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    38   0.026
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    38   0.026
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    38   0.026
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    38   0.026
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    38   0.027
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    38   0.027
Skud_4.335 Chr4 (579305..582289) [2985 bp, 994 aa] {ON} YDR080W ...    38   0.027
TDEL0F01000 Chr6 (176870..178516) [1647 bp, 548 aa] {ON} Anc_8.1...    38   0.028
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    38   0.028
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    38   0.028
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    38   0.030
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    38   0.030
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    38   0.031
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    38   0.033
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    38   0.033
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    38   0.034
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    37   0.034
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    37   0.034
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    37   0.034
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    38   0.034
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    38   0.035
KLTH0H11022g Chr8 (947447..949195) [1749 bp, 582 aa] {ON} simila...    38   0.035
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     38   0.035
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    37   0.035
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    37   0.035
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    37   0.036
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    37   0.037
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    37   0.038
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    37   0.040
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    37   0.041
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    37   0.041
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    37   0.043
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    37   0.044
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.045
Kpol_1018.67 s1018 (194053..195033) [981 bp, 326 aa] {ON} (19405...    37   0.045
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    37   0.046
TBLA0C02620 Chr3 (622295..624985) [2691 bp, 896 aa] {ON} Anc_1.3...    37   0.047
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    37   0.048
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      37   0.049
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    37   0.049
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    37   0.049
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    37   0.049
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    37   0.050
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    37   0.053
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    37   0.053
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    37   0.054
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    37   0.055
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    37   0.055
YDR080W Chr4 (604008..606986) [2979 bp, 992 aa] {ON}  VPS41Vacuo...    37   0.057
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    37   0.057
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    37   0.058
SAKL0H18436g Chr8 complement(1637161..1640109) [2949 bp, 982 aa]...    37   0.059
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    37   0.059
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    37   0.060
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    37   0.064
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    37   0.065
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    37   0.068
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    37   0.068
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    37   0.068
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    36   0.069
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    37   0.070
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    37   0.070
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    37   0.073
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    37   0.075
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    36   0.076
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    37   0.077
NDAI0J00810 Chr10 complement(179995..181353) [1359 bp, 452 aa] {...    36   0.078
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    37   0.078
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    37   0.080
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    37   0.081
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    36   0.082
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    37   0.083
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    37   0.083
NCAS0B04140 Chr2 complement(748270..751122) [2853 bp, 950 aa] {O...    37   0.085
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    36   0.085
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    36   0.086
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    36   0.086
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    36   0.090
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    36   0.091
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    36   0.091
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    36   0.095
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    36   0.095
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    36   0.096
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    36   0.096
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    36   0.10 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    36   0.10 
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    36   0.10 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               36   0.10 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    36   0.10 
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    36   0.11 
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    36   0.11 
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    36   0.11 
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    36   0.11 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    36   0.11 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    36   0.11 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    36   0.11 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    36   0.11 
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    36   0.11 
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    36   0.11 
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    36   0.11 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    36   0.12 
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    36   0.12 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.12 
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    36   0.12 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    36   0.12 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    36   0.12 
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    36   0.12 
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    36   0.13 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    36   0.13 
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    36   0.13 
ZYRO0D15510g Chr4 (1296067..1297374) [1308 bp, 435 aa] {ON} simi...    36   0.13 
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    36   0.13 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    35   0.13 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    36   0.13 
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    36   0.13 
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    35   0.13 
TDEL0F01750 Chr6 (325359..328655) [3297 bp, 1098 aa] {ON} Anc_6....    36   0.14 
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    36   0.14 
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              36   0.14 
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    36   0.14 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    36   0.15 
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    35   0.15 
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    35   0.15 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    35   0.15 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    35   0.15 
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    35   0.16 
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    35   0.16 
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    35   0.16 
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    35   0.16 
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    35   0.16 
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    35   0.17 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    35   0.17 
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    35   0.17 
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    35   0.17 
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    35   0.18 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    35   0.18 
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    35   0.18 
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               35   0.18 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    35   0.18 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    35   0.18 
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    35   0.19 
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    35   0.19 
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    35   0.19 
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    35   0.20 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    35   0.20 
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    35   0.20 
ZYRO0B15290g Chr2 (1246428..1247783) [1356 bp, 451 aa] {ON} simi...    35   0.20 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    35   0.20 
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    35   0.21 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    35   0.21 
YER124C Chr5 complement(407342..409063) [1722 bp, 573 aa] {ON}  ...    35   0.21 
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    35   0.21 
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    35   0.22 
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    35   0.23 
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    35   0.23 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    35   0.23 
CAGL0K02277g Chr11 (203760..205463) [1704 bp, 567 aa] {ON} simil...    35   0.24 
Smik_11.117 Chr11 (199819..202362) [2544 bp, 847 aa] {ON} YKL121...    35   0.24 
TPHA0E03510 Chr5 (741718..748116) [6399 bp, 2132 aa] {ON} Anc_1....    35   0.24 
TDEL0H02670 Chr8 complement(447727..449049) [1323 bp, 440 aa] {O...    35   0.24 
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    35   0.24 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    35   0.25 
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    35   0.25 
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    35   0.26 
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    35   0.26 
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    35   0.27 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    35   0.27 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    35   0.27 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    35   0.27 
TPHA0A05030 Chr1 complement(1134867..1136255) [1389 bp, 462 aa] ...    35   0.28 
Smik_7.332 Chr7 (556142..557641) [1500 bp, 499 aa] {ON} YFR021W ...    35   0.28 
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    35   0.28 
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    35   0.29 
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    34   0.29 
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    35   0.30 
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    35   0.30 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    34   0.31 
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.31 
Smik_4.409 Chr4 (742877..744220) [1344 bp, 447 aa] {ON} YDR165W ...    35   0.31 
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    34   0.31 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    35   0.34 
Suva_2.240 Chr2 (404330..407275) [2946 bp, 981 aa] {ON} YDR080W ...    35   0.35 
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    34   0.35 
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    34   0.35 
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    34   0.36 
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   0.36 
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    34   0.36 
KLLA0F01991g Chr6 complement(179904..182510) [2607 bp, 868 aa] {...    35   0.36 
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    34   0.36 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    34   0.37 
AGR149W Chr7 (1028985..1031642) [2658 bp, 885 aa] {ON} Syntenic ...    34   0.37 
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    34   0.39 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    34   0.39 
KAFR0E00720 Chr5 (153164..154477) [1314 bp, 437 aa] {ON} Anc_8.5...    34   0.41 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    34   0.41 
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    34   0.41 
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    34   0.42 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    34   0.43 
AEL153W Chr5 (343247..344950) [1704 bp, 567 aa] {ON} Syntenic ho...    34   0.44 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    34   0.47 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    34   0.48 
NDAI0F00770 Chr6 (185453..188332) [2880 bp, 959 aa] {ON} Anc_5.6...    34   0.48 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    34   0.48 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    34   0.48 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    34   0.49 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    34   0.49 
KAFR0A01660 Chr1 complement(339554..341353) [1800 bp, 599 aa] {O...    34   0.49 
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    34   0.50 
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    34   0.50 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    34   0.51 
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    34   0.51 
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    34   0.51 
TPHA0O01210 Chr15 complement(238057..239778) [1722 bp, 573 aa] {...    34   0.52 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    34   0.52 
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    34   0.52 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    34   0.53 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    33   0.53 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    33   0.58 
Kpol_1055.37 s1055 (93164..95716) [2553 bp, 850 aa] {ON} (93164....    34   0.58 
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    33   0.59 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   0.59 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    33   0.61 
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    34   0.61 
YIR012W Chr9 (378486..379781) [1296 bp, 431 aa] {ON}  SQT1Essent...    33   0.62 
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   0.62 
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    33   0.62 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    33   0.63 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    34   0.65 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    33   0.71 
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    33   0.72 
NDAI0I01440 Chr9 (343925..345076) [1152 bp, 383 aa] {ON} Anc_6.1...    33   0.73 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    33   0.75 
Kpol_242.8 s242 (12067..13335) [1269 bp, 422 aa] {ON} (12067..13...    33   0.76 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    33   0.76 
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    33   0.76 
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    33   0.76 
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    33   0.77 
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    33   0.77 
KLTH0C05456g Chr3 complement(468453..471500) [3048 bp, 1015 aa] ...    33   0.79 
KNAG0C02000 Chr3 (392436..393917) [1482 bp, 493 aa] {ON} Anc_1.3...    33   0.82 
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    33   0.83 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   0.83 
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    33   0.83 
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    33   0.83 
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    33   0.83 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    33   0.83 
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    33   0.87 
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    33   0.88 
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    33   0.88 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    33   0.89 
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    33   0.90 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    33   0.90 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    33   0.91 
NCAS0B08480 Chr2 (1619636..1626055) [6420 bp, 2139 aa] {ON} Anc_...    33   0.92 
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    33   0.93 
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    33   0.93 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    33   0.95 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    33   0.96 
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    33   0.97 
CAGL0I03212g Chr9 (275826..278717) [2892 bp, 963 aa] {ON} no sim...    33   0.98 
Smik_15.204 Chr15 (345627..346652) [1026 bp, 341 aa] {ON} YOR026...    33   1.00 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    33   1.0  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    33   1.0  
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     33   1.0  
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    33   1.0  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    33   1.0  
NCAS0A12450 Chr1 (2459574..2460878) [1305 bp, 434 aa] {ON} Anc_7...    33   1.1  
Suva_16.211 Chr16 (371708..373201) [1494 bp, 497 aa] {ON} YPL100...    33   1.1  
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    33   1.1  
KLTH0F03806g Chr6 complement(336740..343105) [6366 bp, 2121 aa] ...    33   1.1  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    33   1.2  
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    33   1.2  
NCAS0H02330 Chr8 complement(458362..460311) [1950 bp, 649 aa] {O...    33   1.2  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   1.2  
SAKL0H09130g Chr8 (778200..779408) [1209 bp, 402 aa] {ON} simila...    33   1.2  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   1.2  
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    33   1.2  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    33   1.2  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    33   1.3  
KLLA0E06425g Chr5 complement(574273..577239) [2967 bp, 988 aa] {...    33   1.3  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   1.3  
NCAS0A08960 Chr1 (1774232..1775620) [1389 bp, 462 aa] {ON} Anc_1...    32   1.4  
SAKL0G03916g Chr7 (322002..323873) [1872 bp, 623 aa] {ON} simila...    32   1.4  
Smik_9.212 Chr9 (354323..355615) [1293 bp, 430 aa] {ON} YIR012W ...    32   1.5  
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    32   1.5  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    32   1.5  
YPL100W Chr16 (361872..363362) [1491 bp, 496 aa] {ON}  ATG21Phos...    32   1.5  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    32   1.5  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    32   1.5  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    32   1.6  
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    32   1.6  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    32   1.6  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    32   1.6  
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    32   1.7  
SAKL0H25740g Chr8 (2254859..2254871,2254990..2256593) [1617 bp, ...    32   1.7  
TPHA0A01250 Chr1 (240466..241863) [1398 bp, 465 aa] {ON} Anc_8.5...    32   1.7  
ABR189W Chr2 (764141..765370) [1230 bp, 409 aa] {ON} Syntenic ho...    32   1.7  
YCR032W Chr3 (179520..186023) [6504 bp, 2167 aa] {ON}  BPH1PProt...    32   1.7  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    32   1.7  
Smik_16.136 Chr16 (245086..246576) [1491 bp, 496 aa] {ON} YPL100...    32   1.8  
KLLA0C11759g Chr3 (1011298..1013889) [2592 bp, 863 aa] {ON} simi...    32   1.8  
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    32   1.8  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    32   1.8  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    32   1.8  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    32   1.8  
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    32   1.9  
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    32   1.9  
Kwal_47.18825 s47 complement(989263..991137) [1875 bp, 624 aa] {...    32   1.9  
Skud_5.254 Chr5 (412459..414180) [1722 bp, 573 aa] {ON} YER124C ...    32   1.9  
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    32   1.9  
Ecym_7072 Chr7 complement(146021..147247) [1227 bp, 408 aa] {ON}...    32   1.9  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    32   2.0  
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    32   2.0  
NCAS0B04530 Chr2 complement(823022..824746) [1725 bp, 574 aa] {O...    32   2.0  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    32   2.0  
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    32   2.0  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    32   2.0  
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    32   2.1  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    32   2.1  
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    32   2.1  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   2.2  
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    32   2.2  
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    32   2.2  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    32   2.2  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    32   2.3  
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    32   2.3  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   2.4  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    32   2.4  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    32   2.4  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    32   2.4  
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    32   2.5  
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    32   2.5  
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    32   2.5  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    32   2.5  
Skud_16.182 Chr16 (333354..334838) [1485 bp, 494 aa] {ON} YPL100...    32   2.5  
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    32   2.5  
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               32   2.5  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    32   2.5  
TPHA0D04410 Chr4 (949150..951882) [2733 bp, 910 aa] {ON} Anc_8.2...    32   2.6  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    32   2.6  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    32   2.6  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   2.7  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    32   2.7  
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    32   2.7  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    32   2.7  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    32   2.8  
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    32   2.8  
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    32   2.8  
NCAS0A09260 Chr1 (1829435..1831219) [1785 bp, 594 aa] {ON} Anc_1...    32   2.8  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    32   2.9  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    32   2.9  
Kwal_55.19926 s55 (180008..180946) [939 bp, 312 aa] {ON} YOR026W...    31   3.0  
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    32   3.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    31   3.0  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    31   3.0  
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    32   3.1  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    32   3.1  
TPHA0A00660 Chr1 (118435..120429) [1995 bp, 664 aa] {ON} Anc_3.9...    32   3.2  
KAFR0K00510 Chr11 (107850..109355) [1506 bp, 501 aa] {ON} Anc_7....    31   3.2  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    31   3.2  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    31   3.3  
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    31   3.3  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    31   3.3  
Suva_9.223 Chr9 (366063..367358) [1296 bp, 431 aa] {ON} YIR012W ...    31   3.4  
SAKL0C04422g Chr3 complement(431806..438456) [6651 bp, 2216 aa] ...    32   3.4  
Smik_5.269 Chr5 complement(416222..417940) [1719 bp, 572 aa] {ON...    31   3.4  
TDEL0G01290 Chr7 (261621..262943) [1323 bp, 440 aa] {ON} Anc_5.1...    31   3.4  
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    31   3.4  
TPHA0F02850 Chr6 complement(633867..635480) [1614 bp, 537 aa] {O...    31   3.5  
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    31   3.5  
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    31   3.5  
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    31   3.6  
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    31   3.7  
YJL069C Chr10 complement(310922..312706) [1785 bp, 594 aa] {ON} ...    31   3.7  
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    31   3.7  
Suva_8.79 Chr8 (141412..142443) [1032 bp, 343 aa] {ON} YOR026W (...    31   3.8  
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    31   3.8  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    31   3.8  
SAKL0H22638g Chr8 complement(1968593..1972378) [3786 bp, 1261 aa...    31   3.8  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    31   3.9  
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    31   3.9  
Smik_8.285 Chr8 (466829..468553) [1725 bp, 574 aa] {ON} YHR196W ...    31   3.9  
TDEL0A05240 Chr1 complement(924979..926271) [1293 bp, 430 aa] {O...    31   3.9  
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    31   4.0  
KNAG0B02990 Chr2 (577427..579097) [1671 bp, 556 aa] {ON} Anc_7.2...    31   4.1  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    31   4.1  
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    31   4.1  
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    31   4.2  
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    31   4.3  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    31   4.5  
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    31   4.5  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    31   4.6  
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    31   4.6  
CAGL0F02541g Chr6 (248281..250173) [1893 bp, 630 aa] {ON} simila...    31   4.6  
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    31   4.7  
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    31   4.7  
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    31   4.8  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    31   4.9  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    31   5.0  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    31   5.1  
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    31   5.1  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    31   5.1  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    31   5.2  
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    30   5.2  
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    30   5.4  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    31   5.4  
CAGL0A00781g Chr1 (77746..81366) [3621 bp, 1206 aa] {ON} similar...    31   5.5  
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    31   5.5  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    30   5.5  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    30   5.7  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    31   5.8  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    31   5.8  
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    30   5.9  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    30   6.0  
ZYRO0G03564g Chr7 complement(281481..284786) [3306 bp, 1101 aa] ...    31   6.0  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    30   6.1  
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    30   6.1  
Skud_4.671 Chr4 (1189343..1191271) [1929 bp, 642 aa] {ON} YDR398...    30   6.2  
Skud_4.762 Chr4 complement(1348926..1350539) [1614 bp, 537 aa] {...    30   6.2  
NDAI0B02440 Chr2 complement(611035..612675) [1641 bp, 546 aa] {O...    30   6.2  
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    30   6.2  
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    30   6.3  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    30   6.4  
Smik_16.82 Chr16 (154481..155830) [1350 bp, 449 aa] {ON} YGR223C...    30   6.5  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    30   6.7  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    30   6.8  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    30   7.0  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    30   7.0  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    30   7.0  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    30   7.1  
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    30   7.1  
ZYRO0B11264g Chr2 (888911..891631) [2721 bp, 906 aa] {ON} simila...    30   7.2  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    30   7.2  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    30   7.2  
ZYRO0E02354g Chr5 (178826..180592) [1767 bp, 588 aa] {ON} simila...    30   7.2  
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    30   7.2  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    30   7.3  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    30   7.3  
KAFR0G01280 Chr7 (286915..288597) [1683 bp, 560 aa] {ON} Anc_3.9...    30   7.3  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    30   7.4  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    30   7.4  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    30   7.5  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    30   7.5  
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               30   7.7  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    30   7.7  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    30   7.7  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    30   7.7  
KLLA0E15885g Chr5 (1419922..1420941) [1020 bp, 339 aa] {ON} weak...    30   7.9  
YJR109C Chr10 complement(629585..632941) [3357 bp, 1118 aa] {ON}...    30   7.9  
Kwal_14.1924 s14 complement(529306..532131) [2826 bp, 941 aa] {O...    30   8.3  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    30   8.4  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    30   8.4  
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    30   8.5  
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    30   8.7  
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    30   8.7  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    30   8.9  
KLLA0F02013g Chr6 (183770..185470) [1701 bp, 566 aa] {ON} simila...    30   9.1  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    30   9.3  
SAKL0A03322g Chr1 complement(304459..305004) [546 bp, 181 aa] {O...    29   9.7  
Ecym_8134 Chr8 (277019..283225) [6207 bp, 2068 aa] {ON} similar ...    30   9.7  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    30   9.8  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    30   9.8  
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    30   9.8  
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    30   9.8  

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/303 (100%), Positives = 303/303 (100%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN
Sbjct: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF
Sbjct: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 297/303 (98%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL AAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGHKGNVTSLSFQQDN+WMV+SSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+ PLQS+SVASDGSMLVAAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNC+VWEMPNHTDASNLKPVTKFKAH++YITRILLSSDVKHLATCSAD T R WS+D+NF
Sbjct: 181 GNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE+VRQYGGHHKG +CVAL
Sbjct: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL  AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+T LQSLS+ASDGSML AAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPNHTDAS+LKPVTKF+AHS YITRILLSSDVKHLATCSAD TAR WS+DD+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL  AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+T LQSLS+ASDGSML AAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPNHTDAS+LKPVTKF+AHS YITRILLSSDVKHLATCSAD TAR WS+DD+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL  AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+T LQSLS+ASDGSML AANSK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPNHTDAS+LKPVTKF+AHS YITRILLSSDVKHLATCSAD TAR WS++D+F
Sbjct: 181 GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/303 (93%), Positives = 295/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL  AGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPS+PRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+T LQSLS+ASDGSML AANSK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPN TDAS+LKPVTKF+AHS YITRILLSSDVKHLATCSAD TAR WS+DD+F
Sbjct: 181 GNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/303 (92%), Positives = 298/303 (98%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT+DKKLL AAGHQNVRLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDN+WMV+SSEDGTIKVWDVR+PSVPRNYKHNAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+TPLQSLS+ASDGSMLVAANSK
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPN TDASNLKPVTKF++H+ YITRILLSSDVKHLATCSAD TAR WS+D+NF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST+EIVRQYGGHHKGA+CVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/303 (92%), Positives = 296/303 (97%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL AAGHQNVRLYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPVA+FEGH+GNVTS+SFQQDN+WM TSSEDGTIKVWDVR+PS+PRNYK NAPVN
Sbjct: 61  RTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDG+IRIWDLGENQCTHQLTPED+TPLQSLS+ASDGSMLVAAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPN TDASNLKPVTKF++H+ YITRILLSSDVKHLATCSAD TAR WS+DDNF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYL+TASSDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/303 (90%), Positives = 293/303 (96%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVC RTIQH DSQVNRLEITNDKKLL AAGHQN+RLYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           +T+N NPVA+FEGH+GNVTS+SFQQDN+WMVTSSEDGTIKVWD+RSPSVPRNYKHNAPVN
Sbjct: 61  KTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+ PLQSLSVASDGSMLVAAN+K
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPNHTDASNLKP TKFKAH +YITR+LLSSDVKH+ATCSAD TAR WS++DNF
Sbjct: 181 GNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            LESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR+I+RQYGGHHKGA+CVAL
Sbjct: 241 NLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/303 (91%), Positives = 288/303 (95%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL ITNDKKLL AAGHQNV+LYDI
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
            TTNPNPVA+FEGH+GNVTSLSFQ DNRWMVTSSEDGTIKVWDVRSPSVPR YKHNAPVN
Sbjct: 61  NTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EV IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED+TP+QSLS+A+DGSMLVAANSK
Sbjct: 121 EVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAANSK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVWEMPN TDASNLKPVTKF+AH  YITRILLSSDVK LATCSAD TAR WS+DDNF
Sbjct: 181 GNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            L +TLDGHQRWVWDCAFSADSAYL+TASSDHYVRLWDLSTREIVRQY GHHKGA+CVAL
Sbjct: 241 NLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/303 (88%), Positives = 292/303 (96%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ L AAGH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPV +FEGH+GNVTS+SFQQDN+WMV+SSEDGTIKVWDVR+PSV RNYKH+APVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCD+DGNIRIWDLGENQCTHQLTPED+TPLQSLS+ASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MPNHTDA+NLKPVTKF++H+ YITR+LLSSDVKHLATCSAD TAR WS++DNF
Sbjct: 181 GNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           KLE+TLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/307 (89%), Positives = 293/307 (95%), Gaps = 4/307 (1%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLL AAG+QNVRLYDI
Sbjct: 21  MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDI 80

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPN VATFEGHKGNVTS+SFQQDN+WMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN
Sbjct: 81  RTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 140

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP-EDNTPLQSLSVASDGSMLVAANS 179
           EVVIHPNQGELISCDRDG I+IWDLGENQCTHQL P +DNT LQSLSVASDGSMLVAAN+
Sbjct: 141 EVVIHPNQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANN 200

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL--- 236
           KG+CYVWEMPNHTDASNLKP+ KF AH +YITR++LSSDVKH+ATCSAD+TA+ WS+   
Sbjct: 201 KGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGET 260

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAI 296
           +D+F LE+TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA+
Sbjct: 261 EDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAV 320

Query: 297 CVALNDV 303
           CVALNDV
Sbjct: 321 CVALNDV 327

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/303 (86%), Positives = 285/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSV+LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRL+ITNDKKLL AAGH NV+LYDI
Sbjct: 1   MSVLLVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLQITNDKKLLAAAGHLNVKLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
            TTNPNPV +FEGHKGNVTS+SFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN
Sbjct: 61  NTTNPNPVGSFEGHKGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQ+TPE++  L+SLS+ASDGSML AAN +
Sbjct: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQITPEEDVSLESLSIASDGSMLAAANDR 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCY+WEMPNHTDASNLKPV  F AH  Y+TR+LLSSDVKHLATCSAD++AR WS+++ F
Sbjct: 181 GNCYIWEMPNHTDASNLKPVKTFSAHETYVTRVLLSSDVKHLATCSADQSARIWSVENGF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           + E  L+GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QRECALEGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           +DV
Sbjct: 301 DDV 303

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  567 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/303 (86%), Positives = 289/303 (95%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DKK L AAGH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           R+ NPNPV++FEGHKGNVTS++FQQ+NRWMV+SSEDGTIKVWDVRSPSV RNYKHNAPVN
Sbjct: 61  RSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EV IHPNQGELISCD+DGNIRIWDLGENQCT+QLTPEDNTPLQSLSVASDGSMLVA N+K
Sbjct: 121 EVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MP+HTDAS L+PVTKFK+H+ YITR+LLS+DVKHLATCSAD TAR W+++DNF
Sbjct: 181 GNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLST EIVRQYGGHHKGA+CVAL
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/303 (86%), Positives = 287/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT+DK+ L AAGH NVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPV +FEGH+GNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PSV RNYKH+A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQC HQL PED+TPLQSLSVASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MP+ TDA+N +PVTKF++H+ YITR+LLSSDVKHLATCSAD TAR WS+DDNF
Sbjct: 181 GNCYVWQMPHQTDAANPRPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLDGHQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/303 (85%), Positives = 285/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI++DK+ L AAGH NVRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPV +FEGH+GNVTS++FQQ+N+WMV+SSEDGTIKVWDVR+PSV RNYKH A VN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCD+DGN+RIWDLGENQC HQL PED+TPLQSLSVASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MP+ TDA+N KPVTKF++H+ YITR+LLSSDVKHLATCSAD TAR WS+DDNF
Sbjct: 181 GNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLD HQRWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGAICVAL
Sbjct: 241 QLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/303 (84%), Positives = 285/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ L A GH +VRLYDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAGGHLHVRLYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPV +FEGH+GNVTS++FQQDN+WMV+SSEDGTIKVWDVR+PSV RNYKHNAPVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRTPSVQRNYKHNAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQCTHQL  ED+TPLQSLS+ASDGSMLVA ++K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTHQLALEDDTPLQSLSIASDGSMLVAGSNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MPNHTD +NLKPVTKF++H+ YITR+LLS DVKHLATCSAD TAR WS++DNF
Sbjct: 181 GNCYVWKMPNHTDTANLKPVTKFRSHTKYITRVLLSVDVKHLATCSADHTARVWSIEDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLD H RWVWDCAFSADSAYLVTA SDHY+RLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDTHSRWVWDCAFSADSAYLVTACSDHYIRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL006W
           (LST8)
          Length = 303

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/303 (84%), Positives = 285/303 (94%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVIL SAGYDHTIRFWEALTGVCSRTIQH+DSQVNRLEIT+DK+ L AAGH +VR+YDI
Sbjct: 1   MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDI 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           RTTNPNPV +FEGH+GNVTS++FQQDN+WMV+SSEDGTIKVWDVRSPSV RNYKH+APVN
Sbjct: 61  RTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           EVVIHPNQGELISCD+DGNI+IWDLGENQCT+QL  EDNT LQSLS+ASDGSMLVA N+K
Sbjct: 121 EVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNK 180

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
           GNCYVW+MPNHTD ++LKPVTKF++HS YITR+LLS DVKHLATCSAD TAR WS++DNF
Sbjct: 181 GNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNF 240

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +LE+TLD H RWVWDCAFSADSAYLVTA SDHYVRLWDLSTREIVRQYGGHHKGA+CVAL
Sbjct: 241 QLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 301 NDV 303
           NDV
Sbjct: 301 NDV 303

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/304 (80%), Positives = 277/304 (91%), Gaps = 1/304 (0%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQH DSQVN+LEITNDKKLL AAG  N++LYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPDSQVNKLEITNDKKLLAAAGSNNIKLYDV 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
            T+N NP+A+F+GHK NVTS++FQ +N+WMVTSSED TIK+WD+RSPS PR YKHN PVN
Sbjct: 61  NTSNSNPIASFDGHKNNVTSINFQVENKWMVTSSEDNTIKLWDIRSPSSPRTYKHNCPVN 120

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDN-TPLQSLSVASDGSMLVAANS 179
           EV+IHPNQGELISCD+DGNIRIWDLGENQCTHQLTPEDN   +QS+S+A+DGSMLVAAN+
Sbjct: 121 EVIIHPNQGELISCDKDGNIRIWDLGENQCTHQLTPEDNDISIQSISLANDGSMLVAANN 180

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
           KGNCYVW+MPN  DASNLKP+TKFKAH +YIT+ILLSSDVK++ATCSAD TAR WS++DN
Sbjct: 181 KGNCYVWDMPNKIDASNLKPITKFKAHDSYITKILLSSDVKYMATCSADHTARIWSVEDN 240

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           F L+ TL GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST EIVRQY GH KGA CVA
Sbjct: 241 FTLDKTLTGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTNEIVRQYSGHQKGATCVA 300

Query: 300 LNDV 303
           LND+
Sbjct: 301 LNDI 304

>TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {ON}
           Anc_1.399 YNL006W
          Length = 327

 Score =  464 bits (1194), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/327 (67%), Positives = 262/327 (80%), Gaps = 24/327 (7%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           MSVILVSAGYDHTIRFWEALTGVCSRTIQH +SQVNRLEI++DK LL AA +Q+VRLYD+
Sbjct: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHPESQVNRLEISSDKTLLAAAANQSVRLYDL 60

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV-PRNYKHN--- 116
           ++ NP P+A  +GH GNVT+++FQ++ +W+ T+SEDG ++VWDVRSP   PR Y H    
Sbjct: 61  QSANPTPLACLDGHGGNVTAVAFQRERQWIATASEDGAVRVWDVRSPPTQPRIYLHGSSG 120

Query: 117 -------------------APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
                              APVN+V IHPNQ EL+SCDR G +R+WDL   + THQL PE
Sbjct: 121 SSSSTSGNSSSASSVGTGAAPVNDVAIHPNQAELVSCDRSGTLRVWDLAGGRSTHQLVPE 180

Query: 158 DNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
           D+ PLQSLS++ DGS LVAAN+KGNCYVW+MPN TDAS+LKP++ FKAH+ YITR LLSS
Sbjct: 181 DDIPLQSLSLSPDGSTLVAANTKGNCYVWDMPNRTDASSLKPLSVFKAHNTYITRALLSS 240

Query: 218 DVKHLATCSADKTARTWSLD-DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
           D KH+ATCSAD TA+ WS+D ++  LE TLDGHQRWVWDCAFSADSAYLVTASSDHYVRL
Sbjct: 241 DGKHIATCSADHTAKIWSIDNESVNLEITLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 300

Query: 277 WDLSTREIVRQYGGHHKGAICVALNDV 303
           WDLST+EIVRQYGGH KG ICVALND+
Sbjct: 301 WDLSTKEIVRQYGGHQKGVICVALNDI 327

>Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON}
           (30012..32012) [2001 nt, 667 aa]
          Length = 666

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 126/292 (43%), Gaps = 26/292 (8%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +  +   V  L   +D+KL+  +  + +R+++  T 
Sbjct: 321 LLFTGSYDSTIAIWDLSTGKLLRRLTGNGDGVKTLHF-DDQKLITGSLDKTIRVWNYVTG 379

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  +V S+   +  + +V+ S D T+KVW + S +      H   VN V 
Sbjct: 380 EC--ISTYRGHTDSVMSIDSYK--KIIVSGSADKTVKVWHIESRACYTLRGHTEWVNCVK 435

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +HP      SC  D  IR+WD+  N C      H    +   PL  L V +    LV   
Sbjct: 436 LHPKSFSCFSCSDDTTIRMWDIRSNSCLKVFRGHVGQVQKVIPLTILDVEN----LVVDQ 491

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
              N    E     D  +     K      Y T         HL +CS D T + W +  
Sbjct: 492 VPDNLSSSETQESNDEEDTSENVKLDESLPYPT---------HLLSCSLDNTIKLWDVKT 542

Query: 239 NFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
              + +   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 543 GNCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGTIKIWDLQSGKCMHTFAG 591

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 84/221 (38%), Gaps = 56/221 (25%)

Query: 71  FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGE 130
           F+GH   V +L F  + R + T S D TI +WD+ +  + R    N       +H +  +
Sbjct: 305 FKGHMDGVLTLQF--NYRLLFTGSYDSTIAIWDLSTGKLLRRLTGNGD-GVKTLHFDDQK 361

Query: 131 LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
           LI+   D  IR+W+    +C                                        
Sbjct: 362 LITGSLDKTIRVWNYVTGEC---------------------------------------- 381

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                    ++ ++ H++ +  I   S  K + + SADKT + W ++   +   TL GH 
Sbjct: 382 ---------ISTYRGHTDSVMSI--DSYKKIIVSGSADKTVKVWHIES--RACYTLRGHT 428

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 429 EWVNCVKLHPKSFSCFSCSDDTTIRMWDIRSNSCLKVFRGH 469

>KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} similar
           to uniprot|P39014 Saccharomyces cerevisiae YIL046W MET30
           F-box protein containing five copies of the WD40 motif
           controls cell cycle function sulfur metabolism and
           methionine biosynthesis as part of the ubiquitin ligase
           complex interacts with and regulates Met4p localizes
           within the nucleus
          Length = 623

 Score = 94.4 bits (233), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 134/301 (44%), Gaps = 23/301 (7%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +G   R +      V  +   +D+K++ A+  + +R+++  T 
Sbjct: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
           +   ++T+ GH+ +V  LS     + +V++S D T+KVW V S +      H   VN V 
Sbjct: 383 SC--ISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNC 183
           +HP      S   D  +R+WD+  N C            + + +    +  +  + K   
Sbjct: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495

Query: 184 YVWEMPNHTDASNLKP--VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFK 241
            + ++PN     +        F  +  Y T         HL +CS D T + W +     
Sbjct: 496 -IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGRC 545

Query: 242 LESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
           + +   GH   VWD A  AD+  +V+ S D  +++WDL   + ++ + GH    +CV + 
Sbjct: 546 IRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602

Query: 302 D 302
           D
Sbjct: 603 D 603

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 107/267 (40%), Gaps = 54/267 (20%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V SL F  ++R + T S D T+ +WD +S ++ R    H   V    I+ 
Sbjct: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYF 360

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  ++I+   D  IR+W+     C        ++    LSV S   ++V+A++     VW
Sbjct: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVW 417

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
            + + T           + H+ ++  + L        + S DKT R W +  N  ++   
Sbjct: 418 HVESRT-------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK-VF 469

Query: 247 DGH---------------------------------QRWVWDCA--FSADSAY---LVTA 268
            GH                                 + +  DC   F  +  Y   L++ 
Sbjct: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSC 529

Query: 269 SSDHYVRLWDLSTREIVRQYGGHHKGA 295
           S D+ ++LW++S+   +R   GH +G 
Sbjct: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGV 556

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 15/103 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-----ITNDKKLLGAAGHQNVRLYD 59
           L+S   D+TI+ WE  +G C RT      Q   +E       ++ +++  +  ++++++D
Sbjct: 526 LLSCSLDNTIKLWEVSSGRCIRT------QFGHVEGVWDIAADNFRIVSGSHDKSIKVWD 579

Query: 60  IRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           ++  N   + TF GHK  +  +     +   V+  E G +K+W
Sbjct: 580 LQ--NGKCIQTFTGHKAPIVCVGIGDSS--FVSGDELGEVKMW 618

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 40/96 (41%), Gaps = 5/96 (5%)

Query: 203 FKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADS 262
           FK H + +  + L  + + L T S D T   W       L   L GH   V    F  D 
Sbjct: 308 FKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSG-NLIRRLTGHTDGVKGIYF--DD 362

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
             ++TAS D  +R+W+  T   +  Y GH    + V
Sbjct: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV 398

>ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL046W
           (MET30)
          Length = 569

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 130/302 (43%), Gaps = 26/302 (8%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L++  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 271 LLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRF-DDQKLITGSLDKTIRVWNYVTG 329

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               V+T+ GH+ +V  LS     + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 330 AC--VSTYRGHQDSV--LSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVK 385

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNC 183
           +HP      S   D  IR+WD+  N C           +Q +   + GS L+        
Sbjct: 386 LHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQ-VQKVIPLTLGSDLIEDPKDA-- 442

Query: 184 YVWEMPNHTDASNLKPVTK---FKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
               +P    A    P  +   F     Y T         HL +CS D T + W++    
Sbjct: 443 ---VVPPDATAPAHDPSVQAANFDHSLPYPT---------HLLSCSLDNTIKLWNVKTGA 490

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            + +   GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G H    CV +
Sbjct: 491 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGI 547

Query: 301 ND 302
            D
Sbjct: 548 GD 549

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/263 (20%), Positives = 99/263 (37%), Gaps = 49/263 (18%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V  LS Q  N+ ++T S D T+ +WD+ +  + R    +    + +   +
Sbjct: 252 IQEFKGHMDGV--LSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKALRFDD 309

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+     C        ++    LSV S   ++V+ ++     VW 
Sbjct: 310 Q-KLITGSLDKTIRVWNYVTGACVSTYRGHQDS---VLSVDSFRKLIVSGSADKTVKVWH 365

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN-------- 239
           + + T           + H+ ++  + L        + S D T R W +  N        
Sbjct: 366 VESRT-------CYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHG 418

Query: 240 -------------------------FKLESTLDGHQRWVWDCAFSADSAY---LVTASSD 271
                                       ++T   H   V    F     Y   L++ S D
Sbjct: 419 HVGQVQKVIPLTLGSDLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLD 478

Query: 272 HYVRLWDLSTREIVRQYGGHHKG 294
           + ++LW++ T   +R   GH +G
Sbjct: 479 NTIKLWNVKTGACIRTQFGHVEG 501

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L++  K L T S D T   W L    KL   L GH   V   A  
Sbjct: 252 IQEFKGHMDGVLSLQLTN--KLLLTGSYDSTVAIWDLATG-KLIRRLSGHTDGVK--ALR 306

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T   V  Y GH    + V
Sbjct: 307 FDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSV 345

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 108/232 (46%), Gaps = 15/232 (6%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D  ++ T +ED  I++W+++   +    K H   +  +   P+  +L+S   
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSG 403

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE-----MPNH 191
           D +IRIWDL   QC+  L+ ED     ++S  ++G ++ A +   +  +W+     +   
Sbjct: 404 DRSIRIWDLKTGQCSLTLSIEDGVTTVAVS-PNEGKLIAAGSLDRSVRIWDSSTGFLVER 462

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN----FKLESTLD 247
            D+ N         H + +  +  + D +H+ + S D+T + W+L D      K E T  
Sbjct: 463 LDSDN----ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYI 518

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           GH+ +V   A S D  Y+ + S D  V +WD  +   +    GH    I VA
Sbjct: 519 GHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVA 570

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 10/108 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D +IR W+  TG CS T+   D         N+ KL+ A    ++VR++D    
Sbjct: 398 LVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTG 457

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
               R  + N   +  GH+ +V S++F +D + +V+ S D T+K+W++
Sbjct: 458 FLVERLDSDN--ESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 129/279 (46%), Gaps = 38/279 (13%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDI---------------RTTNP 65
           VC  T  +++S++  LE ++D +L  AAG Q+  ++++ +               RT N 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRL-AAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN- 475

Query: 66  NPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI 124
               T  GH G V S SF  DNR+++++SED T+++W   + +   NYK HN P+ +V  
Sbjct: 476 ---ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAF 532

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVAANSK 180
            P      +   D   R+W      C H    ++       + ++S   +G+ +   +S 
Sbjct: 533 SPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
             C +W      D ++   V  F  H+  +T   +S D + L+T S D     W +    
Sbjct: 588 KTCRMW------DITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGK 641

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+      +  V+  ++S +   L++  +DH VR+WD+
Sbjct: 642 RLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T       +  +  +  +  +        A H Q  RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC--D 554

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
           +  P+  F GH  +V ++SF  +  ++ T S D T ++WD+ S    R +  H APV   
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTST 614

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS + +G +L++  +  +
Sbjct: 615 AVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHS 674

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T     +P   F  +S  +T
Sbjct: 675 VRVWDVKKSTAEPGSEPEQPFTGYSGDVT 703

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNF---KLES---------TLDGHQRWVWDCA 257
           +T +  S DV+  A    D   + WSLD      KL S         TL GH   V+  +
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           FS D+ YL++AS D  VRLW   T   +  Y GH+
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHN 524

>YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box
           protein containing five copies of the WD40 motif,
           controls cell cycle function, sulfur metabolism, and
           methionine biosynthesis as part of the ubiquitin ligase
           complex; interacts with and regulates Met4p, localizes
           within the nucleus
          Length = 640

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 126/292 (43%), Gaps = 20/292 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  +V S+   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +HP      SC  D  IR+WD+  N C      H    +   PL       D   L   N
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPL----TIKDVENLATDN 484

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
           +       + P  TD ++       +  +     I   +   HL +C  D T + W +  
Sbjct: 485 TSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPT---HLLSCGLDNTIKLWDVKT 541

Query: 239 NFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
             K   T  GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 542 G-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 88/225 (39%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 350

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ HS+ +  + + S  K + + SADKT + W ++   +   TL
Sbjct: 375 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 417

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + + L T S D T   W L    KL   L GH   V    F 
Sbjct: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 350

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 14/86 (16%)

Query: 229 KTARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
           +T R W +   + FK+ES             GH   V    F+     L T S D  + +
Sbjct: 269 QTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNY--RLLFTGSYDSTIGI 326

Query: 277 WDLSTREIVRQYGGHHKGAICVALND 302
           WDL T +++R+  GH  G   +  +D
Sbjct: 327 WDLFTGKLIRRLSGHSDGVKTLYFDD 352

>TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.231
           YIL046W
          Length = 584

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 126/294 (42%), Gaps = 32/294 (10%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           S +L +  YD T+  W+  +G   R +      V  L   +++KL+  +  + +R+++  
Sbjct: 270 SRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVKALHF-DEQKLVTGSLDKTIRVWNYI 328

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
           T     ++T+ GH  +V  LS     + +V+ S D T+KVW V S +      H   VN 
Sbjct: 329 TGEC--ISTYRGHTDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNC 384

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVA 176
           V +HP      SC  D  IR+WD+  N C      H    +   PL  + + +    LV 
Sbjct: 385 VKLHPKSFLCFSCSDDTTIRMWDIRTNACLRVFRGHVGQVQKVIPLTIVDIDN----LVV 440

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
            + + N    E     D   LK    +                 HL +CS D T + W +
Sbjct: 441 DDRQINRSTQEEDTEEDQDVLKEDLPYPT---------------HLLSCSLDNTIKMWDI 485

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
               K   T  GH   VWD A  AD+  +V+ S D  V+LWDL + + +  + G
Sbjct: 486 RTG-KCVRTQFGHVEGVWDIA--ADNFRIVSGSHDGKVKLWDLQSGKCIHTFQG 536

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 103/264 (39%), Gaps = 51/264 (19%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEVVIHP 126
           +  F+GH   V +L F   +R + T S D T+ +WD+ S  + R   +H   V    +H 
Sbjct: 253 IQEFKGHMDGVLTLQFS--SRLLFTGSYDSTVAIWDLCSGRLIRRLSRHGDGVK--ALHF 308

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           ++ +L++   D  IR+W+    +C        ++    LSV S   ++V+ ++     VW
Sbjct: 309 DEQKLVTGSLDKTIRVWNYITGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVW 365

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
            + + T  S        + H+ ++  + L        +CS D T R W +  N  L    
Sbjct: 366 HVESRTCYS-------LRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNACLR-VF 417

Query: 247 DGHQRWVWDC--------------------------------AFSADSAY---LVTASSD 271
            GH   V                                       D  Y   L++ S D
Sbjct: 418 RGHVGQVQKVIPLTIVDIDNLVVDDRQINRSTQEEDTEEDQDVLKEDLPYPTHLLSCSLD 477

Query: 272 HYVRLWDLSTREIVRQYGGHHKGA 295
           + +++WD+ T + VR   GH +G 
Sbjct: 478 NTIKMWDIRTGKCVRTQFGHVEGV 501

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  +  SS +  L T S D T   W L    +L   L  H   V   A  
Sbjct: 253 IQEFKGHMDGVLTLQFSSRL--LFTGSYDSTVAIWDLCSG-RLIRRLSRHGDGVK--ALH 307

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   LVT S D  +R+W+  T E +  Y GH    + V
Sbjct: 308 FDEQKLVTGSLDKTIRVWNYITGECISTYRGHTDSVLSV 346

>KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.231
           YIL046W
          Length = 654

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 136/309 (44%), Gaps = 28/309 (9%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
            L +  YD T+  W+  TG   R +      V  L   + +KL+  +  + +R+++  T 
Sbjct: 290 FLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTL-FFDGQKLITGSLDKTIRVWNYMTG 348

Query: 64  NPNPVATFEGHKGNVTSL-SFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
               ++T+ GH  +V S+ SF+   + +V+ S D T+KVW V S +      H+  VN V
Sbjct: 349 EC--ISTYRGHTNSVMSVDSFK---KIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCV 403

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP-----EDNTPLQSLSVASDGSMLVAA 177
            +HP      SC  D  IR+WD+  N C    T      +   PL  L +    ++++ +
Sbjct: 404 KLHPKSFCCFSCSDDTTIRMWDIRTNTCLKVFTGHVGQVQKVIPLTILDIE---NLVMDS 460

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
           NS  +    E     D S  +        S     I   +   HL +CS D T + W + 
Sbjct: 461 NSADD----ETVTGVDESVNEETPPLVVGSQLDGTIPYPT---HLLSCSLDNTIKLWEVK 513

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG---HHKG 294
              K   T  GH   VWD A  AD+  +V+ S D  +++WDL +   +  + G     +G
Sbjct: 514 SG-KCIRTQFGHVEGVWDIA--ADNFRIVSGSHDGSIKIWDLQSGRCMHTFHGKNLQKEG 570

Query: 295 AICVALNDV 303
            +  +  DV
Sbjct: 571 MVASSSGDV 579

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 79/182 (43%), Gaps = 14/182 (7%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           V  F+GH   + S+ F  + R++ T S DGT+ +WD+ +  + R    +    + +    
Sbjct: 271 VKEFKGHMDGILSMKF--NFRFLFTGSYDGTVAIWDLFTGKLIRRLNGHQDGVKTLFFDG 328

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+    +C        N+    +SV S   ++V+ ++     VW 
Sbjct: 329 Q-KLITGSLDKTIRVWNYMTGECISTYRGHTNS---VMSVDSFKKIIVSGSADKTVKVWH 384

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
           + + T           + HS ++  + L        +CS D T R W +  N  L+    
Sbjct: 385 VESRT-------CYTLRGHSEWVNCVKLHPKSFCCFSCSDDTTIRMWDIRTNTCLK-VFT 436

Query: 248 GH 249
           GH
Sbjct: 437 GH 438

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           V +FK H + I  + +  + + L T S D T   W L    KL   L+GHQ  V    F 
Sbjct: 271 VKEFKGHMDGI--LSMKFNFRFLFTGSYDGTVAIWDLFTG-KLIRRLNGHQDGVKTLFF- 326

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 327 -DGQKLITGSLDKTIRVWNYMTGECISTYRGHTNSVMSV 364

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 14/81 (17%)

Query: 227 ADKTARTWSL--DDNFKLE----------STLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
           A+K    W +   D FK+E              GH   +    F+    +L T S D  V
Sbjct: 243 AEKQMNPWKIIYRDRFKVELNWRKGKCMVKEFKGHMDGILSMKFNF--RFLFTGSYDGTV 300

Query: 275 RLWDLSTREIVRQYGGHHKGA 295
            +WDL T +++R+  GH  G 
Sbjct: 301 AIWDLFTGKLIRRLNGHQDGV 321

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 125/284 (44%), Gaps = 35/284 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDI---------------- 60
           AL  VC  T  +++  +  LE ++D +L  AAG Q+  ++++ +                
Sbjct: 460 ALPSVCMYTFHNTNRDMTSLEFSDDCRL-AAAGFQDSYIKIWSLDGSSLINPKYSSSQFD 518

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R +  N  +T  GH G V S SF  DN ++V+ SED T+K+W + + +   NYK HN PV
Sbjct: 519 RFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPV 578

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLV 175
            +V   P      S   D   R+W      C H    ++       + ++S   +G  + 
Sbjct: 579 WDVKFSPLGHYFASASHDQTARLW-----ACDHIYPLRIFAGHTNDVDTVSFHPNGCYVF 633

Query: 176 AANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWS 235
             +S   C +W      D S    V  F  H+  +    +S D + LAT S D     W 
Sbjct: 634 TGSSDKTCRMW------DVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWD 687

Query: 236 LDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +    +++      +  V   +F+ +   L++  +DH VR+WD+
Sbjct: 688 IGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 96/211 (45%), Gaps = 4/211 (1%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIR 61
           + LVS   D T++ W   T       +  +  V  ++ +       +A H Q  RL+   
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW--A 603

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVN 120
             +  P+  F GH  +V ++SF  +  ++ T S D T ++WDV +    R +  H APV 
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVL 663

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
              + P+   L +   DG I +WD+G  +   Q+       + SLS   +G++L++  + 
Sbjct: 664 STQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGAD 723

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
            +  VW++ + T     +P   F AH   IT
Sbjct: 724 HSVRVWDVKHGTTEQGPEPEQPFNAHVGDIT 754

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 17/100 (17%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLD--------------DNFKLE---STLDGHQRW 252
           +T +  S D +  A    D   + WSLD              D F  +   STL GH   
Sbjct: 476 MTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           V+  +FS D+ YLV+ S D  V+LW + T   +  Y GH+
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHN 575

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 130/279 (46%), Gaps = 38/279 (13%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLY---------------DIRTTNP 65
           VC  T  +++S++  LE ++D +L  +AG Q+  V+++               D R+ N 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRL-ASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN- 475

Query: 66  NPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI 124
              AT  GH G V S +F  DNR+++++SED T+++W   + +   +YK HN P+ +V  
Sbjct: 476 ---ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAF 532

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVAANSK 180
            P      +   D   R+W      C H    ++       + ++S   +G+ +   +S 
Sbjct: 533 SPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
             C +W+M      S    V  F  H+  +T   +S D + L+T S D     W +    
Sbjct: 588 KTCRMWDM------STGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGK 641

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+      +  V+  ++S +   LV+  +DH +R+WD+
Sbjct: 642 RLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 94/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T     + +  +  +  +  +        A H Q  RL+     
Sbjct: 497 LLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSC--D 554

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
           +  P+  F GH  +V ++SF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 555 HIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTAT 614

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS + +G +LV+  +  +
Sbjct: 615 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHS 674

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T     +P   F + S  +T
Sbjct: 675 LRVWDVKKSTAEPGSEPEQPFTSFSGDVT 703

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 101/248 (40%), Gaps = 37/248 (14%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           +RL +++++ P+  + TF      +TSL F  D R      +D  +K+W +         
Sbjct: 406 IRLDNLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSL--------- 456

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSM 173
                          GE +S          D   N  T  L     T + S + + D   
Sbjct: 457 --------------DGEPLSSKLPSK---QDERSNNAT--LVGHSGT-VYSTAFSPDNRY 496

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           L++A+      +W    +T       +  +K H++ I  +  S    + AT S D+TAR 
Sbjct: 497 LLSASEDKTVRLWSTDTYTS------LVSYKGHNHPIWDVAFSPLGHYFATASHDQTARL 550

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           WS D  + L     GH   V   +F  +  Y+ T SSD   R+WD+ST + VR + GH  
Sbjct: 551 WSCDHIYPLR-IFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTA 609

Query: 294 GAICVALN 301
                A++
Sbjct: 610 PVTATAVS 617

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 61/152 (40%), Gaps = 16/152 (10%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKA-------HSNYIT 211
           N+ + SL  + D  +  A        +W +     +S L      ++       HS  + 
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVY 486

Query: 212 RILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSD 271
               S D ++L + S DKT R WS D    L S   GH   +WD AFS    Y  TAS D
Sbjct: 487 STAFSPDNRYLLSASEDKTVRLWSTDTYTSLVS-YKGHNHPIWDVAFSPLGHYFATASHD 545

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICVALNDV 303
              RLW       +R + GH        LNDV
Sbjct: 546 QTARLWSCDHIYPLRIFAGH--------LNDV 569

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 129/303 (42%), Gaps = 32/303 (10%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRL-------------YDIRTTNP 65
           AL  VC  T  +++  +  LE ++D +L  AAG Q+ ++             YD      
Sbjct: 483 ALPSVCMYTFHNTNRDMTSLEFSDDCRL-AAAGFQDSQIKLFSLDGSPLGNRYDPDLPED 541

Query: 66  NPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI 124
               T  GH G V S SF  DNR++V+SSED T+++W + + S   +YK HN PV +V  
Sbjct: 542 ATSKTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKF 601

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVAANSK 180
            P      +   D   R+W      C H    ++       +  +S   +G  L   +S 
Sbjct: 602 SPLGHYFATASHDHTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSD 656

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
             C +W      D +    V  F   +  +    +S D + L+T S D     W +    
Sbjct: 657 KTCRMW------DIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGK 710

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           +L+      +  ++  A+  +   L++  +DH VR+WDL  ++   + G   + A    L
Sbjct: 711 RLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL--KKATTESGPEPEQAFVGYL 768

Query: 301 NDV 303
            DV
Sbjct: 769 GDV 771

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 90/209 (43%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           LVS+  D T+R W   T     + +  +  V  ++ +        A H    RL+     
Sbjct: 566 LVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWSCDHI 625

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WD+ +    R +    APV   
Sbjct: 626 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVIST 683

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SL+   +G+ L++  +  +
Sbjct: 684 CVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHS 743

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T  S  +P   F  +   +T
Sbjct: 744 VRVWDLKKATTESGPEPEQAFVGYLGDVT 772

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 112/257 (43%), Gaps = 33/257 (12%)

Query: 59  DIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK---- 114
           D R   P  V  +EGH   + +L   +D +W+ T S+D T+ +W  R  S    +K    
Sbjct: 387 DSRDCFPLEVELYEGHTDLLNALDSSEDGKWLATCSKDHTVILW--RYSSELEKFKAYAK 444

Query: 115 ---HNAPVNEVVIHPNQGE------LISCDRDGNIRIWDLG----ENQCTHQLTPEDNT- 160
              H  PV  V + PN         +I+   D  I+ W +     E    H +   D T 
Sbjct: 445 FTGHAGPVTAVGL-PNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTR 503

Query: 161 -----PLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILL 215
                 + +LS++ + S    A+    C VW++    D+  L+       H   +  +  
Sbjct: 504 RAHDKDINALSISPNDSTFATASYDKTCKVWDV----DSGELQGT--LANHKRGLWDVSF 557

Query: 216 SSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
               K LATCS DKT + WSLD    +  TL+GH   V  C+F   +  LV+  +D  ++
Sbjct: 558 CQYDKLLATCSGDKTVKVWSLD-TLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIK 616

Query: 276 LWDLSTREIVRQYGGHH 292
           LWDLST E VR    H 
Sbjct: 617 LWDLSTGECVRTLDAHE 633

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 16/197 (8%)

Query: 4   ILVSAGYDHTIRFWEA-----------LTGVCSRTIQHSDSQVNRLEIT-NDKKLLGAAG 51
            +++A  D TI+ W             +  V   T +  D  +N L I+ ND     A+ 
Sbjct: 468 FIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATASY 527

Query: 52  HQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR 111
            +  +++D+ +       T   HK  +  +SF Q ++ + T S D T+KVW + + SV +
Sbjct: 528 DKTCKVWDVDSGELQ--GTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVK 585

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             + H   V          +L+S   DG I++WDL   +C   L   +N  + +LSV  D
Sbjct: 586 TLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENR-IWALSVLHD 644

Query: 171 GSMLVAANSKGNCYVWE 187
           G   V A++ G    W+
Sbjct: 645 GDEFVTADADGVFQFWK 661

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 95/244 (38%), Gaps = 29/244 (11%)

Query: 69  ATFEGHKGNVTSLSFQQDNR-----WMVTSSEDGTIKVWDVRSP----SVPRNYK----- 114
           A F GH G VT++      R     +++T+S D TIK W V  P    + P   K     
Sbjct: 443 AKFTGHAGPVTAVGLPNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYT 502

Query: 115 ---HNAPVNEVVIHPNQGELISCDRDGNIRIWDL--GENQCTHQLTPEDNTPLQSLSVAS 169
              H+  +N + I PN     +   D   ++WD+  GE Q T          L  +S   
Sbjct: 503 RRAHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGT---LANHKRGLWDVSFCQ 559

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
              +L   +      VW +        L  V   + H+N + R    +  K L +  AD 
Sbjct: 560 YDKLLATCSGDKTVKVWSL------DTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADG 613

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYG 289
             + W L    +   TLD H+  +W  +   D    VTA +D   + W   + E  ++  
Sbjct: 614 LIKLWDLSTG-ECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENL 672

Query: 290 GHHK 293
            +HK
Sbjct: 673 ENHK 676

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 52/261 (19%), Positives = 104/261 (39%), Gaps = 20/261 (7%)

Query: 40  ITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTI 99
           ++ D +LL  +    V + ++  T           +  +T+L    D  ++   S+   +
Sbjct: 25  VSEDGRLLATSVIDEVNIIELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLL 84

Query: 100 KVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDN 159
           +++ +RS  V R+ K ++PV  +   P+   +     DG++ + D+     TH L     
Sbjct: 85  RIYHLRSKRVVRSMKVSSPVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGA 144

Query: 160 TPLQSLSVASDGSM------LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRI 213
           T     SV   G +      L + ++ G   VW++      S L  + +  A    +   
Sbjct: 145 TI---SSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRR---SCLHTIQEHAAAVRGLDFR 198

Query: 214 LLSS--DVKHLATCSADKTARTWSLDD--NFKLESTLDGHQRWVWDCAFSADSAY---LV 266
           +  +  DV  L +   D     + L      KL  T+  HQ+ +  C F  D  +     
Sbjct: 199 VSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKTIPVHQQ-IEACGFIHDGEHQDLFY 257

Query: 267 TASSDHYVRLWDLSTREIVRQ 287
           TA  D   ++  L+T  ++++
Sbjct: 258 TAGGDAVYQILSLATASVIKK 278

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 59/148 (39%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVK- 220
           L +L  + DG  L   +      +W     ++    K   KF  H+  +T + L + ++ 
Sbjct: 406 LNALDSSEDGKWLATCSKDHTVILWRYS--SELEKFKAYAKFTGHAGPVTAVGLPNVMRS 463

Query: 221 ----HLATCSADKTARTWSLDDN---------FKL-ESTLDGHQRWVWDCAFSADSAYLV 266
                + T S D T + W++             K+ + T   H + +   + S + +   
Sbjct: 464 AWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++WD+ + E+      H +G
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRG 551

>Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W
           (REAL)
          Length = 638

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 129/290 (44%), Gaps = 20/290 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 312 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 370

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  +V S+   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 371 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 426

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNC 183
           +HP      SC  D  IR+WD+  N C            + + +    +  +A ++  + 
Sbjct: 427 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDAENLATDNTSSQ 486

Query: 184 YVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVK---HLATCSADKTARTWSLDDNF 240
               M N  +AS   P +  +A        +L   +    HL +C  D T + W +    
Sbjct: 487 NEPAMSNDANASE-TPSSDQEA--------VLDETIPYPTHLLSCGLDNTIKLWEVRTG- 536

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           K   T  GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 537 KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQG 584

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ +  + R    H   V    ++ 
Sbjct: 293 IQEFKGHMDGVLTLQF--NFRLLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVK--TLYF 348

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 349 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 372

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ HS+ +  +   S  K + + SADKT + W ++   +   TL
Sbjct: 373 -------------ISTYRGHSDSVLSV--DSYQKVIVSGSADKTVKVWHVES--RTCYTL 415

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 416 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 460

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + + L T S D T   W L    KL   L GH   V    F 
Sbjct: 293 IQEFKGHMDGV--LTLQFNFRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHTDGVKTLYF- 348

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 349 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 386

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 14/84 (16%)

Query: 231 ARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            R W +   + FK+ES             GH   V    F  +   L T S D  + +WD
Sbjct: 269 TRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NFRLLFTGSYDSTIGIWD 326

Query: 279 LSTREIVRQYGGHHKGAICVALND 302
           L T +++R+  GH  G   +  +D
Sbjct: 327 LFTGKLIRRLSGHTDGVKTLYFDD 350

>Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W
           (REAL)
          Length = 630

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 130/299 (43%), Gaps = 34/299 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 304 LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF-DDRKLITGSLDRTIRVWNYITG 362

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  +V S+   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 363 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 418

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDNTPLQSLSV--ASDG 171
           +HP      SC  D  IR+WD+  N C            ++ P      ++L+    SDG
Sbjct: 419 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGHVGQVQKVVPLTIKDTENLATDNTSDG 478

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S L     + +  + +  N ++  + +          Y T         HL +C  D T 
Sbjct: 479 STL-----QDDSAMADGVNESETPSDEQEIALDETIPYPT---------HLLSCGLDNTI 524

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           + W +    K   T  GH   VWD A  AD+  +++ S D  +++WDL +   +  + G
Sbjct: 525 KLWDVKTG-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGRCMHTFNG 580

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 88/225 (39%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ +  + R    H+  V    ++ 
Sbjct: 285 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVK--TLYF 340

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 341 DDRKLITGSLDRTIRVWNYITGEC------------------------------------ 364

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ HS+ +  + + S  K + + SADKT + W ++   +   TL
Sbjct: 365 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 407

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 408 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFKGH 452

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + + L T S D T   W L    KL   L GH   V    F 
Sbjct: 285 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHSDGVKTLYF- 340

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 341 -DDRKLITGSLDRTIRVWNYITGECISTYRGHSDSVLSV 378

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 14/84 (16%)

Query: 231 ARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            R W +   + FK+ES             GH   V    F  +   L T S D  + +WD
Sbjct: 261 TRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWD 318

Query: 279 LSTREIVRQYGGHHKGAICVALND 302
           L T +++R+  GH  G   +  +D
Sbjct: 319 LFTGKLIRRLSGHSDGVKTLYFDD 342

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 135/303 (44%), Gaps = 27/303 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L +  YD T+  W+  +G   R +      V  +   +D+KL+  +  + +R+++ +T  
Sbjct: 345 LFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF-DDQKLITGSLDKTIRVWNYQTGA 403

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              ++T+ GH  +V  LS     + +V+ S D T+KVW V S +      H+  VN V +
Sbjct: 404 C--ISTYRGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHSEWVNCVKL 459

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAANS 179
           HP      S   D  IR+WD+  N C      H    +   PL+ + V    +++V    
Sbjct: 460 HPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGHVGQVQKVIPLKIVDVE---NLVVDKQE 516

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
           +    + E PN   A +    T    +  Y T         H+ +CS D T + W +   
Sbjct: 517 EAQELIPE-PNGEGAVDDVTGT-MDPNLPYPT---------HILSCSLDNTIKLWEVRSG 565

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
            K   T  GH   VWD A  AD+  +++ + D  V++WDL + + +  + GH     CV 
Sbjct: 566 -KCVRTHFGHVEGVWDIA--ADNFRVISGAHDRTVKIWDLQSGKCMHTFTGHQAPIACVD 622

Query: 300 LND 302
           + D
Sbjct: 623 IGD 625

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 88/225 (39%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V SL F  ++R++ T S D T+ +WD+ S  + R    H+  V  V    
Sbjct: 325 IQEFKGHMDGVLSLQF--NHRYLFTGSYDSTVAIWDLCSGKLIRRLTGHHDGVKSVYF-- 380

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+     C                                    
Sbjct: 381 DDQKLITGSLDKTIRVWNYQTGAC------------------------------------ 404

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ HS+ +  + + S  K + + SADKT + W ++   +   TL
Sbjct: 405 -------------ISTYRGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVES--RTCYTL 447

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ +   ++ + GH
Sbjct: 448 RGHSEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCIKVFKGH 492

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 78/195 (40%), Gaps = 49/195 (25%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIR 61
           I+VS   D T++ W   +  C     HS+  VN +++ + K     +G  +  +R++DIR
Sbjct: 424 IIVSGSADKTVKVWHVESRTCYTLRGHSE-WVNCVKL-HPKSFTCFSGSDDTTIRMWDIR 481

Query: 62  TTNPNPVATFEGHKGNVTS-------------LSFQQDNRWMV----------------- 91
           +     +  F+GH G V               +  Q++ + ++                 
Sbjct: 482 SN--TCIKVFKGHVGQVQKVIPLKIVDVENLVVDKQEEAQELIPEPNGEGAVDDVTGTMD 539

Query: 92  ----------TSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV-VIHPNQGELISCDRDGNI 140
                     + S D TIK+W+VRS    R   H   V  V  I  +   +IS   D  +
Sbjct: 540 PNLPYPTHILSCSLDNTIKLWEVRSGKCVRT--HFGHVEGVWDIAADNFRVISGAHDRTV 597

Query: 141 RIWDLGENQCTHQLT 155
           +IWDL   +C H  T
Sbjct: 598 KIWDLQSGKCMHTFT 612

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 226 SADKTARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHY 273
           +  +  R W +   + FK+ES             GH   V    F  +  YL T S D  
Sbjct: 296 AGGRKTRPWKVIYRERFKVESNWRKGSCVIQEFKGHMDGVLSLQF--NHRYLFTGSYDST 353

Query: 274 VRLWDLSTREIVRQYGGHHKGAICVALND 302
           V +WDL + +++R+  GHH G   V  +D
Sbjct: 354 VAIWDLCSGKLIRRLTGHHDGVKSVYFDD 382

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + ++L T S D T   W L    KL   L GH   V    F 
Sbjct: 325 IQEFKGHMDGV--LSLQFNHRYLFTGSYDSTVAIWDLCSG-KLIRRLTGHHDGVKSVYF- 380

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T   +  Y GH    + V
Sbjct: 381 -DDQKLITGSLDKTIRVWNYQTGACISTYRGHSDSVLSV 418

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLGAAGHQNVRLYDIRTT 63
           ++S   D+TI+ WE  +G C RT  H        +I  D  +++  A  + V+++D+++ 
Sbjct: 548 ILSCSLDNTIKLWEVRSGKCVRT--HFGHVEGVWDIAADNFRVISGAHDRTVKIWDLQSG 605

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
               + TF GH+  +  +         V+  E G +K++
Sbjct: 606 --KCMHTFTGHQAPIACVDIGDSE--FVSGDELGCVKLY 640

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 125/291 (42%), Gaps = 32/291 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T  
Sbjct: 298 LFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYF-DDQKLITGSLDKTIRVWNYLTGE 356

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              ++T+ GH  +V  LS     + +V+ S D T+KVW V S +      H   VN V +
Sbjct: 357 C--ISTYRGHTDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYSLRGHTEWVNCVKL 412

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAANS 179
           HP      SC  D  IR+WD+  N C      H    +   PL  +    D   LV  + 
Sbjct: 413 HPKSFLCFSCSDDTTIRMWDIRTNVCLKVFRGHLGQVQKVVPLTII----DSENLVVDDK 468

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +    +     D  N + V     +  Y T         HL +CS D T + W +   
Sbjct: 469 AED----DGEEQGDDENAQDV--LTENLPYPT---------HLLSCSLDNTIKLWDIKKG 513

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
             + +   GH   VWD A  AD+  +V+ S D  V++WDL + + +  + G
Sbjct: 514 RCIRTQF-GHVEGVWDLA--ADNFRIVSGSHDGKVKVWDLQSGKCIHTFQG 561

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 103/263 (39%), Gaps = 49/263 (18%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V +L F  + R++ T S D TI +WD+ +  + R    +    + +   +
Sbjct: 278 IKEFKGHMDGVLALQF--NTRYLFTGSYDSTIAIWDLCTGRLVRRLSSHTDGVKALYFDD 335

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+    +C        ++    LSV S   ++V+ ++     VW 
Sbjct: 336 Q-KLITGSLDKTIRVWNYLTGECISTYRGHTDS---VLSVDSYKKIIVSGSADKTVKVWH 391

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
           + + T  S        + H+ ++  + L        +CS D T R W +  N  L+    
Sbjct: 392 VESRTCYS-------LRGHTEWVNCVKLHPKSFLCFSCSDDTTIRMWDIRTNVCLK-VFR 443

Query: 248 GH---------------QRWVWDCAFSADS--------------------AYLVTASSDH 272
           GH               +  V D     D                      +L++ S D+
Sbjct: 444 GHLGQVQKVVPLTIIDSENLVVDDKAEDDGEEQGDDENAQDVLTENLPYPTHLLSCSLDN 503

Query: 273 YVRLWDLSTREIVRQYGGHHKGA 295
            ++LWD+     +R   GH +G 
Sbjct: 504 TIKLWDIKKGRCIRTQFGHVEGV 526

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 72/184 (39%), Gaps = 41/184 (22%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNR---LEITNDKKLL--------GAA 50
           S +  S   D TIR W+  T VC +  +    QV +   L I + + L+        G  
Sbjct: 416 SFLCFSCSDDTTIRMWDIRTNVCLKVFRGHLGQVQKVVPLTIIDSENLVVDDKAEDDGEE 475

Query: 51  GHQNVRLYDIRTTN-PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV 109
              +    D+ T N P P                      +++ S D TIK+WD++    
Sbjct: 476 QGDDENAQDVLTENLPYPTH--------------------LLSCSLDNTIKLWDIKKGRC 515

Query: 110 PR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVA 168
            R  + H   V ++    +   ++S   DG +++WDL   +C H          +SL   
Sbjct: 516 IRTQFGHVEGVWDLA--ADNFRIVSGSHDGKVKVWDLQSGKCIHTFQG------KSLEQR 567

Query: 169 SDGS 172
           SDG+
Sbjct: 568 SDGT 571

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + ++L T S D T   W L    +L   L  H   V   A  
Sbjct: 278 IKEFKGHMDGV--LALQFNTRYLFTGSYDSTIAIWDLCTG-RLVRRLSSHTDGVK--ALY 332

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 333 FDDQKLITGSLDKTIRVWNYLTGECISTYRGHTDSVLSV 371

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 12/75 (16%)

Query: 238 DNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQ 287
           D FK+ES             GH   V   A   ++ YL T S D  + +WDL T  +VR+
Sbjct: 263 DRFKVESNWRKGTCLIKEFKGHMDGVL--ALQFNTRYLFTGSYDSTIAIWDLCTGRLVRR 320

Query: 288 YGGHHKGAICVALND 302
              H  G   +  +D
Sbjct: 321 LSSHTDGVKALYFDD 335

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 130/285 (45%), Gaps = 36/285 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTT---NPNPV----- 68
           AL  VC  T Q+++  ++ L+ ++D ++  AAG Q+  ++++ +  +   NPN V     
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRV-AAAGFQDSYIKIWSLDGSSLNNPNIVLNNET 511

Query: 69  ---------ATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAP 118
                     T  GH G V S SF  DN+++++ SED T+++W + + +   +YK HN P
Sbjct: 512 NYKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP 571

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSML 174
           V +V   P      +   D   R+W      C H    ++       +  +S   +G  L
Sbjct: 572 VWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYL 626

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW 234
              +S   C +W      + S    V  F  H+  +  I +S D + L+T S D     W
Sbjct: 627 FTGSSDKTCRMW------NVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVW 680

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            +    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 681 DIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +        A H Q  RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++W+V +    R +  H APV  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISI 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS + +G++L++  +  +
Sbjct: 660 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T   + +P   F  +   +T
Sbjct: 720 VRVWDLKKATTEPSAEPDEPFIGYLGDVT 748

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 95/240 (39%), Gaps = 48/240 (20%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV---------PRNYKHNAPVN 120
           TF+    +++ L F  D R      +D  IK+W +   S+           NYK + P  
Sbjct: 461 TFQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTC 520

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           + ++                           H  T      + S S + D   L++ +  
Sbjct: 521 KTLV--------------------------GHSGT------VYSTSFSPDNKYLLSGSED 548

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNF 240
               +W M  HT       +  +K H++ +  +  S    + AT S D+TAR WS D  +
Sbjct: 549 KTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIY 602

Query: 241 KLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            L     GH   V   +F  +  YL T SSD   R+W++ST + VR + GH    I +A+
Sbjct: 603 PLR-IFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAV 661

>KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 658

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 134/309 (43%), Gaps = 38/309 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 360 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYF-DDQKLITGSLDRTIRVWNYVTG 418

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               V+T+ GH  +V  LS     + +V+ S D T+K+W V S +      H+  V  V 
Sbjct: 419 AC--VSTYRGHSDSV--LSVDSYKKIIVSGSADKTVKMWHVESRTCYTLRGHSEWVGCVK 474

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLV--- 175
           +HP      S   D  IR+WD+  N C      H    +   PL  L    D   LV   
Sbjct: 475 LHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGHVGQVQKVLPLNIL----DTENLVTDP 530

Query: 176 AANSKGNCYVWEMPNHTDAS--NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           A+ ++ N    + P   D S   L P+     + +            HL +CS D T + 
Sbjct: 531 ASEAQRN----DEPAANDPSEGQLAPLDDSLPYPS------------HLLSCSLDNTIKL 574

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +    K   T  GH   +WD A  AD+  +++ + D  V++WDL + + +  +  HH 
Sbjct: 575 WDVRTG-KCVRTHFGHLEGIWDIA--ADNFRIISGAHDKTVKVWDLQSGKCIHTFDSHHA 631

Query: 294 GAICVALND 302
              CV + D
Sbjct: 632 PITCVGIGD 640

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 104/266 (39%), Gaps = 53/266 (19%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V +L F  + R + T S D T+ +WD+ +  + R    +    + +   +
Sbjct: 341 IQDFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKTLYFDD 398

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+     C        ++    LSV S   ++V+ ++     +W 
Sbjct: 399 Q-KLITGSLDRTIRVWNYVTGACVSTYRGHSDS---VLSVDSYKKIIVSGSADKTVKMWH 454

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
           + + T           + HS ++  + L        + S D T R W +  N  L+    
Sbjct: 455 VESRT-------CYTLRGHSEWVGCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCLK-VFR 506

Query: 248 GH---------------QRWVWDCAFSAD------------------------SAYLVTA 268
           GH               +  V D A  A                          ++L++ 
Sbjct: 507 GHVGQVQKVLPLNILDTENLVTDPASEAQRNDEPAANDPSEGQLAPLDDSLPYPSHLLSC 566

Query: 269 SSDHYVRLWDLSTREIVRQYGGHHKG 294
           S D+ ++LWD+ T + VR + GH +G
Sbjct: 567 SLDNTIKLWDVRTGKCVRTHFGHLEG 592

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 104/230 (45%), Gaps = 8/230 (3%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++   +ED  I++WD+ +  +    K H   +  +   P+  +L+S   
Sbjct: 460 IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSG 519

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     S S  ++G  + A +   +  +W+         
Sbjct: 520 DKTVRIWDLRTGQCSLTLSIEDGVTTVS-SSPNNGKFIAAGSLDRSARIWDTETGFLLKR 578

Query: 197 LKPVTKFK-AHSNYITRILLSSDVKHLATCSADKTARTWSLD-----DNFKLESTLDGHQ 250
           L   T  +  H + I  +  + D K L + S D++ + W+LD      N   E T  GH+
Sbjct: 579 LDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHK 638

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            +V     S +  Y+++ S D  V  WD ++   +    GH    I VA+
Sbjct: 639 DFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 13/153 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D         N+ K + A    ++ R++D  T 
Sbjct: 514 LVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETG 573

Query: 64  N-----PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK---- 114
                  +      GHK ++ S+SF +D + +V+ S D ++K+W++ + +   N      
Sbjct: 574 FLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVT 633

Query: 115 ---HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
              H   V  V    N   ++S  +D  +  WD
Sbjct: 634 FIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWD 666

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 208 NYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVT 267
           N  TR+  +S  + +AT   D  +   S + N + ++  +    ++    FS D  +L  
Sbjct: 418 NKTTRVYKTSTGELIATLLVDPQS---SNNSNSEQQTNPESSDLYIRSVCFSPDGKFLAA 474

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHK 293
            + D  +R+WD++T++IV    GH +
Sbjct: 475 GAEDKLIRIWDITTKQIVMILKGHEQ 500

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 116/259 (44%), Gaps = 31/259 (11%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS---VP--RNYKHNAPV 119
           P  V  +EGHK  + ++   +D  W+ T+S+D T  +W  +S S   VP  +   H++ V
Sbjct: 369 PIDVELYEGHKDLLNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAV 428

Query: 120 NEV----VIHPNQGELI-SCDRDGNIRIW------------DLGENQCTHQLTPEDNTPL 162
             V    ++H    E I +   D  ++ W            +L   + +          +
Sbjct: 429 TAVGLPNIMHKGWPEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDI 488

Query: 163 QSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
            +LSVA + S    A+    C VW++ +    + L        H   +  +      + +
Sbjct: 489 NALSVAPNDSTFATASYDKTCKVWDLESGEVKATLAN------HRRGLWDVAFCQYERLI 542

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           ATCS DKT + WSLD  F +  T +GH   V  C+F      LV++S+D  V++WD ST 
Sbjct: 543 ATCSGDKTIKIWSLD-TFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG 601

Query: 283 EIVRQYGGHHKG--AICVA 299
           E V+   GH     A+CVA
Sbjct: 602 ECVKTLDGHTNRIWALCVA 620

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 102/276 (36%), Gaps = 30/276 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRLYDIRTTNPN---PVATFEGHKGNVTSLSFQQDN---- 87
           +N ++ T D   L  A   +  +     +N N   P A FEGH   VT++          
Sbjct: 382 LNAVDATEDGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGW 441

Query: 88  -RWMVTSSEDGTIKVWDVRSP--------------SVPRNYKHNAPVNEVVIHPNQGELI 132
             +++T+S D T+K W V  P              S      H   +N + + PN     
Sbjct: 442 PEFILTASNDLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFA 501

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHT 192
           +   D   ++WDL   +    L       L  ++      ++   +      +W +    
Sbjct: 502 TASYDKTCKVWDLESGEVKATLA-NHRRGLWDVAFCQYERLIATCSGDKTIKIWSL---- 556

Query: 193 DASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRW 252
                  V  F+ H+N + R    +    L + SAD   + W      +   TLDGH   
Sbjct: 557 --DTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTG-ECVKTLDGHTNR 613

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
           +W    + D   +V+A +D   + W  ST +  +Q+
Sbjct: 614 IWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 64/141 (45%), Gaps = 4/141 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGA-AGHQNVRLYDIRTT 63
             +A YD T + W+  +G    T+ +    +  +     ++L+   +G + ++++ + T 
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEV 122
               V TFEGH   V   SF      +V+SS DG +K+WD  +    +    H   +  +
Sbjct: 560 --AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWAL 617

Query: 123 VIHPNQGELISCDRDGNIRIW 143
            +  +   ++S D DG  + W
Sbjct: 618 CVAEDGDLIVSADADGVFQFW 638

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 95/223 (42%), Gaps = 21/223 (9%)

Query: 77  NVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDR 136
           ++T+L    D R++  +S+   +K++D+R   + R+ K ++P   V        L     
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIGGT 121

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGS----MLVAANSKGNCYVWEMPN-- 190
           DG+I + D+     TH L     T + S+    + +    +L + ++ G   +W++    
Sbjct: 122 DGSITVVDVENGYVTHSLKGHGGT-ISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

Query: 191 --HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSA--DKTARTWSLDDNFK--LES 244
             HT   +   V     H +       ++D   L   S   D     W  +   K  L  
Sbjct: 181 CIHTVQEHTAAVRGIDFHESK------NNDESELFLISGGRDDVINYWQFNLKKKCTLLK 234

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQ 287
           TL   Q+ V  C F A+S  + TA SD +++L  L + + V++
Sbjct: 235 TLPVSQQ-VESCGF-ANSELIYTAGSDAFLQLISLESGKAVKR 275

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLGAAGHQNVRLYDIRT 62
           ++ +   D TI+ W   T    +T +   + V R    N + +L+ ++    V+++D  T
Sbjct: 541 LIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCST 600

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
                V T +GH   + +L   +D   +V++  DG  + W
Sbjct: 601 --GECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFW 638

>Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W
           (REAL)
          Length = 639

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 127/295 (43%), Gaps = 27/295 (9%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  TG   R +      V  L   +D+KL+  +  + +R+++  T 
Sbjct: 314 LLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVKTLYF-DDRKLITGSLDKTIRVWNYITG 372

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  +V S+   Q  + +V+ S D T+KVW V S +      H   VN V 
Sbjct: 373 EC--ISTYRGHSDSVLSVDSYQ--KVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVK 428

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPL---QSLSVASDGSMLV 175
           +HP      SC  D  IR+WD+  N C      H    +   PL    + ++A+D +   
Sbjct: 429 LHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDAENLATDNTSDG 488

Query: 176 AANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWS 235
             + +    + + P        +          Y T         HL +C  D T + W 
Sbjct: 489 GGSLQDGSAMIDEPEAVAGD--QEAAALDESIPYPT---------HLLSCGLDNTIKLWD 537

Query: 236 LDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           +    K   T  GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 538 VKTG-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKVWDLQSGKCMHTFQG 589

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ +  + R    H   V    ++ 
Sbjct: 295 IQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHTDGVK--TLYF 350

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+    +C                                    
Sbjct: 351 DDRKLITGSLDKTIRVWNYITGEC------------------------------------ 374

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ HS+ +  + + S  K + + SADKT + W ++   +   TL
Sbjct: 375 -------------ISTYRGHSDSV--LSVDSYQKVIVSGSADKTVKVWHVES--RTCYTL 417

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 418 RGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 79/217 (36%), Gaps = 57/217 (26%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLGAAGHQNVRLYDIRT 62
           ++VS   D T++ W   +  C     H++  VN +++          +    +R++DIRT
Sbjct: 394 VIVSGSADKTVKVWHVESRTCYTLRGHTE-WVNCVKLHPKSFSCFSCSDDTTIRMWDIRT 452

Query: 63  TNPNPVATFEGHKGNVTSL--------------------SFQQDNRWMVTSSE------- 95
            +   +  F GH G V  +                       QD   M+   E       
Sbjct: 453 NSC--LKVFRGHVGQVQKIIPLTIKDAENLATDNTSDGGGSLQDGSAMIDEPEAVAGDQE 510

Query: 96  -------------------DGTIKVWDVRSPSVPR-NYKHNAPVNEVVIHPNQGELISCD 135
                              D TIK+WDV++    R  + H   V ++    +   +IS  
Sbjct: 511 AAALDESIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGS 568

Query: 136 RDGNIRIWDLGENQCTHQLT----PEDNTPLQSLSVA 168
            DG+I++WDL   +C H         D  P Q+ S+ 
Sbjct: 569 HDGSIKVWDLQSGKCMHTFQGRRLQRDTQPTQTQSLG 605

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 200 VTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS 259
           + +FK H + +  + L  + + L T S D T   W L    KL   L GH   V    F 
Sbjct: 295 IQEFKGHMDGV--LTLQFNYRLLFTGSYDSTIGIWDLFTG-KLIRRLSGHTDGVKTLYF- 350

Query: 260 ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 351 -DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSV 388

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 14/83 (16%)

Query: 232 RTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           R W +   + FK+ES             GH   V    F  +   L T S D  + +WDL
Sbjct: 272 RPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQF--NYRLLFTGSYDSTIGIWDL 329

Query: 280 STREIVRQYGGHHKGAICVALND 302
            T +++R+  GH  G   +  +D
Sbjct: 330 FTGKLIRRLSGHTDGVKTLYFDD 352

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 129/286 (45%), Gaps = 37/286 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTT---NPNPV----- 68
           AL  VC  T Q+++  ++ L  ++D ++  AAG Q+  ++++ +  +   NPN +     
Sbjct: 454 ALPSVCMYTFQNTNKDMSCLNFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIMLNSAN 512

Query: 69  ----------ATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNA 117
                      T  GH G V S SF  DN+++++ SED T+++W + + +   +YK HN 
Sbjct: 513 NNYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNH 572

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSM 173
           PV +V   P      +   D   R+W      C H    ++       +  +S   +G  
Sbjct: 573 PVWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCY 627

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           +   +S   C +W      D S    V  F  H+  +  I +S D + L+T S D     
Sbjct: 628 VFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINI 681

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W +    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 682 WDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 97/231 (41%), Gaps = 29/231 (12%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQG 129
           TF+    +++ L+F  D R      +D  IK+W +   S+                 N  
Sbjct: 462 TFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSL-----------------NNP 504

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMP 189
            ++    + N R     ++     L     T + S S + D   L++ +      +W M 
Sbjct: 505 NIMLNSANNNYR----DDDPTCKTLVGHSGT-VYSTSFSPDNKYLLSGSEDKTVRLWSMD 559

Query: 190 NHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGH 249
            HT       +  +K H++ +  +  S    + AT S D+TAR WS D  + L     GH
Sbjct: 560 THT------ALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLR-IFAGH 612

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              V   +F  +  Y+ T SSD   R+WD+ST + VR + GH    IC+A+
Sbjct: 613 LNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAV 663

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +        A H Q  RL+     
Sbjct: 544 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 603

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 604 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 661

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I IWD+G  +   Q+       + SLS + +G++L++  +  +
Sbjct: 662 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 721

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T   + +P   F  +   +T
Sbjct: 722 VRVWDLKKATTEPSAEPDEPFIGYLGDVT 750

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 113/248 (45%), Gaps = 27/248 (10%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW--DVRSPSVPRNYK---HNAPV 119
           P  V  +EGH+  + SL   +D  W+ T+S+D  + +W  D ++    +  K   H  PV
Sbjct: 410 PIEVEMYEGHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPV 469

Query: 120 NEVVI-----HPNQGELISCDRDGNIRIWDLGENQ----CTHQLTPEDNT------PLQS 164
             V +      P    L+S   D  I+ W + + +      H +   + T       + +
Sbjct: 470 TAVGLPNVMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINA 529

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLAT 224
           L+V+ + S+   A+    C +W +    D   L+       H   +  +      K LAT
Sbjct: 530 LAVSPNDSVFATASYDKTCKIWSL----DTGELE--ATLANHKRGLWDVNFCQYDKLLAT 583

Query: 225 CSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
           CS DKT + WSLD  + +  TL+GH   V  C+F + +  LV++ +D  V+LWD ST E 
Sbjct: 584 CSGDKTVKIWSLD-TYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGEC 642

Query: 285 VRQYGGHH 292
           V+    H+
Sbjct: 643 VKTLDAHN 650

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 98/263 (37%), Gaps = 28/263 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSFQQ-DNR-- 88
           +N L+ T D   L  A   N  +   YD +T      A F GH G VT++      NR  
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNVMNRPW 482

Query: 89  --WMVTSSEDGTIKVWDVRSPSVPRN------------YKHNAPVNEVVIHPNQGELISC 134
             +++++S D TIK W V  P   ++              H   +N + + PN     + 
Sbjct: 483 PEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATA 542

Query: 135 DRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDA 194
             D   +IW L   +    L       L  ++      +L   +      +W +  ++  
Sbjct: 543 SYDKTCKIWSLDTGELEATLANHKRG-LWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVM 601

Query: 195 SNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVW 254
             L+       H+N + R    S  K L +  AD   + W      +   TLD H   +W
Sbjct: 602 KTLE------GHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTG-ECVKTLDAHNNRIW 654

Query: 255 DCAFSADSAYLVTASSDHYVRLW 277
             +   D   +VTA +D   + W
Sbjct: 655 ALSVLKDGDIIVTADADGVFQFW 677

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGA-AGHQNVRLYDIRT 62
           +  +A YD T + W   TG    T+ +    +  +      KLL   +G + V+++ + T
Sbjct: 538 VFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDT 597

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNE 121
              + + T EGH   V   SF   N+ +V+S  DG +K+WD  +    +    HN  +  
Sbjct: 598 Y--SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWA 655

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +   +++ D DG  + W
Sbjct: 656 LSVLKDGDIIVTADADGVFQFW 677

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 59/148 (39%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL    DG  L  A+      +W     T+    K   KF  H+  +T + L + +  
Sbjct: 423 LNSLDATEDGMWLATASKDNFVILWRYDEQTEL--FKQYAKFVGHAGPVTAVGLPNVMNR 480

Query: 220 ---KHLATCSADKTARTWSL------DDNFKL----ESTLDGHQRWVWDCAFSADSAYLV 266
              + L + S D T + W++       D   +    E T   H++ +   A S + +   
Sbjct: 481 PWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++W L T E+      H +G
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRG 568

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 80/194 (41%), Gaps = 40/194 (20%)

Query: 28  IQHSDSQ-VNRLEITNDKKLLGAAGH-QNVRLYDIRTTN-------PNPVATFEGHKGNV 78
           I++ D Q +  L IT D + L      Q +R+Y + +          +PV   E    +V
Sbjct: 75  IENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSSPVYVMEC---DV 131

Query: 79  TSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIH----PNQGELIS 133
           TS         +     DG++ + D+ +  V  ++K H   ++ V  H     N   L S
Sbjct: 132 TS-------TLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLAS 184

Query: 134 CDRDGNIRIWDLGENQCTH--------------QLTPEDNTPLQSLSVASDGSM-LVAAN 178
            D  G ++IWDL + +C H              ++  ED   +Q +S   D  + L   +
Sbjct: 185 GDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFD 244

Query: 179 SKGNCYVWE-MPNH 191
           S+  C + + +P H
Sbjct: 245 SRKKCKLLKTLPIH 258

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 102/231 (44%), Gaps = 9/231 (3%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ S  +    + H   +  +   P   +L+S   
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 431

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 432 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 490

Query: 197 LKPVTKFK-AHSNYITRILLSSDVKHLATCSADKTARTWSL------DDNFKLESTLDGH 249
           L    +    H + +  ++ + D + + + S D++ + W L        +   E T  GH
Sbjct: 491 LDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 550

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           + +V   A + D  Y+++ S D  V  WD ++   +    GH    I VA+
Sbjct: 551 KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 601

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 81/209 (38%), Gaps = 21/209 (10%)

Query: 96  DGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +G  +  D  S ++      +  +  V   P+   L +   D  IRIWDL   +    L 
Sbjct: 349 NGATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ 408

Query: 156 PEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILL 215
             +   + SL     G  LV+ +      +W++   T   +L             T  + 
Sbjct: 409 GHEQD-IYSLDYFPAGDKLVSGSGDRTVRIWDL--RTGQCSL----TLSIEDGVTTVAVS 461

Query: 216 SSDVKHLATCSADKTARTWSLDDNFKLESTLD-------GHQRWVWDCAFSADSAYLVTA 268
             D K++A  S D+T R W  +  F +E  LD       GH+  V+   F+ D   +V+ 
Sbjct: 462 PGDGKYIAAGSLDRTVRVWDSETGFLVER-LDSENELSTGHKDSVYSVVFTRDGRSVVSG 520

Query: 269 SSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
           S D  V+LWDL      R   G    A C
Sbjct: 521 SLDRSVKLWDL------RGLNGQKSHATC 543

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 18/156 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D  T 
Sbjct: 426 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-- 114
                  + N ++T  GHK +V S+ F +D R +V+ S D ++K+WD+R  +  +++   
Sbjct: 486 FLVERLDSENELST--GHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATC 543

Query: 115 ------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                 H   V  V    +   ++S  +D  +  WD
Sbjct: 544 EVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWD 579

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 100/219 (45%), Gaps = 9/219 (4%)

Query: 74  HKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELIS 133
           H+G +  L +  D   +++   D  +K+WD+ S S      H   V+ V +HP+     S
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAAS 273

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTD 193
              D    +WDL E +   QL    +  + +++  SDG++L +A     C +W++ +   
Sbjct: 274 ASFDLTWILWDL-ERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSG-- 330

Query: 194 ASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWV 253
               +P+ K + H+  I+ +  S +   LAT  AD T R W +  N   ES L  HQ   
Sbjct: 331 ----EPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI-RNVGTESALLAHQVAA 385

Query: 254 WDCAFSADSA-YLVTASSDHYVRLWDLSTREIVRQYGGH 291
            D  F  ++  +LV+   D  V +++    + +    GH
Sbjct: 386 LDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGH 424

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 93/239 (38%), Gaps = 23/239 (9%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV- 104
           LL   G   V+L+D+ +   N      GH G V+ +      R   ++S D T  +WD+ 
Sbjct: 230 LLSGGGDNLVKLWDMTS---NSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLE 286

Query: 105 RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQS 164
           R   +     H+  V  +    +   L S   D    IWDL   +   +L       +  
Sbjct: 287 RKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGA-ISG 345

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKP------VTKFKAHSNYITRILLSSD 218
           +  + +G  L  A + G   VW++ N    S L          KFK ++           
Sbjct: 346 VDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTF-------- 397

Query: 219 VKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              L +C  D+    ++ D+  KL ++L+GH   V+    + D + + +   D  ++ W
Sbjct: 398 ---LVSCGHDRLVNIFNADNWQKL-ASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 6/186 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNV-RLYDIRT 62
           +  SA +D T   W+    V  +  +     V  +   +D  LL +AG   V  ++D+R+
Sbjct: 270 LAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRS 329

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN-YKHNAPVNE 121
             P  +   EGH G ++ + +  +   + T+  DGT++VWD+R+         H     +
Sbjct: 330 GEP--IMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALD 387

Query: 122 VVIHPNQGE-LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           V    N G  L+SC  D  + I++    Q    L    +    ++ +  DGS + +    
Sbjct: 388 VKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRVF-TVDITEDGSTIYSGGKD 446

Query: 181 GNCYVW 186
            +   W
Sbjct: 447 RSLKQW 452

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 113/254 (44%), Gaps = 29/254 (11%)

Query: 59  DIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-----VPRNY 113
           DI+   P  V  +EGH   + SL   ++  W+ T S+D T+ +W + + S       R  
Sbjct: 384 DIQNCLPLEVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFT 443

Query: 114 KHNAPVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQC----THQLTPEDNT--- 160
            H  PV  V + PN         +I+   D  I+ W + +        H +   D T   
Sbjct: 444 GHAGPVTAVGL-PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRA 502

Query: 161 ---PLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
               + +LS++ + S+   A+    C +W    + D+  L+       H   +  +    
Sbjct: 503 HEKDINALSISPNDSVFATASYDKTCKIW----NVDSGELEGT--LANHKRGLWDVTFCQ 556

Query: 218 DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             K LATCS DKT + WSL+ +  +  TL+GH   V  C+F   +  +V+  +D  +++W
Sbjct: 557 YDKLLATCSGDKTIKVWSLE-SMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVW 615

Query: 278 DLSTREIVRQYGGH 291
           DLST E +R    H
Sbjct: 616 DLSTGECIRTLDAH 629

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 16/197 (8%)

Query: 4   ILVSAGYDHTIRFWEAL-----------TGVCSRTIQHSDSQVNRLEIT-NDKKLLGAAG 51
            +++A  D TI+ W                V   T +  +  +N L I+ ND     A+ 
Sbjct: 465 FIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASY 524

Query: 52  HQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR 111
            +  +++++ +       T   HK  +  ++F Q ++ + T S D TIKVW + S SV +
Sbjct: 525 DKTCKIWNVDSGELE--GTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVK 582

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             + H   V          +++S   DG I++WDL   +C   L    N  + +LSV SD
Sbjct: 583 TLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNR-IWALSVLSD 641

Query: 171 GSMLVAANSKGNCYVWE 187
           G   V A++ G    W+
Sbjct: 642 GKEFVTADADGVFQFWK 658

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 87/228 (38%), Gaps = 25/228 (10%)

Query: 67  PVATFEGHKGNVTSLSFQQDNR-----WMVTSSEDGTIKVWDVRSPSV----PRNYK--- 114
           P A F GH G VT++      R     +++T+S D TIK W V  P+       N K   
Sbjct: 438 PYARFTGHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSD 497

Query: 115 -----HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS 169
                H   +N + I PN     +   D   +IW++   +    L       L  ++   
Sbjct: 498 YTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLA-NHKRGLWDVTFCQ 556

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
              +L   +      VW +       ++  V   + H+N + R    +  K + +  AD 
Sbjct: 557 YDKLLATCSGDKTIKVWSL------ESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADG 610

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             + W L     +  TLD H   +W  +  +D    VTA +D   + W
Sbjct: 611 LIKVWDLSTGECIR-TLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 75/175 (42%), Gaps = 10/175 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           +  +A YD T + W   +G    T+  H     +      DK L   +G + ++++ + +
Sbjct: 518 VFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLES 577

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNE 121
              + V T EGH   V   SF   N+ +V++  DG IKVWD+ +    R    H+  +  
Sbjct: 578 M--SVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWA 635

Query: 122 VVIHPNQGELISCDRDGNIRIW------DLGENQCTHQLTPEDNTPLQSLSVASD 170
           + +  +  E ++ D DG  + W      +  EN    +L  E    LQ+     D
Sbjct: 636 LSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGD 690

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 66/148 (44%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
           L SL  + +G  L   +      +W++  + D+   KP  +F  H+  +T + L + +++
Sbjct: 403 LNSLDSSENGEWLATCSKDHTVILWKL--NADSEKFKPYARFTGHAGPVTAVGLPNVMRN 460

Query: 222 -----LATCSADKTARTWSLDD---------NFKL-ESTLDGHQRWVWDCAFSADSAYLV 266
                + T S D T + WS+           N K+ + T   H++ +   + S + +   
Sbjct: 461 TWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++W++ + E+      H +G
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRG 548

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 19/94 (20%)

Query: 96  DGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQG----ELISCDRDGNIRIWDLGENQC 150
           DG++ V D+ +  V  ++K H A ++ V  H  Q      L S D  G +++WDL    C
Sbjct: 122 DGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNC 181

Query: 151 TH--------------QLTPEDNTPLQSLSVASD 170
            H              +L+P D+  L+ L+   D
Sbjct: 182 IHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRD 215

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 32/250 (12%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY------KHNAP 118
           P  V  +EGH   + SL+  +D +W+ T+S+D T  +W   + S  R Y       H A 
Sbjct: 380 PIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTS-KRFYIYATFVGHAAS 438

Query: 119 VNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTP-----------EDNTP 161
           V+ V + PN  E      +I+   D  ++ W++   +      P                
Sbjct: 439 VSAVCL-PNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKD 497

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
           + ++S+A + S+   A+    C +W +         +PV     H   +  +      K 
Sbjct: 498 INAISMAPNDSIFATASYDKTCKLWNVDTG------EPVATLANHKRGLWDVSFCESEKW 551

Query: 222 LATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
           +ATCS DKT + WSL+ +F +  TL+GH   V  C+F      LV+A +D  +++WD+++
Sbjct: 552 IATCSGDKTVKIWSLE-SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIAS 610

Query: 282 REIVRQYGGH 291
            + ++   GH
Sbjct: 611 GDCIKNLDGH 620

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 4/147 (2%)

Query: 42  NDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKV 101
           ND     A+  +  +L+++ T  P  VAT   HK  +  +SF +  +W+ T S D T+K+
Sbjct: 506 NDSIFATASYDKTCKLWNVDTGEP--VATLANHKRGLWDVSFCESEKWIATCSGDKTVKI 563

Query: 102 WDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNT 160
           W + S +V +  + H   V        Q +L+S   DG I++WD+    C   L    N 
Sbjct: 564 WSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNR 623

Query: 161 PLQSLSVASDGSMLVAANSKGNCYVWE 187
            + +LSV  DG ++++A++      W+
Sbjct: 624 -IWALSVLEDGDLIISADADSVFQFWK 649

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 94/235 (40%), Gaps = 27/235 (11%)

Query: 69  ATFEGHKGNVTSLSF---QQDN--RWMVTSSEDGTIKVWDVR-------------SPSVP 110
           ATF GH  +V+++      + N  ++++T+S D T+K W++                S+ 
Sbjct: 430 ATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIY 489

Query: 111 RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             + H   +N + + PN     +   D   ++W++   +    L       L  +S    
Sbjct: 490 TRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLA-NHKRGLWDVSFCES 548

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
              +   +      +W + + T    L+       H+N + R    +  K L +  AD  
Sbjct: 549 EKWIATCSGDKTVKIWSLESFTVLKTLE------GHTNAVQRCSFMNKQKQLVSAGADGL 602

Query: 231 ARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW-DLSTREI 284
            + W +     +++ LDGH   +W  +   D   +++A +D   + W D +  EI
Sbjct: 603 IKVWDIASGDCIKN-LDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 122/311 (39%), Gaps = 38/311 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT--NDKKLLG--AAGHQNVR--- 56
           +L S   +   + W+ +T  C  T+Q   S +  ++ T  +DK +L     G  NV    
Sbjct: 163 LLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSF--QQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK 114
            ++I+  +   V T   H   + +  F    D  +  T+  D   ++ D+   SV +  K
Sbjct: 223 RFNIKGKSSKLVKTIPAHL-QIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTK 281

Query: 115 HNAPVNEV----VIHPNQG-ELISCDRDGNIRIWDLGEN---------QCTHQLTPEDNT 160
              P+ E+    VI  NQG +  +   D  I++               Q    +     T
Sbjct: 282 K--PIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEFIQIQEYIAGNHGT 339

Query: 161 PLQSLSVASDGSMLVAANSKGNCYVWEMPN---HTDASNLK-PVTKFKAHSNYITRILLS 216
                 V  +   +  A +  +  +  +P     T  ++L   V  ++ HS+ +  +  +
Sbjct: 340 VADLCLVTKNKDCIALATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACT 399

Query: 217 SDVKHLATCSADKTARTW---SLDDNFKLESTLDGHQRWVWDCAF-----SADSAYLVTA 268
            D + LAT S DKTA  W   +    F + +T  GH   V               Y++TA
Sbjct: 400 EDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITA 459

Query: 269 SSDHYVRLWDL 279
           S+D  V+ W++
Sbjct: 460 SNDLTVKKWEI 470

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 89/222 (40%), Gaps = 21/222 (9%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T +S   D ++++  S+   +K+ +V +  + R+ K ++P   +   P    +     D
Sbjct: 65  ITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVAIGGTD 124

Query: 138 GNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGS----MLVAANSKGNCYVWEMPNHTD 193
           G+I + D+      H       T + SL    +      +L + ++ G   VW++     
Sbjct: 125 GSITVIDIENGYIAHSFKGHGGT-ISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTR-- 181

Query: 194 ASNLKPVTKFKAHSNYITRILLS----SDVKHLATCSADKTARTWSLD---DNFKLESTL 246
               K     + HS+ I  I  +     DV +L T   D     W  +    + KL  T+
Sbjct: 182 ----KCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTI 237

Query: 247 DGHQRWVWDCAFSA--DSAYLVTASSDHYVRLWDLSTREIVR 286
             H + +  C F    D  +  TA  D   ++ DL+   +V+
Sbjct: 238 PAHLQ-IEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVK 278

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 18/149 (12%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL+   DG  L  A+      +W   N   +        F  H+  ++ + L + +  
Sbjct: 393 LNSLACTEDGQWLATASKDKTAILWHWNN--TSKRFYIYATFVGHAASVSAVCLPNVMEK 450

Query: 220 ---KHLATCSADKTARTWSL-----DDN---FKLESTL---DGHQRWVWDCAFSADSAYL 265
              K++ T S D T + W +     D N   F ++S++     H++ +   + + + +  
Sbjct: 451 NYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIF 510

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   +LW++ T E V     H +G
Sbjct: 511 ATASYDKTCKLWNVDTGEPVATLANHKRG 539

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 67/149 (44%), Gaps = 13/149 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQ-HSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           L+       ++     TGV +R+++  S S V   + T+    L A G  +  +  I   
Sbjct: 77  LIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTST---LVAIGGTDGSITVIDIE 133

Query: 64  NPNPVATFEGHKGNVTSLSFQQD---NRWMVTSSE-DGTIKVWDVRSPSVPRNYK-HNAP 118
           N     +F+GH G ++SL F  +   N W++ S + +G  KVWD+ +       + H++ 
Sbjct: 134 NGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSA 193

Query: 119 VNEVVIHPNQGE----LISCDRDGNIRIW 143
           +  +    N  +    LI+  RD  + +W
Sbjct: 194 IRGIDFTKNDDKDVLNLITGGRDNVLNLW 222

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 126/289 (43%), Gaps = 48/289 (16%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRT-IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           L S G+ D  I+ W +L G    T    ++   NR+ IT D+ L     H +  L     
Sbjct: 469 LASTGFQDSYIKIW-SLDGTSLNTKFTQANKDRNRITIT-DRSLT----HMDNEL----- 517

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
                 AT  GH G V S SF  DNR++++ SED T+++W + + +   +YK HN P+ +
Sbjct: 518 -----SATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWD 572

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ----------SLSVASDG 171
           V   P      +   D   R+W      C H        PL+           +S   +G
Sbjct: 573 VQFSPLGHYFATASHDQTARLW-----SCDHIF------PLRIFAGHLNDVDCVSFHPNG 621

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
             +   +S   C +W      D S    V  F  H++ +    +S D + L T S D T 
Sbjct: 622 YYVFTGSSDKTCRMW------DISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTI 675

Query: 232 RTWSLDDNFKLESTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
             W +    +L+S L GH +  V+   +S +   LV++ +D  VR+WDL
Sbjct: 676 NVWDIGSGKRLKS-LRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 113/270 (41%), Gaps = 37/270 (13%)

Query: 37  RLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVA-----TFEGHKGNVTSLSFQQDNRWMV 91
           RLEI   ++       +++RL     TNPN +      TF     ++TSL F  D R   
Sbjct: 421 RLEIQKVRE-----SRESIRL----DTNPNSLPSVCMYTFHNTNQDMTSLEFSDDCRLAS 471

Query: 92  TSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           T  +D  IK+W +   S+   + + N   N + I          DR       +L     
Sbjct: 472 TGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITI---------TDRSLTHMDNELSATLI 522

Query: 151 THQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYI 210
            H  T      + S S + D   L++ +      +W +  HT       +  +K H++ I
Sbjct: 523 GHSGT------VYSTSFSPDNRYLISGSEDKTVRLWSLDTHT------ALVSYKGHNHPI 570

Query: 211 TRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASS 270
             +  S    + AT S D+TAR WS D  F L     GH   V   +F  +  Y+ T SS
Sbjct: 571 WDVQFSPLGHYFATASHDQTARLWSCDHIFPLR-IFAGHLNDVDCVSFHPNGYYVFTGSS 629

Query: 271 DHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           D   R+WD+ST + VR + GH    +  A+
Sbjct: 630 DKTCRMWDISTGDSVRLFLGHTSAVVSTAV 659

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 120/277 (43%), Gaps = 36/277 (12%)

Query: 42  NDKKLLGAAGHQNVRLYDIRTTN----PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDG 97
           N  KL  A     +R+  + ++     P  V  +EGH+  + SL    D  WM T+S+D 
Sbjct: 349 NHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNSLDTTDDGLWMATASKDH 408

Query: 98  TIKVWDVRS------PSVPRNYKHNAPVNEVVIHPN---QGE---LISCDRDGNIRIWDL 145
           T  VW   S      P V +   H+A V  V + PN   +G    L++   D  I+ W +
Sbjct: 409 TAIVWKYNSIINKFQPYV-KFIGHSATVTAVGL-PNVMLRGYPEFLLTASNDLTIKKWKI 466

Query: 146 G------ENQCTHQLTPE-----DNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDA 194
                  E  C      E         + +L+++ + S+   A+    C +W++ N    
Sbjct: 467 PKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELT 526

Query: 195 SNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVW 254
           + L        H   +  +      K +ATCS DKT + WSLD  F +  TL+GH   V 
Sbjct: 527 ATLS------NHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLD-TFSVMKTLEGHTNAVQ 579

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            C F      LV++ +D  +++WD ST + ++   GH
Sbjct: 580 RCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 93/198 (46%), Gaps = 17/198 (8%)

Query: 4   ILVSAGYDHTIRFWE------------ALTGVCSRTIQHSDSQVNRLEIT-NDKKLLGAA 50
            L++A  D TI+ W+             +  V   T +  +  +N L I+ ND     A+
Sbjct: 451 FLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATAS 510

Query: 51  GHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP 110
             +  +++D+   N    AT   HK  +  ++F Q ++ + T S D TIK+W + + SV 
Sbjct: 511 YDKTCKIWDLE--NGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVM 568

Query: 111 RNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS 169
           +  + H   V   +    Q +L+S   DG I+IWD     C   L   DN  + +L+  +
Sbjct: 569 KTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNR-IWALTEIN 627

Query: 170 DGSMLVAANSKGNCYVWE 187
           DG M+V+A++ G    W+
Sbjct: 628 DGDMIVSADADGVFQFWK 645

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 98/266 (36%), Gaps = 33/266 (12%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF-----QQD 86
           +N L+ T+D   +  A   +  +   Y+       P   F GH   VT++       +  
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGY 448

Query: 87  NRWMVTSSEDGTIKVWDVRSPSVP-------------RNYKHNAPVNEVVIHPNQGELIS 133
             +++T+S D TIK W +  PS                   H   +N + I PN     +
Sbjct: 449 PEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFAT 508

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTD 193
              D   +IWDL   + T  L+      L  ++      ++   +      +W +   + 
Sbjct: 509 ASYDKTCKIWDLENGELTATLSNHKR-GLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSV 567

Query: 194 ASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW--SLDDNFKLESTLDGHQR 251
              L+       H+N + R +  +    L +  AD   + W  S  D  K   TLDGH  
Sbjct: 568 MKTLE------GHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLK---TLDGHDN 618

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLW 277
            +W      D   +V+A +D   + W
Sbjct: 619 RIWALTEINDGDMIVSADADGVFQFW 644

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYIT-----RILLS 216
           L SL    DG  +  A+      VW+   ++  +  +P  KF  HS  +T      ++L 
Sbjct: 389 LNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVTAVGLPNVMLR 446

Query: 217 SDVKHLATCSADKTARTW-------SLDDNFKL----ESTLDGHQRWVWDCAFSADSAYL 265
              + L T S D T + W       +++++ ++    E T   H++ +   A S + +  
Sbjct: 447 GYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF 506

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   ++WDL   E+      H +G
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKRG 535

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 8/112 (7%)

Query: 96  DGTIKVWDVRSPSVPRNYK-HNAPVNEVVI----HPNQGELISCDRDGNIRIWDLGENQC 150
           DG+I V D+ +  +  + K H A ++ +      + N   L S D +G +++WDL + +C
Sbjct: 127 DGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKC 186

Query: 151 THQLTPEDNTPLQSLSVASDGS--MLVAANSKGNCYVWEMPNHTDASNLKPV 200
            H +    N  ++ L V   G    L++      C +W        + LK +
Sbjct: 187 LHTMQEHSNA-VRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTI 237

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 128/283 (45%), Gaps = 34/283 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTT------------- 63
           AL  VC  T Q+++  ++ L+ ++D ++  AAG Q+  ++++ +  +             
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIALNNND 511

Query: 64  -NPNPV-ATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVN 120
            + +P   T  GH G V S SF  DN+++++ SED T+++W + + +   +YK HN PV 
Sbjct: 512 KDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVW 571

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVA 176
           +V   P      +   D   R+W      C H    ++       +  +S   +G  +  
Sbjct: 572 DVSFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
            +S   C +W      D S    V  F  H+  +  I +  D + L+T S D     W +
Sbjct: 627 GSSDKTCRMW------DVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDI 680

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
               +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 681 GTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 92/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +        A H Q  RL+     
Sbjct: 540 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 599

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 600 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISI 657

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS + +G++L++  +   
Sbjct: 658 AVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHT 717

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T   + +P   F  +   +T
Sbjct: 718 VRVWDLKKATTEPSAEPDEPFIGYLGDVT 746

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 95/231 (41%), Gaps = 32/231 (13%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQG 129
           TF+    +++ L F  D R      +D  IK+W +   S               ++    
Sbjct: 461 TFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSS---------------LNNPNI 505

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMP 189
            L + D+D         E+     L     T + S S + D   L++ +      +W M 
Sbjct: 506 ALNNNDKD---------EDPTCKTLVGHSGT-VYSTSFSPDNKYLLSGSEDKTVRLWSMD 555

Query: 190 NHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGH 249
            HT       +  +K H++ +  +  S    + AT S D+TAR WS D  + L     GH
Sbjct: 556 THT------ALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLR-IFAGH 608

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              V   +F  +  Y+ T SSD   R+WD+ST + VR + GH    I +A+
Sbjct: 609 LNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

>CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar to
           uniprot|P39014 Saccharomyces cerevisiae YIL046w MET30
          Length = 673

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 129/299 (43%), Gaps = 36/299 (12%)

Query: 4   ILVSAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           +L +  YD T+  W+  TG +  R   HSD  V  L   +D+KL+  +  + +R+++  T
Sbjct: 346 LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDG-VKTLYF-DDQKLITGSLDKTIRVWNYIT 403

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
                ++T+ GH  +V  +S     + +V+ S D T+KVW V S +      H   VN V
Sbjct: 404 GEC--ISTYRGHTDSV--MSVDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCV 459

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAA 177
            +HP      SC  D  IR+WD+  N C      H    +   PL  +    D   LV  
Sbjct: 460 KLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTII----DAQNLVTH 515

Query: 178 NSKGNCYVWEMPNHTD--ASNL----KPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
             K        P   D  ASN      P            ++   +   HL +C+ D T 
Sbjct: 516 ERK--------PGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPT---HLLSCALDNTI 564

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           + W +     + +   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 565 KLWEVRSGRCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 620

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 87/224 (38%), Gaps = 56/224 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           +  F+GH   V +L F  + R + T S D T+ +WD+ +  + R    ++   + +   +
Sbjct: 327 IQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDD 384

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+    +C                                     
Sbjct: 385 Q-KLITGSLDKTIRVWNYITGEC------------------------------------- 406

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
                       ++ ++ H++ +  +   S  K + + SADKT + W ++   +   TL 
Sbjct: 407 ------------ISTYRGHTDSVMSV--DSHKKIIVSGSADKTVKVWHVES--RTCYTLK 450

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S    + S D  +R+WD+ T   +R + GH
Sbjct: 451 GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGH 494

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 45/102 (44%), Gaps = 5/102 (4%)

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
           L  + +FK H + +  + L  + + L T S D T   W L    KL   L GH   V   
Sbjct: 324 LCTIQEFKGHMDGV--LTLQFNYRLLFTGSYDTTVAIWDLFTG-KLIRRLTGHSDGVKTL 380

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            F  D   L+T S D  +R+W+  T E +  Y GH    + V
Sbjct: 381 YF--DDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSV 420

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 14/83 (16%)

Query: 232 RTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           ++W +   + FK+ES             GH   V    F  +   L T S D  V +WDL
Sbjct: 304 KSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQF--NYRLLFTGSYDTTVAIWDL 361

Query: 280 STREIVRQYGGHHKGAICVALND 302
            T +++R+  GH  G   +  +D
Sbjct: 362 FTGKLIRRLTGHSDGVKTLYFDD 384

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 132/310 (42%), Gaps = 39/310 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTT------------- 63
           AL  VC  T  ++D  +  LE ++D +L  AAG Q+  ++++ +  +             
Sbjct: 483 ALPSVCMYTFHNTDRDMTSLEFSDDCRL-AAAGFQDSQIKIFSLDGSSLNSKLTESNKKT 541

Query: 64  -----NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNA 117
                N    +T  GH G V S SF  DNR++V+ SED T+++W + + +   +YK HN 
Sbjct: 542 NKLLNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNH 601

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSM 173
           PV +V   P      +   D   R+W      C H    ++       +  +S   +G  
Sbjct: 602 PVWDVEFSPLGHYFATASHDHTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCY 656

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           L   +S   C +W      D +    V  F   +  +    +S D + L+T S D     
Sbjct: 657 LFTGSSDKTCRMW------DITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINV 710

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +    +L+      +  ++  +++ +   L++  +DH VR+WDL  ++   + G   +
Sbjct: 711 WDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL--KKATTESGAEPE 768

Query: 294 GAICVALNDV 303
                 L DV
Sbjct: 769 EPFVGYLGDV 778

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 96/219 (43%), Gaps = 5/219 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           LVS   D T+R W   T     + +  +  V  +E +        A H    RL+     
Sbjct: 573 LVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSC--D 630

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
           +  P+  F GH  +V  +SF  +  ++ T S D T ++WD+ +    R +    APV   
Sbjct: 631 HIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMST 690

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS   +G++L++  +  +
Sbjct: 691 SVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHS 750

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
             VW++   T  S  +P   F  +   +T   ++ D+K 
Sbjct: 751 VRVWDLKKATTESGAEPEEPFVGYLGDVT-TSINQDIKE 788

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 123/290 (42%), Gaps = 69/290 (23%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDI-----------RTTNPNPVA 69
           VC  T  +++ ++  L  ++D +L+ AAG Q+  ++L+ +           +  + +   
Sbjct: 478 VCMYTFHNTNREMTCLRFSDDSRLV-AAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTV 536

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQ 128
           T  GH G V S+SF  DNR++V++SED T+++W + + +   +YK HN PV +V   P  
Sbjct: 537 TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLG 596

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEM 188
               +   D   R+W      C H                                    
Sbjct: 597 HYFATGSHDQTARLW-----SCDH------------------------------------ 615

Query: 189 PNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD--DNFKLESTL 246
                   + P+  F  H N +  +    +  ++ T S+DKT R W +   D+ +L    
Sbjct: 616 --------IYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRL---F 664

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAI 296
            GH   V   A S D  +L T S D  + +WD+ T + ++Q  GH K A+
Sbjct: 665 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAV 714

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 96/204 (47%), Gaps = 4/204 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           LVSA  D T+R W   T  C  + +  +  V  ++ +          H Q  RL+     
Sbjct: 557 LVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHI 616

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  ++F  +  +++T S D T ++WD+++    R +  H A V  V
Sbjct: 617 YP--LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 674

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+     + + SLS   +G++LV+  +  +
Sbjct: 675 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQS 734

Query: 183 CYVWEMPNHTDASNLKPVTKFKAH 206
             VW++   T+  +L+P   +  +
Sbjct: 735 VRVWDLKKFTNEPSLEPEQPYSGY 758

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 109/248 (43%), Gaps = 37/248 (14%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           +++ +++T+ P+  + TF      +T L F  D+R +    +D  IK+W +         
Sbjct: 466 IKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDG------- 518

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSM 173
                       P + +L S  +D +  +  +G +            P+ S+S + D   
Sbjct: 519 -----------TPLESQLPSKAKDASNTVTLIGHS-----------GPVYSVSFSPDNRY 556

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           LV+A+      +W +  +T       +  +K H++ +  +  S    + AT S D+TAR 
Sbjct: 557 LVSASEDKTVRLWSLDTYTC------LVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARL 610

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           WS D  + L     GH   V    F  +  Y++T SSD   R+WD+ T + VR + GH  
Sbjct: 611 WSCDHIYPLR-IFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTA 669

Query: 294 GAICVALN 301
             + VA++
Sbjct: 670 SVVSVAVS 677

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 122/290 (42%), Gaps = 69/290 (23%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDI-----------RTTNPNPVA 69
           VC  T  +++  +  L+ + D +L+ AAG Q+  ++++ +           ++   +   
Sbjct: 463 VCMYTFHNTNRDMTSLQFSEDSRLV-AAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTT 521

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQ 128
           T  GH G V S+SF  DNR++V++SED T+++W + + +   +YK HN PV +V   P  
Sbjct: 522 TLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLG 581

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEM 188
               +   D   R+W      C H                                    
Sbjct: 582 HYFATVSHDQTARLW-----SCDH------------------------------------ 600

Query: 189 PNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD--DNFKLESTL 246
                   + P+  F  H N +  +    +  ++ T S+DKT R W +   D+ +L    
Sbjct: 601 --------IYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRL---F 649

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAI 296
            GH   V   A S D  +L T S D  + +WD+ T + ++Q  GH K A+
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAV 699

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 96/205 (46%), Gaps = 4/205 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           LVSA  D T+R W   T  C  + +  +  V  ++ +          H Q  RL+     
Sbjct: 542 LVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHI 601

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  ++F  +  +++T S D T ++WD+++    R +  H A V  V
Sbjct: 602 YP--LRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSV 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+     + + SLS   +G++LV+  +  +
Sbjct: 660 AVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQS 719

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHS 207
             VW++   T+   L+P   +  +S
Sbjct: 720 VRVWDLKKFTNEPALEPEQPYSGYS 744

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 111/248 (44%), Gaps = 37/248 (14%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           ++L +++T+ P+  + TF     ++TSL F +D+R +    +D  IK+W +         
Sbjct: 451 IKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDG------- 503

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSM 173
                       P + +L S  ++ +     +G +            P+ S+S + D   
Sbjct: 504 -----------TPLESKLPSKSKEASNTTTLIGHS-----------GPVYSVSFSPDNRY 541

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           LV+A+      +W +   T       +  +K H++ +  +  S    + AT S D+TAR 
Sbjct: 542 LVSASEDKTVRLWSLDTFTC------LVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARL 595

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           WS D  + L     GH   V   AF  +  Y++T SSD   R+WD+ T + VR + GH  
Sbjct: 596 WSCDHIYPLR-IFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTA 654

Query: 294 GAICVALN 301
             + VA++
Sbjct: 655 SVVSVAVS 662

>TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.231
           YIL046W
          Length = 687

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 131/299 (43%), Gaps = 35/299 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R    S   V  L   + +KL+  +  + +++++  T 
Sbjct: 352 LLFTGSYDSTVAAWDLYTGKLIRRFVGSFDGVKTLHF-DGQKLVTGSLDKTIKVWNYLT- 409

Query: 64  NPNPVATFEGHKGNVTSL-SFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
               ++T+ GH  +V S+ SF+   + +V+ S D T+KVW V S S      H   VN V
Sbjct: 410 -GECISTYRGHTDSVMSVDSFK---KIIVSGSADKTVKVWHVESRSCYTLRGHTEWVNSV 465

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVAS---DGSML 174
            +HP    L SC  D  IR+WD+  N C      H    +   PL  + + +   D  ++
Sbjct: 466 KLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVVDPKII 525

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVK---HLATCSADKTA 231
           V              +  + +      +   +      I L S +    HL +CS D T 
Sbjct: 526 V--------------DEENNNENNENNENNENREGNESITLDSSLSYPTHLLSCSLDNTI 571

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
           + W +    K   T  GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 572 KLWDVQTG-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFQG 627

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 86/224 (38%), Gaps = 56/224 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           V  F+GH  +V +L F    R + T S D T+  WD+ +  + R +  +       +H +
Sbjct: 333 VQEFKGHMDSVLTLQFTH--RLLFTGSYDSTVAAWDLYTGKLIRRFVGSFD-GVKTLHFD 389

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
             +L++   D  I++W+    +C                                     
Sbjct: 390 GQKLVTGSLDKTIKVWNYLTGEC------------------------------------- 412

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
                       ++ ++ H++ +  +   S  K + + SADKT + W ++   +   TL 
Sbjct: 413 ------------ISTYRGHTDSVMSV--DSFKKIIVSGSADKTVKVWHVES--RSCYTLR 456

Query: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           GH  WV        S  L + S D  +R+WD+ T   ++ + GH
Sbjct: 457 GHTEWVNSVKLHPKSFCLFSCSDDTTIRMWDIRTNVCLKVFRGH 500

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 20/185 (10%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNR---LEITNDKKLLGAAGHQNVRLY 58
           S  L S   D TIR W+  T VC +  +    QV +   L I + + L+           
Sbjct: 471 SFCLFSCSDDTTIRMWDIRTNVCLKVFRGHVGQVQKVIPLTIIDIENLVVDPKIIVDEEN 530

Query: 59  DIRTTNPNPVATFEGHKGNVT---SLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR-NYK 114
           +      N          ++T   SLS+      +++ S D TIK+WDV++    R  + 
Sbjct: 531 NNENNENNENNENREGNESITLDSSLSYPTH---LLSCSLDNTIKLWDVQTGKCIRTQFG 587

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSML 174
           H   V ++    +   +IS   DG+I+IWDL   +C H          Q +S+ +     
Sbjct: 588 HVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMH--------TFQGMSLYTGAGAN 637

Query: 175 VAANS 179
           VA N+
Sbjct: 638 VANNN 642

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 109/247 (44%), Gaps = 26/247 (10%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW----DVRSPSVPRNY-KHNAPV 119
           P  V  +EGH+  + SL   +D  W+ T+S+D +  VW    + R   V   Y  H++ V
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAV 437

Query: 120 NEV----VIHPNQGE-LISCDRDGNIRIW---------DLGENQCTHQLTPEDNTPLQSL 165
             V    ++     E L++   D  I+ W         D+   + +          + +L
Sbjct: 438 TAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINAL 497

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           S++ + S+   A+    C +W + N    + L        H   +  +      K LATC
Sbjct: 498 SISPNDSIFATASYDKTCKIWNLENGELEATLS------NHKRGLWDVTFCQYDKLLATC 551

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S DKT + WSLD  F +  TL+GH   V  C+F      LV+  +D  +++WD S+ E +
Sbjct: 552 SGDKTVKIWSLD-TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECL 610

Query: 286 RQYGGHH 292
           +   GH+
Sbjct: 611 KTLDGHN 617

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 15/196 (7%)

Query: 4   ILVSAGYDHTIRFW---------EALTGVCSRTIQHS-DSQVNRLEIT-NDKKLLGAAGH 52
            L++A  D TI+ W         +  T   S   +H+ +  +N L I+ ND     A+  
Sbjct: 453 FLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATASYD 512

Query: 53  QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN 112
           +  +++++   N    AT   HK  +  ++F Q ++ + T S D T+K+W + + SV + 
Sbjct: 513 KTCKIWNLE--NGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKT 570

Query: 113 YK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDG 171
            + H   V        Q +L+SC  DG I+IWD    +C   L   +N  L +L+  +DG
Sbjct: 571 LEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNR-LWALNTMNDG 629

Query: 172 SMLVAANSKGNCYVWE 187
            ++V+A++ G    W+
Sbjct: 630 DIIVSADADGVFQFWK 645

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 99/262 (37%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSFQQDN---- 87
           +N L+ T D   +  A   N  +   Y+  T      + + GH   VT++   +      
Sbjct: 391 LNSLDATEDGLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAVTAVGLPKIMPKGY 450

Query: 88  -RWMVTSSEDGTIKVWDVRSPSVPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W +  P+ P + +           H   +N + I PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATAS 510

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D   +IW+L EN             L  ++      +L   +      +W +   +   
Sbjct: 511 YDKTCKIWNL-ENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMK 569

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
            L+       H+N + R    +  K L +C AD   + W       L+ TLDGH   +W 
Sbjct: 570 TLE------GHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLK-TLDGHNNRLWA 622

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 623 LNTMNDGDIIVSADADGVFQFW 644

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query: 47  LGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSF--QQDNR-WMVTSSE-DGTIKVW 102
           L A G  +  +  +   N     +F+GH G ++SL F  Q D++ W++ S + +G +KVW
Sbjct: 116 LLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVW 175

Query: 103 D-VRSPSVPRNYKHNAPVNEVVIHPNQG------ELISCDRDGNIRIWDL 145
           D V+   +    +H++ V  + I   Q       +L+S  RD  I IWD 
Sbjct: 176 DLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDF 225

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 60/147 (40%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYIT-----RILLS 216
           L SL    DG  +  A+   +  VW+   +T     +  +K+  HS+ +T     +I+  
Sbjct: 391 LNSLDATEDGLWIATASKDNSAIVWKYNENT--RKFEVYSKYIGHSSAVTAVGLPKIMPK 448

Query: 217 SDVKHLATCSADKTARTWSLDD-NFKL--------ESTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W +    F          E T   H++ +   + S + +   T
Sbjct: 449 GYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFAT 508

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W+L   E+      H +G
Sbjct: 509 ASYDKTCKIWNLENGELEATLSNHKRG 535

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 58/309 (18%), Positives = 120/309 (38%), Gaps = 35/309 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-------KLLGAAGHQNVR 56
           +L S   +  ++ W+ +   C  T+Q   S V  L+I   +       KLL       + 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIIN 221

Query: 57  LYDIRTTNPNPVATFEGHKGNVTS---LSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           ++D        +         V S   L +  D   + T+  D   ++ D+ S  + +  
Sbjct: 222 IWDFNMKKTCKLIKTLPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDLESGIMIK-- 279

Query: 114 KHNAPVNEVVIHP-----NQGELISCDRDGNIRIWDLGEN-QCTHQLTPEDNTPLQSLSV 167
           K N P+ E+ I       +  ++     D  +++ ++ E  +  +++    +T   +  +
Sbjct: 280 KTNKPIEELFIIGVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEIIEVSSTIAGNHGI 339

Query: 168 ASDGSM-------LVAANSKGNCYVWEMPN--HTDASNLKPVTKFKAHSNYITRILLSSD 218
            +D          L  A +  +  +  +P+   T AS    V  ++ H + +  +  + D
Sbjct: 340 IADMRFVGPELNKLALATNSPSLRIIPIPDLAGTTASLPLDVEIYEGHEDLLNSLDATED 399

Query: 219 VKHLATCSADKTARTWSLDDN---FKLESTLDGHQRWVWDCAF-----SADSAYLVTASS 270
              +AT S D +A  W  ++N   F++ S   GH   V               +L+TAS+
Sbjct: 400 GLWIATASKDNSAIVWKYNENTRKFEVYSKYIGHSSAVTAVGLPKIMPKGYPEFLLTASN 459

Query: 271 DHYVRLWDL 279
           D  ++ W +
Sbjct: 460 DLTIKKWKI 468

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 90  MVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGE----LISCDRDGNIRIWD 144
           +     DG+I V D+ +  +  ++K H   ++ +  +         L S D +G +++WD
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWD 176

Query: 145 LGENQCTHQL 154
           L + +C H L
Sbjct: 177 LVKRKCLHTL 186

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 124/282 (43%), Gaps = 36/282 (12%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPV-------- 68
           A   VC  T  +++  +  LE ++D  L  AAG Q+  ++L+ +  T   P+        
Sbjct: 408 AAPSVCMYTFHNTNRDMTCLEFSDDATL-AAAGFQDSYIKLWSLDGT---PLDSKLPSKQ 463

Query: 69  ------ATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
                  T  GH G V S SF  DN++++++SED T+++W + + S   +YK HN PV +
Sbjct: 464 REKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWD 523

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVAA 177
           V   P      +   D   R+W      C H    ++       +  +S   +G+ +   
Sbjct: 524 VSFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTG 578

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
           ++   C +W      D      V  F  H+  +    +S D + L+T S D     W + 
Sbjct: 579 STDKTCRMW------DIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIG 632

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
              +L+      +  V+  ++S +   LV+  +DH VR+WDL
Sbjct: 633 TGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 93/204 (45%), Gaps = 4/204 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T     + +  +  V  +  +        A H Q  RL+     
Sbjct: 491 LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSC--D 548

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
           +  P+  F GH  +V  +SF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 549 HIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIST 608

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+       + SLS + +G++LV+  +  +
Sbjct: 609 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHS 668

Query: 183 CYVWEMPNHTDASNLKPVTKFKAH 206
             VW++   T   N +P   F ++
Sbjct: 669 VRVWDLKRSTAEPNTEPEQPFTSY 692

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 45/100 (45%), Gaps = 1/100 (1%)

Query: 201 TKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA 260
           T    HS  +     S D K+L + S DKT R WS+D    L S   GH   VWD +FS 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVS-YKGHNHPVWDVSFSP 528

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              Y  TAS D   RLW       +R + GH     CV+ 
Sbjct: 529 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 568

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 19/178 (10%)

Query: 136 RDGNIRIWDLGENQCTHQLTPE-----DNTPL-------QSLSVASDGSMLVAANSKGNC 183
           +D  I++W L       +L  +     +NT L        S S + D   L++A+     
Sbjct: 441 QDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTV 500

Query: 184 YVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLE 243
            +W M  ++       +  +K H++ +  +  S    + AT S D+TAR WS D  + L 
Sbjct: 501 RLWSMDTYSS------LVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLR 554

Query: 244 STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
               GH   V   +F  +  Y+ T S+D   R+WD+ T + VR + GH    I  A++
Sbjct: 555 -IFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVS 611

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDD---NFKLES---------TLDGHQRWVWDCA 257
           +T +  S D    A    D   + WSLD    + KL S         TL GH   V+  +
Sbjct: 424 MTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTS 483

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           FS D+ YL++AS D  VRLW + T   +  Y GH+
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHN 518

>Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii ADL082C
          Length = 583

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 130/309 (42%), Gaps = 38/309 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +G   R +      V  +   +D+KL+  +  + +R+++  T 
Sbjct: 282 LLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRF-DDQKLITGSLDKTIRVWNYVTG 340

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               V+T+ GH+ +V  LS     + +V+ S D T+KVW V S +      H   +N V 
Sbjct: 341 KC--VSTYRGHQDSV--LSVDSFRKIIVSGSADKTVKVWHVESRTCYTLRGHTKWINCVK 396

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDNTPLQSLSVASDGSM 173
           +HP      S   D  IR+WD+  N C            ++ P +      +  A D ++
Sbjct: 397 LHPKSFTCFSGSDDTTIRMWDIRTNTCIKIFRGHVGQVQKVIPLNLVDENLVQDAEDATV 456

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           +    +         P + D S   P        NY            L +CS D T + 
Sbjct: 457 ISDVENTDVEDPTVNPENWDDSLPYP--------NY------------LLSCSLDNTIKL 496

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +  + K   T  GH   VWD A  AD+  +V+ S D   ++WDL T + +  + G+  
Sbjct: 497 WDVKTS-KCIRTQFGHVEGVWDIA--ADNFRIVSGSHDRTCKVWDLQTGKCMHTFTGNQA 553

Query: 294 GAICVALND 302
              CV + D
Sbjct: 554 PIACVGIGD 562

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 100/268 (37%), Gaps = 55/268 (20%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           V  F GH   V SL F      + T S D T+ +WD+ S  + R    +    + V   +
Sbjct: 263 VQEFMGHMDGVLSLQFTHS--LLFTGSYDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFDD 320

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
           Q +LI+   D  IR+W+    +C        ++    LSV S   ++V+ ++     VW 
Sbjct: 321 Q-KLITGSLDKTIRVWNYVTGKCVSTYRGHQDS---VLSVDSFRKIIVSGSADKTVKVWH 376

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLD 247
           + + T           + H+ +I  + L        + S D T R W +  N  ++    
Sbjct: 377 VESRT-------CYTLRGHTKWINCVKLHPKSFTCFSGSDDTTIRMWDIRTNTCIK-IFR 428

Query: 248 GHQRWV----------------------------------------WDCAFSADSAYLVT 267
           GH   V                                        WD +    + YL++
Sbjct: 429 GHVGQVQKVIPLNLVDENLVQDAEDATVISDVENTDVEDPTVNPENWDDSLPYPN-YLLS 487

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKGA 295
            S D+ ++LWD+ T + +R   GH +G 
Sbjct: 488 CSLDNTIKLWDVKTSKCIRTQFGHVEGV 515

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL  +    ++L+D++T+    + T  GH   V  ++   DN  +V+ S D T KVWD++
Sbjct: 485 LLSCSLDNTIKLWDVKTSKC--IRTQFGHVEGVWDIA--ADNFRIVSGSHDRTCKVWDLQ 540

Query: 106 SPSVPRNYKHN-APVNEVVIHPNQGELISCDRDGNIRIW 143
           +      +  N AP+  V I     E +S D  G ++++
Sbjct: 541 TGKCMHTFTGNQAPIACVGI--GDSEFVSGDELGCVKLY 577

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 16/93 (17%)

Query: 224 TCSADKTA--RTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTAS 269
           TC+    A  R W +   + FK+ES             GH   V    F+   + L T S
Sbjct: 230 TCAKSSLAKMRPWKVVYRERFKVESNWRKGVYKVQEFMGHMDGVLSLQFT--HSLLFTGS 287

Query: 270 SDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
            D  V +WDL + +++R+  GH  G  CV  +D
Sbjct: 288 YDSTVAIWDLCSGKLLRRLTGHTDGVKCVRFDD 320

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 102/231 (44%), Gaps = 9/231 (3%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P   +L+S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVWDSETGFLVER 473

Query: 197 LKPVTKFK-AHSNYITRILLSSDVKHLATCSADKTARTWSL------DDNFKLESTLDGH 249
           L    +    H + +  ++ + D + + + S D++ + W L        +   E T  GH
Sbjct: 474 LDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 533

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           + +V   A + D  Y+++ S D  V  WD ++   +    GH    I VA+
Sbjct: 534 KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAV 584

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 99/252 (39%), Gaps = 31/252 (12%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE-ITNDKKLLGAAGHQNVRLYDIRTT 63
           L +   D  IR W+  T     T+Q  +  +  L+      KL+  +G + VR++D+RT 
Sbjct: 367 LATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTG 426

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY--------KH 115
             +   + E   G  T      D +++   S D T++VWD  +  +             H
Sbjct: 427 QCSLTLSIE--DGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGH 484

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDL-GEN------QCTHQLTPEDNTPLQSLSVA 168
              V  VV   +   +IS   D ++++WDL G N       C    T   +  L   +  
Sbjct: 485 KDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQ 544

Query: 169 SDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRIL------LSSDVKHL 222
            D  +L  +  +G  + W      D ++  P+   + H N +  +       L  DV   
Sbjct: 545 DDEYILSGSKDRGVLF-W------DTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVF 597

Query: 223 ATCSADKTARTW 234
           AT S D  AR W
Sbjct: 598 ATGSGDCKARIW 609

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  YL T + D  +R+WDL+T++I+    GH +
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQ 395

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 103/237 (43%), Gaps = 14/237 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    K H   +  +   P+  +L+S   
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QCT  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSDTGFLVER 676

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-----------NFKLES 244
           L    +    H + +  ++ + D   + + S D++ + W+L +           +   E 
Sbjct: 677 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEV 736

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
           T  GH+ +V   A + D  Y+++ S D  V  WD  +   +    GH    I VA+N
Sbjct: 737 TYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVN 793

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 16/120 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG C+ T+   D          D K + A    + VR++D    
Sbjct: 612 LVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTG 671

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
               R  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++      RN  HN
Sbjct: 672 FLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL------RNVNHN 723

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 133/334 (39%), Gaps = 54/334 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +L+      N VRL++ +T 
Sbjct: 156 MVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTG 215

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
            P   A   GH   +TSLS++        +   + TSS+DGTIK+WD            +
Sbjct: 216 KPFGDA-LRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGH 274

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT-------------------- 155
                 V    Q  L S   D  +R+WD+    +C + L                     
Sbjct: 275 TSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVG 334

Query: 156 PEDNTPLQSLSV------------------ASDGSMLVAANSKGNCYVWEMPNHTDASNL 197
           P D T  Q  +                     +  ++V A+     ++W+    T     
Sbjct: 335 PFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTT----- 389

Query: 198 KPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCA 257
           KP+ +   H   +  +  S D +H+ + S D + + W   D  K  +T  GH   V+  A
Sbjct: 390 KPIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDG-KFITTFRGHVASVYQVA 448

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 449 WSSDCRLLVSCSKDTTLKVWDIRTRKLSVDLPGH 482

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L ++  D TI+ W+    VC+ T+    S V+ ++      L   +  + VR++D++ + 
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNSG 307

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V   +      +    P+ P   K  A  N   +
Sbjct: 308 -RCINILKNHAHWVNHLSLSTDYALRVGPFD------YTGEQPATPEIAKAKALKNYEKV 360

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G+    +++   D  + +WD L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 361 AKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKL-VNHVAFSPDGRHIVSASF 419

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D+ + K +T F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 420 DNSIKLW------DSRDGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDIRTR 473

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 474 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W+ L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 370 LMVTASDDFTMFLWDPLRTTKPIARMTGHQ-KLVNHVAFSPDGRHIVSASFDNSIKLWDS 428

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   + TF GH  +V  +++  D R +V+ S+D T+KVWD+R+  +  +   H   V
Sbjct: 429 R--DGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDIRTRKLSVDLPGHKDEV 486

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 487 YTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 50/134 (37%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+     H N++  +  S D + +AT S D T 
Sbjct: 154 SRMVTGAGDNTARIWDCDTQT------PMATLTGHHNWVLCVSWSPDGELIATGSMDNTV 207

Query: 232 RTWSLDDNFKLESTLDGHQRWV----WD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W           L GH +W+    W+        +   L T+S D  +++WD + R  
Sbjct: 208 RLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVC 267

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 268 TMTLSGHTSSVSCV 281

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+   S+ +VT + D+  R+WD  T+  +    GHH   +CV+
Sbjct: 134 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVS 190

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 108/247 (43%), Gaps = 9/247 (3%)

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVN 120
           T N N  A+       + S+ F  D +++ T +ED  I++WD+ +  +    K H   + 
Sbjct: 393 TGNQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIY 452

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
            +   P+  +L+S   D  +RIWDL    C+  L+ ED     ++S   +G  + A +  
Sbjct: 453 SLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLD 511

Query: 181 GNCYVWEMPNHTDASNLKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLD-- 237
               VW+         L    +    H + +  ++ + D K + + S D++ + W+L+  
Sbjct: 512 RTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGL 571

Query: 238 ----DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
                + + E T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH  
Sbjct: 572 SGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 631

Query: 294 GAICVAL 300
             I V +
Sbjct: 632 SVISVTV 638

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 20/157 (12%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH--QNVRLYDI-- 60
           LVS   D T+R W+  TG CS T+   D  V  + ++  +    AAG   + VR++D   
Sbjct: 463 LVSGSGDRTVRIWDLTTGTCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTVRVWDSDT 521

Query: 61  -----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK- 114
                R  + N + T  GH+ +V S+ F +D + +V+ S D ++K+W++   S  +++  
Sbjct: 522 GFLVERLDSENELGT--GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAE 579

Query: 115 -------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                  H   V  V    N   ++S  +D  +  WD
Sbjct: 580 CEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 616

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 128/286 (44%), Gaps = 38/286 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLY------------------ 58
           AL  VC  T  +++  +  LE ++D +L  AAG Q+  ++L+                  
Sbjct: 469 ALPTVCMYTFHNTNRDMTSLEFSDDSRL-AAAGFQDSYIKLWSLDGSSLISNKIPSYKRK 527

Query: 59  DIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNA 117
           ++ TT+P   +T  GH G+V S SF  D+R++++ SED T+++W + + +   +YK HN 
Sbjct: 528 EMETTDPA-TSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNH 586

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSM 173
           PV +V   P      +   D   R+W      C H    ++     + + ++S   +G  
Sbjct: 587 PVWDVKFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDTVSFHPNGCY 641

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           +   +S   C +W      D S    V  F  H+  I   +++ D + L T S D     
Sbjct: 642 VFTGSSDKTCRMW------DISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINL 695

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W +    +++      +  V     + +   L++  +DH VR+WDL
Sbjct: 696 WDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 5/224 (2%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDI 60
           S  L+S   D T+R W   T     + +  +  V  ++ +        A H Q  RL+  
Sbjct: 555 SRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSC 614

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPV 119
              +  P+  F GH  +V ++SF  +  ++ T S D T ++WD+ +    R +  H AP+
Sbjct: 615 --DHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPI 672

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
              V+ P+   L +   DG I +WD+G  +   Q+       + SL++  +G++L++  +
Sbjct: 673 LSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGA 732

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLA 223
             +  VW++   T+   L+P   F  H   +T   ++ DVK   
Sbjct: 733 DHSVRVWDLKKATNEPGLEPEQPFIGHIGDVT-ASINQDVKDFG 775

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 57/146 (39%), Gaps = 14/146 (9%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFK-------------A 205
           N  + SL  + D  +  A        +W +   +  SN  P  K K              
Sbjct: 482 NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIG 541

Query: 206 HSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYL 265
           HS  +     S D + L + S DKT R WSLD +  L S   GH   VWD  FS    Y 
Sbjct: 542 HSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVS-YKGHNHPVWDVKFSPLGHYF 600

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGH 291
            TAS D   RLW       +R + GH
Sbjct: 601 ATASHDQTARLWSCDHIYPLRIFAGH 626

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 18/101 (17%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------------------STLDGHQR 251
           +T +  S D +  A    D   + WSLD +  +                   STL GH  
Sbjct: 485 MTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHSG 544

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
            V+  +FS DS +L++ S D  VRLW L T   +  Y GH+
Sbjct: 545 SVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHN 585

>Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa]
           {ON} YIL046W (MET30) - Met30p contains five copies of
           WD40 motif and interacts with and regulates Met4p
           [contig 11] FULL
          Length = 627

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 123/304 (40%), Gaps = 28/304 (9%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  TG   R +      V  +   + +KL+  +  + +R+++  T 
Sbjct: 329 LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF-DGQKLITGSLDRMIRVWNYVTG 387

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               VA + GH  +V  LS     + +V+ S D T+KVW V S +      H   V  V 
Sbjct: 388 AC--VAAYPGHSDSV--LSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVK 443

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +HP      S   D  IR+WD+  N C      H    +   PL  L   +  +   +  
Sbjct: 444 LHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLVTDRTSDP 503

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
            +      + P     S L     + +               HL +CS D T + W +  
Sbjct: 504 PRNEATTAQDPPDGQLSALDDSLPYPS---------------HLLSCSLDNTIKLWEVRT 548

Query: 239 NFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
             K   T  GH   +WD A  AD+  +V+ + D  V++WDL + + +  +  H     CV
Sbjct: 549 G-KCVRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCV 605

Query: 299 ALND 302
            + D
Sbjct: 606 GIGD 609

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 89/225 (39%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V SL F  + R + T S D T+ +WD+ +  + R    H   V    I+ 
Sbjct: 310 IQEFKGHMDGVLSLQF--NYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK--AIYF 365

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  IR+W+     C                        VAA         
Sbjct: 366 DGQKLITGSLDRMIRVWNYVTGAC------------------------VAA--------- 392

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
             P H+D+  +  V  +K       +I++S         SADKT + W ++   +   TL
Sbjct: 393 -YPGHSDS--VLSVDSYK-------KIIVSG--------SADKTVKVWHVES--RTCYTL 432

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ +   V+ + GH
Sbjct: 433 RGHTEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGH 477

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 7/98 (7%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL  +    ++L+++RT     V T  GH   +  ++   DN  +V+ + D T+KVWD++
Sbjct: 532 LLSCSLDNTIKLWEVRTGKC--VRTHFGHVEGIWDIA--ADNFRIVSGAHDKTVKVWDLQ 587

Query: 106 SPSVPRNY-KHNAPVNEVVIHPNQGELISCDRDGNIRI 142
           S      +  H AP+  V I     E +S D  G +++
Sbjct: 588 SGKCIHTFDSHQAPITCVGI--GDSEFVSGDELGCVKV 623

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-KLLGAAGHQNVRLYDIRTT 63
           L+S   D+TI+ WE  TG C RT  H        +I  D  +++  A  + V+++D+++ 
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRT--HFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSG 589

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKV 101
               + TF+ H+  +T +         V+  E G +KV
Sbjct: 590 --KCIHTFDSHQAPITCVGIGDSE--FVSGDELGCVKV 623

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 14/92 (15%)

Query: 222 LATCSADKTARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTAS 269
           +A+ +  +  R W +   + FK+ES             GH   V    F  +   L T S
Sbjct: 277 VASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKGHMDGVLSLQF--NYRLLFTGS 334

Query: 270 SDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            D  V +WDL+T ++VR+  GH  G   +  +
Sbjct: 335 YDSTVAIWDLATGKLVRRLTGHRDGVKAIYFD 366

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 137/336 (40%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++      N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
                A   GH   +TSLS++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 ECLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQL------------------- 154
              N V  V    QG L S   D  +R+WD+  + +C + L                   
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 ------------TPED-------NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
                       TPED       N         +   M+V A+     ++W     T   
Sbjct: 336 VGAFDHTGKRPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKST--- 392

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
             KPV +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V+ 
Sbjct: 393 --KPVARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L   +  + VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V + +         + PS P + +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTG------KRPSTPEDAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTMFLWNPLKSTKPVARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+   K H N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSDHYVRLWDLSTREI 284
           R W       L   L GH +W+   ++             L ++S D  +++WD  +R  
Sbjct: 211 RLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------STLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D+    ++    FK++      S + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT + D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 39/287 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTT------------- 63
           AL  VC  T  +++  +  L+ + D +L+ AAG Q+  ++L+ +  +             
Sbjct: 474 ALPSVCMYTFHNTNGGMTSLQFSEDSRLV-AAGFQDSYIKLWSLDGSSLKQIQEKSADSI 532

Query: 64  -----NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNA 117
                N N   T  GH G V S SF  DNR++++ SED T+++W   + +   +YK HN 
Sbjct: 533 NTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNH 592

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSM 173
           PV +V   P      +   D   R+W      C H    ++     + +  +S   +G  
Sbjct: 593 PVWDVQFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDCVSFHPNGCY 647

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           +   +S   C +W      D S    V  F  H+  +    +S D + LAT S D     
Sbjct: 648 VFTGSSDKTCRMW------DISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINL 701

Query: 234 WSLDDNFKLESTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
           W +    +L+  + GH +  +   ++  +   LV+  +DH VR+WDL
Sbjct: 702 WDIGTAKRLK-VMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 100/231 (43%), Gaps = 29/231 (12%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQG 129
           TF    G +TSL F +D+R +    +D  IK+W +   S+                  Q 
Sbjct: 482 TFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSL-----------------KQI 524

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMP 189
           +  S D   +I   D+ +N  T  +    +  + S S + D   L++ +      +W   
Sbjct: 525 QEKSAD---SINTGDMNDNTSTTLIG--HSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTD 579

Query: 190 NHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGH 249
            +T       +  +K H++ +  +  S    + AT S D+TAR WS D  + L     GH
Sbjct: 580 TYTS------LVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLR-IFAGH 632

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
              V   +F  +  Y+ T SSD   R+WD+ST + VR + GH    +C A+
Sbjct: 633 LSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 96/221 (43%), Gaps = 5/221 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  ++ +        A H Q  RL+     
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHI 623

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WD+ +    R +  H APV   
Sbjct: 624 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCT 681

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +    +       + SLS   +G++LV+  +  +
Sbjct: 682 AVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHS 741

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLA 223
             VW++   T     +P  +F  +   +T   ++ D+K   
Sbjct: 742 VRVWDLKKSTAEPGPEPEEQFVGYIGNLT-ASINQDIKDFG 781

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 127/287 (44%), Gaps = 38/287 (13%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLY------------------ 58
           AL  VC  T Q+++  ++ L+ ++D ++  AAG Q+  ++++                  
Sbjct: 451 ALPSVCMYTFQNTNKDMSCLDFSDDCRI-AAAGFQDSYIKIWSLDGSSLNNPNIMPNINN 509

Query: 59  -DIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HN 116
            D +  +     T  GH G V + SF  DN+++++ SED T+++W + + +   +YK HN
Sbjct: 510 SDHKDADDPTCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGS 172
            PV +V   P      +   D   R+W      C H    ++       +  +S   +G 
Sbjct: 570 HPVWDVNFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGC 624

Query: 173 MLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTAR 232
            +   +S   C +W      D S    V  F  H+  +  I +S D + L+T S D    
Sbjct: 625 YVFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIIN 678

Query: 233 TWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            W +    +L+      +  ++  ++S +   L++  +DH VR+WDL
Sbjct: 679 IWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  +  +        A H Q  RL+     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WDV +    R +  H APV  +
Sbjct: 602 YP--LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICI 659

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I IWD+G  +   Q+       + SLS + +G++L++  +  +
Sbjct: 660 AVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHS 719

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T   + +P   F  +   +T
Sbjct: 720 VRVWDLKKATTEPSAEPEEPFIGYLGDVT 748

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 7/135 (5%)

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           S + D   L++ +      +W M  HT       +  +K H++ +  +  S    + AT 
Sbjct: 534 SFSPDNKYLLSGSEDKTVRLWSMDTHT------ALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D+TAR WS D  + L     GH   V   +F  +  Y+ T SSD   R+WD+ST + V
Sbjct: 588 SHDQTARLWSCDHIYPLR-IFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSV 646

Query: 286 RQYGGHHKGAICVAL 300
           R + GH    IC+A+
Sbjct: 647 RLFLGHTAPVICIAV 661

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           TL GH   V+  +FS D+ YL++ S D  VRLW + T   +  Y GH+
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHN 569

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 128/273 (46%), Gaps = 30/273 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQD----NRWM 90
           V  L+I+  + L+  +  +++R+YD++      + T   H+G++T+L F ++    N+W+
Sbjct: 44  VKTLDISK-RYLVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITALKFSKNEASTNKWL 100

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           +++SED  I +W V+        K H   +N++ IHP+    IS   D +IR+W+L    
Sbjct: 101 LSASEDKKIIIWRVKDWENYGTLKGHTGRINDLDIHPSSRIAISVSEDHSIRLWNL---- 156

Query: 150 CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNH-----TDASNLKPVTKFK 204
               +T +    L+    + +G  +    S G+ +   + N      T  + +     FK
Sbjct: 157 ----MTVKKAAVLKLRGYSQNGQFVRWLGSSGDFFAVALLNKVLIYTTATAKVHSEIDFK 212

Query: 205 AHSNYITRILLSSDVKHLATCSADKTARTWSLD-------DNFKLESTLDGHQRWVWDCA 257
               ++ +++L ++ ++L    +D     +          ++FK E +L GH   V D  
Sbjct: 213 KTIMHMEKVVLDNEKEYLCIGLSDGNIEFYETGLLCKEGAEDFKPEFSLLGHTNRVKDFK 272

Query: 258 FSADS--AYLVTASSDHYVRLWDLSTREIVRQY 288
           F  +    YLV+  SD  + +WD+  +E +  Y
Sbjct: 273 FYQNEFGIYLVSIGSDGKIVVWDMKKQEQLAVY 305

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 133/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +LVSA  D T+  W+ LTG      V  R+ +  +  V    +T D    L A+  + +R
Sbjct: 31  LLVSASRDKTLISWK-LTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+++ T        F GHK +V S++  +    +++ S D TIKVW ++   +     HN
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDCLATLLGHN 147

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+ +      LIS   D  ++ W++ + Q        +N  + S++ + D
Sbjct: 148 DWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNY-INSITASPD 206

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           GS++ +A   G+  +W +   T      P+    A        L  S  ++  T +    
Sbjct: 207 GSLVASAGKDGDIMLWNLKQKT------PLYTLSAQDEVFA--LAFSPNRYWLTAATATG 258

Query: 231 ARTWSLDDNF---KLESTLDGHQRWVWDCA----FSADSAYLVTASSDHYVRLWDLST 281
            + +SL+D     +L+    G+ +     A    +SAD   L    +D  +R+W + T
Sbjct: 259 IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRVWQVMT 316

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 109/228 (47%), Gaps = 24/228 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  +V++S D T+  W    D +   VP R++K HN  V 
Sbjct: 10  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQ 68

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+W++   +   + T    + + S+++    SM+++ +  
Sbjct: 69  DCALTADGAYALSASWDKTLRLWNVATGETYQRFTGH-KSDVMSVAIDRKASMIISGSRD 127

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
               VW +     A+ L        H+++++++ ++ + K       L +  +DK  + W
Sbjct: 128 KTIKVWSIKGDCLATLL-------GHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAW 180

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E+   GH  ++     S D + + +A  D  + LW+L  +
Sbjct: 181 NIN-QFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQK 227

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHL-ATCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  + +   +  GH   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCA 71

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 71/193 (36%), Gaps = 51/193 (26%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           V L+SAG D  ++ W                 +N+ +I  D                   
Sbjct: 166 VTLISAGSDKMVKAW----------------NINQFQIEAD------------------- 190

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
                   F GH   + S++   D   + ++ +DG I +W+++  +          V  +
Sbjct: 191 --------FVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFAL 242

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED---NTPLQ----SLSVASDGSMLV 175
              PN+  L +    G I+++ L +     +L PE    N   +    SL+ ++DG  L 
Sbjct: 243 AFSPNRYWLTAATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLF 301

Query: 176 AANSKGNCYVWEM 188
           A  +     VW++
Sbjct: 302 AGYTDSIIRVWQV 314

>KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.231
           YIL046W
          Length = 591

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 126/293 (43%), Gaps = 36/293 (12%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L +  YD T+  W+    +  R +      V  L   +DKKL+  +  + +++++  T  
Sbjct: 265 LFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYF-DDKKLITGSLDKTIKIWNYVTGQ 323

Query: 65  PNPVATFEGHKGNVTSL-SFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
              ++T+ GH  +V S+ +F+   + +V+ S D T+KVW + S +      H   VN V 
Sbjct: 324 C--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKVWHIESRTCYTLKGHTEWVNCVK 378

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVA-A 177
           +HP      SC  D  IR+WD+  N C      H    +   PL  + + +  S +    
Sbjct: 379 LHPKSFTCFSCSDDTTIRMWDIRTNTCIKVFKGHVGQVQKVIPLTIIDIENLVSDISNDE 438

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
           +S  N    E+    D S   P                     HL +CS D T + W++ 
Sbjct: 439 DSDENNEDDELNQPLDDSIPYPT--------------------HLLSCSLDNTIKLWNVK 478

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
              K   T  GH   VWD A  AD+  +++ S D  +++WDL   + +  + G
Sbjct: 479 TG-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGCLKVWDLQNGQCLHTFQG 528

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 107/264 (40%), Gaps = 51/264 (19%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV-VIHP 126
           +  F+GH   V SL F    +++ T S D T+ +WD+ +  + R  + N   + V  ++ 
Sbjct: 245 IIDFKGHLDGVLSLQFNY--KYLFTGSYDSTVAIWDLYNNILIR--RLNGHTDGVKALYF 300

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +LI+   D  I+IW+    QC        ++    +SV +   ++V+ ++     VW
Sbjct: 301 DDKKLITGSLDKTIKIWNYVTGQCISTYRGHTDS---VMSVDAFKKIIVSGSADKTVKVW 357

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
            + + T           K H+ ++  + L        +CS D T R W +  N  ++   
Sbjct: 358 HIESRT-------CYTLKGHTEWVNCVKLHPKSFTCFSCSDDTTIRMWDIRTNTCIK-VF 409

Query: 247 DGH---------------QRWVWDCAFSADS--------------------AYLVTASSD 271
            GH               +  V D +   DS                     +L++ S D
Sbjct: 410 KGHVGQVQKVIPLTIIDIENLVSDISNDEDSDENNEDDELNQPLDDSIPYPTHLLSCSLD 469

Query: 272 HYVRLWDLSTREIVRQYGGHHKGA 295
           + ++LW++ T + +R   GH +G 
Sbjct: 470 NTIKLWNVKTGKCIRTQFGHVEGV 493

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 76/188 (40%), Gaps = 42/188 (22%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLGAAGHQNVRLYDIRT 62
           I+VS   D T++ W   +  C     H++  VN +++          +    +R++DIRT
Sbjct: 344 IIVSGSADKTVKVWHIESRTCYTLKGHTE-WVNCVKLHPKSFTCFSCSDDTTIRMWDIRT 402

Query: 63  TNPNPVATFEGHKGN---------------VTSLSFQQDN-------------------- 87
                +  F+GH G                V+ +S  +D+                    
Sbjct: 403 N--TCIKVFKGHVGQVQKVIPLTIIDIENLVSDISNDEDSDENNEDDELNQPLDDSIPYP 460

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
             +++ S D TIK+W+V++    R  + H   V ++    +   +IS   DG +++WDL 
Sbjct: 461 THLLSCSLDNTIKLWNVKTGKCIRTQFGHVEGVWDIA--ADNFRIISGSHDGCLKVWDLQ 518

Query: 147 ENQCTHQL 154
             QC H  
Sbjct: 519 NGQCLHTF 526

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
             GH   V    F+    YL T S D  V +WDL    ++R+  GH  G   +  +D
Sbjct: 248 FKGHLDGVLSLQFNY--KYLFTGSYDSTVAIWDLYNNILIRRLNGHTDGVKALYFDD 302

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 136/301 (45%), Gaps = 38/301 (12%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +LVSA  D T+  W+ LTG      V  R+ +     V  + +T D    L A+  + +R
Sbjct: 32  LLVSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHKG+V S++  +    +++ S D +IKVW ++   +     HN
Sbjct: 91  LWDVATGET--YQRFVGHKGDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + P + E      +IS   D  ++ W+L + Q         N  + +++ + D
Sbjct: 149 DWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNLNQFQIEADFVGH-NANVNTITASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A+  G   +W + N T      P+    A  + +  +  S +   LA  +A   
Sbjct: 208 GTLIASADKSGEIMLWNLHNKT------PMYTLNAQ-DEVFAVAFSPNRYWLAAATASGI 260

Query: 231 ARTWSLD-----DNFKLE-----STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
            + +SLD     D+ + E        D H       A+SAD   L    +D+ +R+W + 
Sbjct: 261 -KIFSLDPEALIDDLRPEFVGYNKAADPHAI---SLAWSADGQTLFAGYTDNVIRVWQVM 316

Query: 281 T 281
           T
Sbjct: 317 T 317

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 106/225 (47%), Gaps = 24/225 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  +V++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +V + P+    +S   D  +R+WD+   + T+Q        + S+++    SM+++ +  
Sbjct: 70  DVTLTPDGAYALSASWDKTLRLWDVATGE-TYQRFVGHKGDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS------SDVKHLATCSADKTARTW 234
            +  VW +     A+ L        H+++++++ ++       D   + +   DK  + W
Sbjct: 129 KSIKVWTIKGQCLATLL-------GHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +L+  F++E+   GH   V     S D   + +A     + LW+L
Sbjct: 182 NLN-QFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWNL 225

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHL-ATCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  F +   +  GH   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            + D AY ++AS D  +RLWD++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAID 116

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 125/282 (44%), Gaps = 44/282 (15%)

Query: 23  VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLY-------DIRTTNPNPV------A 69
           VC  T  +++  +  +E ++D +L  AAG Q+  +         +++  P+        A
Sbjct: 489 VCMYTFHNTNGNMTCVEFSDDARLT-AAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSA 547

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQ 128
           T  GH G V S++F  DNR+++++SED T+++W + + +    YK HN PV  V   P  
Sbjct: 548 TLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLG 607

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS----------VASDGSMLVAAN 178
              I+   D   R+W      C H        PL+  S             +G  +   +
Sbjct: 608 HYFITASHDQTARLW-----SCDHIY------PLRIFSGHLNDVDCSTFHPNGCYVFTGS 656

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
           S   C +W      D      V  F  H++ +T + +S D + L T S D T   W +  
Sbjct: 657 SDKTCRMW------DIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 239 NFKLESTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
             +++  + GH +  ++   F+ +   LVT  +D  VR+WD+
Sbjct: 711 GKRIKQ-MKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 110/260 (42%), Gaps = 27/260 (10%)

Query: 54  NVRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS------ 106
           +++L +++T+ P+  + TF    GN+T + F  D R      +D TIKVW +        
Sbjct: 476 SIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSI 535

Query: 107 -PSVPRNYK-------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
            PS  ++         H+ PV  V   P+   L+S   D  +R+W L    C        
Sbjct: 536 LPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCL-VCYKGH 594

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSD 218
           N P+  +  +  G   + A+      +W         ++ P+  F  H N +       +
Sbjct: 595 NHPVWYVKFSPLGHYFITASHDQTARLWS------CDHIYPLRIFSGHLNDVDCSTFHPN 648

Query: 219 VKHLATCSADKTARTWSLD--DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
             ++ T S+DKT R W +   D+ +L     GH   V     S D  +L T S D  + +
Sbjct: 649 GCYVFTGSSDKTCRMWDIQTGDSVRL---FLGHTSPVTALEVSPDGRWLTTGSEDGTIIV 705

Query: 277 WDLSTREIVRQYGGHHKGAI 296
           WD+ T + ++Q  GH K  I
Sbjct: 706 WDIGTGKRIKQMKGHGKNPI 725

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 103/221 (46%), Gaps = 5/221 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+SA  D T+R W   T  C    +  +  V  ++ +        A H Q  RL+     
Sbjct: 568 LLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSC--D 625

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
           +  P+  F GH  +V   +F  +  ++ T S D T ++WD+++    R +  H +PV  +
Sbjct: 626 HIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTAL 685

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +   Q+      P+ S++   +G+ LV   +  +
Sbjct: 686 EVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQS 745

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLA 223
             VW++   T+   ++P  +F  +S  +  + +++D+K   
Sbjct: 746 VRVWDIKRFTNEPGMEPEQQFNTYSGDM-ELSVNNDIKEFG 785

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 58/150 (38%), Gaps = 16/150 (10%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKA-----------HS 207
           N  +  +  + D  +  A        VW    + D S L+ +   KA           HS
Sbjct: 498 NGNMTCVEFSDDARLTAAGFQDSTIKVW----YLDGSPLQSILPSKAKDQSNSATLVGHS 553

Query: 208 NYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVT 267
             +  +  S D ++L + S DKT R WSLD  F       GH   VW   FS    Y +T
Sbjct: 554 GPVYSVAFSPDNRYLLSASEDKTVRLWSLD-TFTCLVCYKGHNHPVWYVKFSPLGHYFIT 612

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKGAIC 297
           AS D   RLW       +R + GH     C
Sbjct: 613 ASHDQTARLWSCDHIYPLRIFSGHLNDVDC 642

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 141/336 (41%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +++   D+T R W+  T     T++   + V  +  + D +L+      N +RL++    
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQ--------QDNRWMVTSSEDGTIKVWDV-RSPSVPRNYK 114
            P   A   GH   +TSLS++        Q  R + ++S+DGTIK+WD  R   +     
Sbjct: 219 QPVGDA-LRGHGKWITSLSWEPIHLVKPGQKPR-LASASKDGTIKIWDTTRRVCLITLSG 276

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCTHQL------------------- 154
           H + V+  +    QG L S   D  IR WD+    +C + L                   
Sbjct: 277 HTSSVS-CIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 -------TPEDNTPLQSLSVASDG------------SMLVAANSKGNCYVWEMPNHTDAS 195
                  + + +TP ++   A                ++V A+     Y+W     T   
Sbjct: 336 IGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKST--- 392

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
             KP+T+   H   +  +  S D +H+ + S D + + W+  D  K  ST  GH   V+ 
Sbjct: 393 --KPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDG-KFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ T+++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGH 485

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 116/278 (41%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    S V+ ++      L   +  + +R +D+    
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    + + +  + K      PS P   +  A  N   I
Sbjct: 311 -KCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEK------PSTPEEAQKRALKNYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               GE    +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 AKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKL-VNHVAFSPDGRHIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      +  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------NGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTK 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 97/239 (40%), Gaps = 22/239 (9%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRLYDIR 61
           +L S  +D TIR W+  L G C   ++     VN L ++ D  L +GA  H + +     
Sbjct: 291 VLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPE 350

Query: 62  TTNPNPVATFE---GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP--RNYKHN 116
                 +  +E      G V  L        MVT+S+D T+ +W+    + P  R   H 
Sbjct: 351 EAQKRALKNYEKIAKRNGEVEEL--------MVTASDDFTMYLWNPLKSTKPITRMTGHQ 402

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVA 176
             VN V   P+   ++S   D +I++W+  + +          +  Q ++ +SD  +LV+
Sbjct: 403 KLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQ-VAWSSDCRLLVS 461

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWS 235
            +      VW      D    K       H + +  +  S D K + +   DK  R W+
Sbjct: 462 CSKDTTLKVW------DVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 7/113 (6%)

Query: 193 DASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRW 252
           D +   P++  K H N++  +  S D + +AT S D T R W  +    +   L GH +W
Sbjct: 172 DCNTQTPMSTLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKW 231

Query: 253 VWDCAFS-------ADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           +   ++             L +AS D  +++WD + R  +    GH     C+
Sbjct: 232 ITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCI 284

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+   S+ ++T + D+  R+WD +T+  +    GH    +CV+
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVS 193

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 104/235 (44%), Gaps = 13/235 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    + H   +  +   P+  +L+S   
Sbjct: 430 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSG 489

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 490 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PEDGKYIAAGSLDRAVRVWDSETGFLVER 548

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLDD--NFKL--------EST 245
           L    +    H + +  ++ + D  ++ + S D++ + W+L+D  N  L        E T
Sbjct: 549 LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVT 608

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             GH+ +V   A +    Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 609 YTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 663

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 69/160 (43%), Gaps = 22/160 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D  T 
Sbjct: 484 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETG 543

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR-------SPSV 109
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++         P+V
Sbjct: 544 FLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNV 601

Query: 110 PRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
           P   +     H   V  V        ++S  +D  +  WD
Sbjct: 602 PGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWD 641

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++I+    GH +
Sbjct: 429 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQ 470

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 104/238 (43%), Gaps = 16/238 (6%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD++   +    + H+  V  +   P+  +L+S   
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 446 DRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKL------------- 242
           L    +    H + +  ++ + D   + + S D++ + W+L DN                
Sbjct: 505 LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATC 564

Query: 243 ESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           + T  GH+ +V     +A+  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 565 DVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 622

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 440 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETG 499

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
               R  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++R
Sbjct: 500 FLVERLDSENELGT--GHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLR 546

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQ 426

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 117/270 (43%), Gaps = 46/270 (17%)

Query: 30  HSDSQVNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSFQ-- 84
           H+D  +N ++ T D   +  A   N  +   Y+ RTT     A F+GH  +VTS+     
Sbjct: 404 HTD-LLNAVDATEDGLWIATASKDNSAILWRYNPRTTLFCKYAHFQGHVSSVTSVGLPNV 462

Query: 85  QDNRW---MVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIR 141
            +  W   ++T+S D T+K W V  P+                          DR  +I 
Sbjct: 463 MNKGWPEYLITASNDLTVKKWKVPKPT--------------------------DR-FDIE 495

Query: 142 IWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVT 201
           I+ +  ++ T +   +D   +  LS++ + S+   A+    C +W++    +   LK   
Sbjct: 496 IYSISSSEYTRRAHEKD---INMLSISPNDSIFATASYDKTCKIWDL----ETGELKAT- 547

Query: 202 KFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSAD 261
               H   +  +      K +AT S DKT + WSLD  F +  TL+GH   V  C+F   
Sbjct: 548 -LNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLD-TFTVVKTLEGHSNAVQRCSFFNK 605

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
              LV+  +D  V+LWD ST E +    GH
Sbjct: 606 QKQLVSTGADGLVKLWDCSTGECINTLDGH 635

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 106/226 (46%), Gaps = 22/226 (9%)

Query: 5   LVSAGYDHTIRFWEA----------LTGVCSR--TIQHSDSQVNRLEIT-NDKKLLGAAG 51
           L++A  D T++ W+           +  + S   T +  +  +N L I+ ND     A+ 
Sbjct: 471 LITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIFATASY 530

Query: 52  HQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR 111
            +  +++D+ T      AT   HK  +  +SF Q ++++ T+S D T+K+W + + +V +
Sbjct: 531 DKTCKIWDLETGELK--ATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVK 588

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             + H+  V        Q +L+S   DG +++WD    +C + L   DN  + +L+V  D
Sbjct: 589 TLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNR-IWALNVIKD 647

Query: 171 GSMLVAANSKGNCYVW----EMPNHTDASNLK-PVTKFKAHSNYIT 211
           G +++ A++ G    W    E     D    K  V + +   NYI+
Sbjct: 648 GDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYIS 693

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITN-DKKLLGAAGHQNVRLYDIRT 62
           I  +A YD T + W+  TG    T+ +    +  +     DK +  A+G + V+++ + T
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
                V T EGH   V   SF    + +V++  DG +K+WD  +         H+  +  
Sbjct: 584 F--TVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWA 641

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +   +I+ D DG  + W
Sbjct: 642 LNVIKDGDIVITADADGVFQFW 663

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 96/231 (41%), Gaps = 34/231 (14%)

Query: 96  DGTIKVWDVR-SPSVPRNY---------KHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
           D T+++ D++ + S P+ Y          H    +  V+ PN  +L        +RI  +
Sbjct: 326 DQTLQLVDLKDTFSNPKEYIEVVSSLAGNHGTIADMKVVGPNFDKLALATNSSTLRIIPI 385

Query: 146 GENQCTHQLTP-----EDNTPLQSLSVASDGSMLVAANSKGNCYV-WEMPNHTDASNLKP 199
            +   ++ ++      E +T L +   A++  + +A  SK N  + W     T  +    
Sbjct: 386 SDVDDSNSVSISTELYEGHTDLLNAVDATEDGLWIATASKDNSAILWRYNPRT--TLFCK 443

Query: 200 VTKFKAHSNYITRILLSSDV-----KHLATCSADKTARTWSL---DDNFKLE-------- 243
              F+ H + +T + L + +     ++L T S D T + W +    D F +E        
Sbjct: 444 YAHFQGHVSSVTSVGLPNVMNKGWPEYLITASNDLTVKKWKVPKPTDRFDIEIYSISSSE 503

Query: 244 STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            T   H++ +   + S + +   TAS D   ++WDL T E+      H +G
Sbjct: 504 YTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRG 554

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/231 (18%), Positives = 93/231 (40%), Gaps = 29/231 (12%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T+L+   D +++   S+   +K++ + +  + ++ K ++P   +   P    L     D
Sbjct: 76  ITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISSPSYVLETDPTSTLLAIGGTD 135

Query: 138 GNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGS----MLVAANSKGNCYVWEMPNHTD 193
           G++ + D+     TH L     T + SL    +      +L + ++ G   +W++ +   
Sbjct: 136 GSVTVIDIENGYITHSLKGHGAT-ISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSR-- 192

Query: 194 ASNLKPVTKFKAHSNYITRILL-------SSDVKHLATCSADKTARTWSLDD-----NFK 241
               K +   + H++ +  I         S D   L T + D     W   D       K
Sbjct: 193 ----KAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFKDVTNLKRCK 248

Query: 242 LESTLDGHQRWVWDCAFSADSAYLV-----TASSDHYVRLWDLSTREIVRQ 287
           L  T+  HQ+ +  C F  +   +      T+  D  +++  L+   IV++
Sbjct: 249 LLKTIPVHQQ-IEACGFIINIDGIDDDLIYTSGGDAVLQIVSLNNNSIVKK 298

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/325 (23%), Positives = 133/325 (40%), Gaps = 36/325 (11%)

Query: 11  DHTIRFWEALTGVCSRTIQHS---DSQVNRLEITNDKKLLGAAGHQNVRLY--------- 58
           D+ + F  AL       + HS    S V  ++ +ND + L    ++  ++Y         
Sbjct: 304 DYYVVFNPALPLELDVELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIA 363

Query: 59  ---DIRTTNPNPVATFEGHKGN----VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR 111
              D   T+P+  +   G   +    + S+ F  D  ++ T +ED  I++WD++   +  
Sbjct: 364 KLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVM 423

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             K H   V  +   PN  +L+S   D  +RIWDL   QC+  L+ E      ++S  +D
Sbjct: 424 VLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVS-PND 482

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKF-KAHSNYITRILLSSDVKHLATCSADK 229
           G  + A +      VW+         L    +    H + +  ++ + D   + + S DK
Sbjct: 483 GKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDK 542

Query: 230 TARTWSL--------DDNFK------LESTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
           T + W++        + N K       E T  GH+ +V     S D  Y+++ S D  + 
Sbjct: 543 TVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGIL 602

Query: 276 LWDLSTREIVRQYGGHHKGAICVAL 300
            WD  +   +    GH    I VA+
Sbjct: 603 FWDKESGNPLLMLQGHRNSVISVAV 627

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+             ND K + A    + VR++D    
Sbjct: 444 LVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
               R  + N + T  GH+ +V S+ F +D   +V+ S D T+K+W++R
Sbjct: 504 FLVERLDSENELGT--GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMR 550

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 59/124 (47%), Gaps = 22/124 (17%)

Query: 5   LVSAG-YDHTIRFWEALTGVCSRTIQ--------HSDSQVNRLEITNDKKLLGAAGHQNV 55
            ++AG  D  +R W++ TG     +         H DS  + +   +  +++  +  + V
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTV 544

Query: 56  RLYDIR-TTNPNPVA------------TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           +L+++R + N N  +            T+ GHK  V S++  QD++++++ S+D  I  W
Sbjct: 545 KLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFW 604

Query: 103 DVRS 106
           D  S
Sbjct: 605 DKES 608

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 106/247 (42%), Gaps = 26/247 (10%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV-----PRNYKHNAPV 119
           P  V  +EGH+  + SL   +D  W+ T+S+D T  VW     S       +   H+A V
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAV 437

Query: 120 NEV----VIHPNQGE-LISCDRDGNIRIW---------DLGENQCTHQLTPEDNTPLQSL 165
             V    ++     E L++   D  I+ W         D+   + +          + +L
Sbjct: 438 TAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINAL 497

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           SV+ + S+   A+    C +W + N    + L        H   +  +      K LAT 
Sbjct: 498 SVSPNDSIFATASYDKTCKIWNLENGELEATLA------NHKRGLWDVSFCQYDKLLATS 551

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S DKT + WSLD  F +  TL+GH   V  C+F      L++  +D  +++WD S+ E +
Sbjct: 552 SGDKTVKIWSLD-TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECL 610

Query: 286 RQYGGHH 292
           +   GH+
Sbjct: 611 KTLDGHN 617

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 15/196 (7%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQ---------HS-DSQVNRLEIT-NDKKLLGAAGH 52
            L++A  D TI+ W       S  +Q         H+ +  +N L ++ ND     A+  
Sbjct: 453 FLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYD 512

Query: 53  QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN 112
           +  +++++   N    AT   HK  +  +SF Q ++ + TSS D T+K+W + + SV + 
Sbjct: 513 KTCKIWNLE--NGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKT 570

Query: 113 YK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDG 171
            + H   V        Q +LISC  DG I+IWD    +C   L   +N  L +LS  +DG
Sbjct: 571 LEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNR-LWALSTMNDG 629

Query: 172 SMLVAANSKGNCYVWE 187
            M+V+A++ G    W+
Sbjct: 630 DMIVSADADGVFQFWK 645

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 101/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF-----QQD 86
           +N L+ T D   +  A   N  +   Y+  +   +  A + GH   VT++       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGY 450

Query: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W +  P+   + +           H   +N + + PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 510

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D   +IW+L EN             L  +S      +L  ++      +W +   +   
Sbjct: 511 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
            L+       H+N + R    +  K L +C AD   + W       L+ TLDGH   +W 
Sbjct: 570 TLE------GHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLK-TLDGHNNRLWA 622

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
            +   D   +V+A +D   + W
Sbjct: 623 LSTMNDGDMIVSADADGVFQFW 644

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/307 (20%), Positives = 118/307 (38%), Gaps = 35/307 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEIT----NDK---KLLGAAGHQNVR 56
           +L S   +  ++ W+ +   C  T+Q   S V  L+I     ND+    LL       + 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIIN 221

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQD---NRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           L+D        +         V S  F +D    R + T+  D   ++ D  S SV +  
Sbjct: 222 LWDFNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLK-- 279

Query: 114 KHNAPVNEVVIHP-----NQGELISCDRDGNIRIWDLGEN--------QCTHQLTPEDNT 160
           + N P+ E+ I       +  ++     D  +++ ++ E+        Q T  +      
Sbjct: 280 RTNKPIEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGI 339

Query: 161 PLQSLSVASDGSMLVAANSKGNCYVWEMPNHT--DASNLKPVTKFKAHSNYITRILLSSD 218
                 V  + + L  A +  +  +  +P+ +  +AS    V  ++ H + +  +  + D
Sbjct: 340 IADMRYVGPELNKLALATNSPSLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATED 399

Query: 219 VKHLATCSADKTARTWSLDDN---FKLESTLDGHQRWVWDCAF-----SADSAYLVTASS 270
              +AT S D TA  W  ++N   F + +   GH   V               +L+TAS+
Sbjct: 400 GLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASN 459

Query: 271 DHYVRLW 277
           D  ++ W
Sbjct: 460 DLTIKKW 466

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 84/184 (45%), Gaps = 13/184 (7%)

Query: 70  TFEGHKGNVTSLSF--QQDNR-WMVTSSE-DGTIKVWD-VRSPSVPRNYKHNAPVN--EV 122
           +F+GH G ++SL F  Q +++ W++ S + +G +KVWD V+   +    +H + V   ++
Sbjct: 139 SFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

Query: 123 VIHPNQGE----LISCDRDGNIRIWDLGENQCTHQLTPED-NTPLQSLSVASDGSMLVAA 177
           +  P+  E    L+S  RD  I +WD    +    L     N  ++S     DG      
Sbjct: 199 IEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVNQQVESCGFLKDGDGKRII 258

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
            + G   ++++ +    S LK   K      +I  +L       +    +D+T +  +++
Sbjct: 259 YTAGGDAIFQLIDSESGSVLKRTNK-PIEELFIIGVLPILSNSQMFLVLSDQTLQLINVE 317

Query: 238 DNFK 241
           ++ K
Sbjct: 318 EDLK 321

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 58/147 (39%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL    DG  +  A+      VW    + ++       K+  HS  +T + L + V  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAIVWRY--NENSCKFDIYAKYIGHSAAVTAVGLPNIVSK 448

Query: 220 ---KHLATCSADKTARTW-------SLDDNFKL--ESTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W       S+D       E T   H++ +   + S + +   T
Sbjct: 449 GYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 508

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W+L   E+      H +G
Sbjct: 509 ASYDKTCKIWNLENGELEATLANHKRG 535

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 90  MVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGE----LISCDRDGNIRIWD 144
           +     DG+I V D+ +  +  ++K H   ++ +  +         L S D +G +++WD
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWD 176

Query: 145 LGENQCTHQL 154
           L + +C H L
Sbjct: 177 LVKRKCLHTL 186

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 107/247 (43%), Gaps = 26/247 (10%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW----DVRSPSVPRNYKHNAPVN 120
           P  V  +EGH+  + SL   +D  W+ T+S+D +  VW    D     +   Y  ++   
Sbjct: 379 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAV 438

Query: 121 EVVIHPN---QGE---LISCDRDGNIRIWDLGENQCTHQLTP---------EDNTPLQSL 165
             V  PN   +G    L++   D  I+ W + +   T+ +                + +L
Sbjct: 439 TAVGLPNVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINAL 498

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           SV+ + S+   A+    C +W + N    + L        H   +  +      K LATC
Sbjct: 499 SVSPNDSIFATASYDKTCKIWNLENGELEATLA------NHKRGLWDVSFCQYDKLLATC 552

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S DKT + WSL+  F +  TL+GH   V  C+F      LV+  +D  +++WD  + E +
Sbjct: 553 SGDKTVKIWSLE-TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECL 611

Query: 286 RQYGGHH 292
           +   GH+
Sbjct: 612 KTLDGHN 618

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 92/196 (46%), Gaps = 15/196 (7%)

Query: 4   ILVSAGYDHTIRFWE----------ALTGVCSRTIQHSDSQVNRLEIT-NDKKLLGAAGH 52
            L++A  D TI+ W+           +  V   T    +  +N L ++ ND     A+  
Sbjct: 454 FLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYD 513

Query: 53  QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN 112
           +  +++++   N    AT   HK  +  +SF Q ++ + T S D T+K+W + + SV + 
Sbjct: 514 KTCKIWNLE--NGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKT 571

Query: 113 YK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDG 171
            + H   V        Q +L+SC  DG I+IWD    +C   L   +N  L +L+  +DG
Sbjct: 572 LEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNR-LWALNTMNDG 630

Query: 172 SMLVAANSKGNCYVWE 187
             +V+A++ G    W+
Sbjct: 631 DTIVSADADGIFQFWK 646

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 100/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF-----QQD 86
           +N L+ T D   +  A   N  +   Y+  T+  +  A + GH   VT++       +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 451

Query: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W +  P+   + +           H   +N + + PN     +  
Sbjct: 452 PEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 511

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D   +IW+L EN             L  +S      +L   +      +W +   +   
Sbjct: 512 YDKTCKIWNL-ENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMK 570

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
            L+       H+N + R    +  K L +C AD   + W       L+ TLDGH   +W 
Sbjct: 571 TLE------GHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLK-TLDGHNNRLWA 623

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 624 LNTMNDGDTIVSADADGIFQFW 645

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL    DG  +  A+   +  VW+  N  D S      K+  HS+ +T + L + +  
Sbjct: 392 LNSLDATEDGLWIATASKDNSAIVWKYNN--DTSKFDIYAKYIGHSSAVTAVGLPNVMPK 449

Query: 220 ---KHLATCSADKTARTWSL-----DDNFKL----ESTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W +      ++ ++    E T   H++ +   + S + +   T
Sbjct: 450 GYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 509

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W+L   E+      H +G
Sbjct: 510 ASYDKTCKIWNLENGELEATLANHKRG 536

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 60/143 (41%), Gaps = 18/143 (12%)

Query: 25  SRTIQHS-----DSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTTNPNPVATFEGHKGNV 78
           SR I H      + ++  L++T D + L      Q ++++ ++T            K + 
Sbjct: 49  SRKILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGK-----VVRSMKISS 103

Query: 79  TSLSFQQDNR--WMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGE----L 131
            S     D+    +     DG+I V D+ +  +  + K H   ++ +  +         L
Sbjct: 104 PSYILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLL 163

Query: 132 ISCDRDGNIRIWDLGENQCTHQL 154
            S D +G +++WDL + +C H L
Sbjct: 164 ASGDTNGMVKVWDLVKRKCLHTL 186

>TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON}
           Anc_7.231 YIL046W
          Length = 574

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 123/300 (41%), Gaps = 41/300 (13%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  +G   R +      +  L   ++ KL+  +  + +R++D +  
Sbjct: 252 LLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIKTLYF-DENKLITGSLDKTIRVWDYK-- 308

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T++GH  ++ S+   +  + +V+ S D ++KVW +   +      H   VN V 
Sbjct: 309 GGRCISTYKGHSDSILSVDCYK--KLIVSGSADCSVKVWHIERRTCYTLKGHTEWVNCVK 366

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQC----------THQLTPEDNTPLQSLSVASDGSM 173
           +HP      S   D  IR+WDL  N+C            ++ P     ++ L V  +   
Sbjct: 367 LHPTSFSCFSASDDCTIRMWDLRSNKCLKVFKGHVGQVQKVIPLSIKDIEGLVVDDEVQS 426

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
             +A S  +       +  D S   P                     HL +CS D T + 
Sbjct: 427 SASAQSTAD---EPCDDPLDTSIPYPT--------------------HLLSCSLDNTIKL 463

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           W +    K   T  GH   VWD A  AD+  +V+ S D  V++WDL +      + G  +
Sbjct: 464 WDVYTG-KCVRTQFGHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQSGRCTNSFQGTQR 520

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 104/265 (39%), Gaps = 52/265 (19%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ S  + R    H+  +    ++ 
Sbjct: 233 IREFKGHMDGVLTLQF--NYRLLFTGSYDSTIAIWDLYSGKLIRRLNGHSDGIK--TLYF 288

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           ++ +LI+   D  IR+WD    +C        ++    LSV     ++V+ ++  +  VW
Sbjct: 289 DENKLITGSLDKTIRVWDYKGGRCISTYKGHSDSI---LSVDCYKKLIVSGSADCSVKVW 345

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
            +   T           K H+ ++  + L        + S D T R W L  N K     
Sbjct: 346 HIERRT-------CYTLKGHTEWVNCVKLHPTSFSCFSASDDCTIRMWDLRSN-KCLKVF 397

Query: 247 DGHQRWVW----------------DCAFSADSA--------------------YLVTASS 270
            GH   V                 D   S+ SA                    +L++ S 
Sbjct: 398 KGHVGQVQKVIPLSIKDIEGLVVDDEVQSSASAQSTADEPCDDPLDTSIPYPTHLLSCSL 457

Query: 271 DHYVRLWDLSTREIVRQYGGHHKGA 295
           D+ ++LWD+ T + VR   GH +G 
Sbjct: 458 DNTIKLWDVYTGKCVRTQFGHVEGV 482

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
           LL  +    ++L+D+ T     V T  GH   V  ++   DN  +V+ S DG +KVWD++
Sbjct: 452 LLSCSLDNTIKLWDVYTGKC--VRTQFGHVEGVWDIA--ADNFRIVSGSHDGCVKVWDLQ 507

Query: 106 SPSVPRNYKHNAPVNE 121
           S     +++    V E
Sbjct: 508 SGRCTNSFQGTQRVEE 523

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 121/274 (44%), Gaps = 45/274 (16%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSFQQ--DNRW 89
           +N L+ T D   +  A   N  +   ++         A F GH  +VTS+S     +N W
Sbjct: 333 LNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGW 392

Query: 90  ---MVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG 146
              ++TSS D T+K W V SP+                          D D ++ +  + 
Sbjct: 393 PEFIITSSNDFTVKKWKVPSPTK-----------------------KSDNDDDMHLIKVS 429

Query: 147 ENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAH 206
           E   T +   +D   + +LS+A + S+   A+    C +W++    D+  L  +     H
Sbjct: 430 E--YTRRAHEKD---INALSIAPNDSIFATASYDKTCKIWDL----DSGEL--MATLANH 478

Query: 207 SNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLV 266
              +  +      K++AT S DKT + WSL+  FK+ +TL+GH   V  C+F      +V
Sbjct: 479 KRGLWDVSFCQYDKYIATASGDKTIKIWSLE-TFKVVNTLEGHTNAVQRCSFINKQKQIV 537

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG--AICV 298
           +  +D  +++WD S+ E ++   GH     A+CV
Sbjct: 538 STGADGLIKIWDCSSGECLKTLDGHANRIWALCV 571

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (44%), Gaps = 8/157 (5%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITN-DKKLLGAAGHQNVRLYDIRT 62
           I  +A YD T + W+  +G    T+ +    +  +     DK +  A+G + ++++ + T
Sbjct: 451 IFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLET 510

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
                V T EGH   V   SF    + +V++  DG IK+WD  S    +    H   +  
Sbjct: 511 F--KVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWA 568

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
           + +  +   +I+ D DG  + W      CT ++  +D
Sbjct: 569 LCVLRDGDMIITADADGVFQFW----KDCTEEVKEQD 601

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 70  TFEGHKGNVTSLSF---QQDNRWMVTSSEDGTIKVWDV 104
           + +GH   ++SL F    +D+ W++ S +   +KVWD+
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDL 121

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 105/254 (41%), Gaps = 33/254 (12%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +      H   +  +   P+  +++S   
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC   L+ ED   + +++V+ DG  + A +      VW+         
Sbjct: 429 DRTVRIWDLNTGQCLLTLSIEDG--VTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVER 486

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL-------DDNFKL------- 242
           L        H + +  ++ + D K++ + S DKT + W+L       +D  K+       
Sbjct: 487 LDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSNDASKINQNSNSH 546

Query: 243 ----------------ESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
                           E T  GH+ +V   A + D   +++ S D  V  WD  +   + 
Sbjct: 547 LDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLL 606

Query: 287 QYGGHHKGAICVAL 300
              GH    I VA+
Sbjct: 607 MLQGHRNSVISVAV 620

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 60/115 (52%), Gaps = 10/115 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRT- 62
           +VS   D T+R W+  TG C  T+   D  V  + ++ D K + A    + VR++D  T 
Sbjct: 423 IVSGSGDRTVRIWDLNTGQCLLTLSIEDG-VTTVAVSPDGKFIAAGSLDRAVRVWDAETG 481

Query: 63  -----TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN 112
                 + N + T  GH+ +V S+ F +D + +V+ S D T+K+W+++  +   N
Sbjct: 482 FLVERLDSNELGT--GHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSN 534

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D+  R W +    K+   L+GH++ ++   +      +V+ 
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLK-KIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL+T
Sbjct: 427 SGDRTVRIWDLNT 439

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQ 409

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 123/291 (42%), Gaps = 44/291 (15%)

Query: 44  KKLLGAAGHQNVRLYDIRTTN-----------PNPVATFEGHKGNVTSLSFQQDNRWMVT 92
           K L  A     +RL  +  TN           P  V  +EGH+  + ++   +D  W+ T
Sbjct: 315 KHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYEGHEDLLNAIDSTEDGLWIAT 374

Query: 93  SSEDGTIKVWDV-----RSPSVPRNYKHNAPVNEVVIHPN------QGELISCDRDGNIR 141
           +S+D +  VW       +     R   H++ V  V + PN         L++   D  I+
Sbjct: 375 ASKDHSAIVWKYNTIKQKFTQYARFSGHSSSVTAVGL-PNVMPKSYPEYLLTASNDLTIK 433

Query: 142 IWDL-----GENQCT-HQLTPEDNT------PLQSLSVASDGSMLVAANSKGNCYVWEMP 189
            W +     G+ +   H +   + T       + +LS++ + S+   A+    C +W++ 
Sbjct: 434 KWKIPKPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLE 493

Query: 190 NHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGH 249
                   + V     H   +  +      K +ATCS DKT + WSLD  F +  TL+GH
Sbjct: 494 TG------ESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLD-TFSVIKTLEGH 546

Query: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG--AICV 298
              V  C+F      LV+  +D  +++WD+S  E +    GH+    A+CV
Sbjct: 547 TNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCV 597

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 45/184 (24%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           I  +A YD T + W+  TG                                         
Sbjct: 477 IFATASYDKTCKIWDLETG----------------------------------------- 495

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEV 122
               VAT   HK  +  +SF Q ++ + T S D TIK+W + + SV +  + H   V + 
Sbjct: 496 --ESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKC 553

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
                Q +L+S   DG I+IWD+   +C   L   +N  + +L V +DG ++V+A++ G 
Sbjct: 554 SFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNR-IWALCVQNDGDLIVSADADGV 612

Query: 183 CYVW 186
              W
Sbjct: 613 FQFW 616

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 86/234 (36%), Gaps = 27/234 (11%)

Query: 69  ATFEGHKGNVTSLSF-----QQDNRWMVTSSEDGTIKVWDVRSPSVP------------- 110
           A F GH  +VT++       +    +++T+S D TIK W +  PS               
Sbjct: 397 ARFSGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEVEFHDVKISE 456

Query: 111 -RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS 169
                H   +N + I PN     +   D   +IWDL   +    L+      L  +S   
Sbjct: 457 YTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRG-LWDVSFCQ 515

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
              ++   +      +W +           +   + H+N + +    +    L +  AD 
Sbjct: 516 FDKIIATCSGDKTIKIWSL------DTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADG 569

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             + W +  N +  STLDGH   +W      D   +V+A +D   + W   T E
Sbjct: 570 LIKIWDIS-NGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDE 622

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (42%), Gaps = 22/177 (12%)

Query: 27  TIQHSDSQ-VNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQ 85
           TI ++D Q +  L++T D K L       +    ++  N +     +  K  V+S S+  
Sbjct: 23  TISNNDEQEITALKVTPDGKYLIFVSQAQL----LKIVNVSTGKIIKSMK--VSSPSYII 76

Query: 86  D----NRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVV----IHPNQGELISCDR 136
           D    +  +     DG++ V D+ +  +  + K H   ++ +     ++ N   L S D 
Sbjct: 77  DCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDT 136

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVA-----SDGSMLVAANSKGNCYVWEM 188
           +G ++IWDL + +C H +  E  +P++ + +      +D   LV          WE 
Sbjct: 137 NGMVKIWDLVKRKCIHTVQ-EHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEF 192

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 105/235 (44%), Gaps = 13/235 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    + H   +  +   P+  +L+S   
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 525 DRTVRIWDLRNGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 583

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSL--DDNFKL--------EST 245
           L    +    H + +  ++ + D  ++ + S D++ + W+L  D+N  +        E T
Sbjct: 584 LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVT 643

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 644 YTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 698

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 22/160 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+   G CS T+   D          D K + A    + VR++D  T 
Sbjct: 519 LVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 578

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-------PSV 109
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++R        P+V
Sbjct: 579 FLVERLDSENELGT--GHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNV 636

Query: 110 PRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
           P   +     H   V  V    N   ++S  +D  +  WD
Sbjct: 637 PGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 676

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%)

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           +A+ TA   S + N    ST      ++    FS D  +L T + D  +R+WD++ ++IV
Sbjct: 438 AANGTADGTSGETNSFATSTSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIV 497

Query: 286 RQYGGHHK 293
               GH +
Sbjct: 498 MVLQGHEQ 505

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 139/336 (41%), Gaps = 58/336 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++      N +RL+D ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
                A   GH   +TSLS++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 QCLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT------------------ 155
              N V  V    QG L S   D  +R+WD+  + +C + L                   
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 156 --------PEDNTPLQSLSVASDG------------SMLVAANSKGNCYVWEMPNHTDAS 195
                    + +TP ++   A +              M+V A+     ++W     T   
Sbjct: 336 IGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKST--- 392

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
             KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V+ 
Sbjct: 393 --KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQ 449

Query: 256 CAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 118/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L   +  + VR++DI +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    + + +    K      PS P   +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKK------PSTPEEAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D+T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDYTMFLWNPLKSTKPIARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+   K H N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHYNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSDHYVRLWDLSTREI 284
           R W       L   L GH +W+   ++             L ++S D  +++WD  +R  
Sbjct: 211 RLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------STLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D+    ++    FK++      S + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT + D+  R+WD  T+  +    GH+   +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVS 193

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 143/337 (42%), Gaps = 60/337 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +L+      N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSVPRNYKH 115
            P   A   GH+  +TSLS++        +   + TSS+DGTIKVWD  R   +   Y  
Sbjct: 219 KPFGEA-MRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCL---YTL 274

Query: 116 NAPVNEV--VIHPNQGELISCDRDGNIRIWDLG-ENQCTHQLT----------------- 155
           +  VN V  V    +  L S   D  +R+WD+    +C + L                  
Sbjct: 275 SGHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYAL 334

Query: 156 ---PEDNT------PLQSLSVA------------SDGSMLVAANSKGNCYVWEMPNHTDA 194
              P D+T      P ++ + A            SD  ++V A+     ++W     T  
Sbjct: 335 RVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKST-- 392

Query: 195 SNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVW 254
              KP+++   H   +  +  S D +++ + S D + + W   D  K  +T  GH   V+
Sbjct: 393 ---KPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDSRDG-KFITTFRGHVASVY 448

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
             A+S+D   L + S D  +++WD+ T+++     GH
Sbjct: 449 QVAWSSDCRLLASCSKDTSLKVWDIRTKKLSVDLPGH 485

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 104/278 (37%), Gaps = 59/278 (21%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRLYDIR 61
           +L S  +D T+R W+  L G C   ++     VN L ++ D  L +G   H  +      
Sbjct: 291 LLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPE 350

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP--RNYKHNAPV 119
                 +  +E       +     D   MVT+S+D T+ +W+    + P  R   H   V
Sbjct: 351 EARAKALKNYEK-----VAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLV 405

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
           N V   P                                           DG  +V+A+ 
Sbjct: 406 NHVAFSP-------------------------------------------DGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D+ + K +T F+ H   + ++  SSD + LA+CS D + + W +   
Sbjct: 423 DNSIKLW------DSRDGKFITTFRGHVASVYQVAWSSDCRLLASCSKDTSLKVWDIRTK 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH   V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 54/134 (40%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+     H+N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMVTLSGHTNWVLCVAWSPDGELIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWV----WD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W   +       + GHQ+W+    W+      + +   L T+S D  +++WD   R  
Sbjct: 211 RLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 LYTLSGHVNSVSCV 284

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + + GH   +   +F+   S+ +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 137 AAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVA 193

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 127/292 (43%), Gaps = 44/292 (15%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVA------- 69
           AL  VC  T  +++  +  L+ + D +L  A G Q+  ++L+ +  ++            
Sbjct: 506 ALPSVCLYTFHNTNRDMTSLDFSEDSRL-AAGGFQDSYIKLWSLDGSSLKKYGDVSSSPS 564

Query: 70  ----------------TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
                           T  GH G V S SF  DN+++++ SED T+++W + + +   +Y
Sbjct: 565 PSATTADKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSY 624

Query: 114 K-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVA 168
           K HN PV +V   P      +   D   R+W      C H    ++     + +  +S  
Sbjct: 625 KGHNHPVWDVKFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLSDVDCVSFH 679

Query: 169 SDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSAD 228
            +G  +   +S   C +W      D S    V  F  H+  +    +S D + L+T S D
Sbjct: 680 PNGCYVFTGSSDKTCRMW------DVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSED 733

Query: 229 KTARTWSLDDNFKLESTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
                W +    +L+  + GH +  ++  ++S +   LV++ +DH VR+WDL
Sbjct: 734 GIINVWDIGTGKRLK-LMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRTT 63
           L+S   D T+R W   T     + +  +  V  ++ +        A H Q  RL+     
Sbjct: 601 LISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHI 660

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNEV 122
            P  +  F GH  +V  +SF  +  ++ T S D T ++WDV +    R +  H APV   
Sbjct: 661 YP--LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIST 718

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P+   L +   DG I +WD+G  +    +       + SLS + +G++LV++ +  +
Sbjct: 719 AVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHS 778

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
             VW++   T   + +P   F  +   +T
Sbjct: 779 VRVWDLKKATAEPSAEPEEPFVGYLGDVT 807

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 111/265 (41%), Gaps = 30/265 (11%)

Query: 37  RLEITNDKKLLGAAGHQNVRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSE 95
           +LEI   K+       +++RL +++   P+  + TF     ++TSL F +D+R      +
Sbjct: 485 KLEIQKVKE-----SRESIRLNNLQAALPSVCLYTFHNTNRDMTSLDFSEDSRLAAGGFQ 539

Query: 96  DGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155
           D  IK+W +   S+    K+    +         +  S D      I   G         
Sbjct: 540 DSYIKLWSLDGSSL---KKYGDVSSSPSPSATTADKYSKDFTNTTLIGHSGA-------- 588

Query: 156 PEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILL 215
                 + S S + D   L++ +      +W +  +T       +  +K H++ +  +  
Sbjct: 589 ------VYSTSFSPDNKYLISGSEDKTVRLWSLDTNTT------LVSYKGHNHPVWDVKF 636

Query: 216 SSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275
           S    + AT S D+TAR WS D  + L     GH   V   +F  +  Y+ T SSD   R
Sbjct: 637 SPLGHYFATASHDQTARLWSCDHIYPLR-IFAGHLSDVDCVSFHPNGCYVFTGSSDKTCR 695

Query: 276 LWDLSTREIVRQYGGHHKGAICVAL 300
           +WD+ST + VR + GH    I  A+
Sbjct: 696 MWDVSTGDSVRLFLGHTAPVISTAV 720

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 115/252 (45%), Gaps = 23/252 (9%)

Query: 65  PNPVATFE--GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
           PN + T E  GH+ +V S+    DN+ + T+S +GT+K+W++++ +  R ++    +   
Sbjct: 373 PNKLYTIELQGHRTDVRSIDISDDNKLLATAS-NGTLKIWNIKTHACIRTFECGYALTCK 431

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P    ++  +R G+++++DL  +             + SL + SDG  LV  ++   
Sbjct: 432 FL-PGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKT 490

Query: 183 CYVWE-------MPNHTDASNLKPVTKFKAH-------SNYITRILLSSDVKHLATCSAD 228
              W+       +P   D    K V K K         ++ I  + +SSD K LA    D
Sbjct: 491 VKFWDFKVDQELIPGTVD----KFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLD 546

Query: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
            T + + L+ + K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +  
Sbjct: 547 NTVKVFFLN-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHKSL 605

Query: 289 GGHHKGAICVAL 300
             H    + V  
Sbjct: 606 FAHQDSIMSVKF 617

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 124/298 (41%), Gaps = 29/298 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + T++ W   T  C RT +   +   +        ++G  G  +++L+D+ ++ 
Sbjct: 399 LLATASNGTLKIWNIKTHACIRTFECGYALTCKFLPGGALVVVGNRGG-DLQLFDLASST 457

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR--SPSVPRNYKHNAPVNEV 122
                  + H   + SL    D + +VT S D T+K WD +     +P       P  ++
Sbjct: 458 LLENKE-DAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKI 516

Query: 123 VIHPNQGEL--------ISCDR--------DGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
             H    EL        IS D         D  ++++ L   +    L      P+ S+ 
Sbjct: 517 -FHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGH-KLPVLSID 574

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  +L+ +++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 575 ISFDSKLLITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFVPESHNFFSCS 628

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
            D   + W   D F+    L  HQ  VW  A S D+ ++V+ S DH +R+W+ +  E+
Sbjct: 629 KDGLVKYWD-GDKFECVQKLAAHQSEVWALAISNDARFVVSTSHDHSIRVWEETEDEV 685

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 123/292 (42%), Gaps = 28/292 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q   + V  ++I++D KLL  A +  +++++I+T     + TFE   G   +  F    
Sbjct: 381 LQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKT--HACIRTFEC--GYALTCKFLPGG 436

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             +V  +  G ++++D+ S ++  N +  H A +  + +  +   L++   D  ++ WD 
Sbjct: 437 ALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDGKRLVTGSADKTVKFWDF 496

Query: 146 GENQ---------------CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
             +Q                 H  T E N  + ++ ++SD   L  +       V+ +  
Sbjct: 497 KVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKFLAVSLLDNTVKVFFL-- 554

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
               +++K       H   +  I +S D K L T SADK  + W LD       +L  HQ
Sbjct: 555 ----NSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG-DCHKSLFAHQ 609

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
             +    F  +S    + S D  V+ WD    E V++   H      +A+++
Sbjct: 610 DSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAISN 661

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 47  LGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD- 103
           L A G+ +  ++++D+   +   +  F GHK  +T L F      +++ S+D  I +WD 
Sbjct: 89  LLAVGYADGVIKIWDL--ISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146

Query: 104 VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH 152
           V    + +   H   +  +    N+  LIS  +DG I+IWDL   QC  
Sbjct: 147 VGEVGLYKLRSHKDSITGIWCE-NEDWLISTSKDGLIKIWDLKTQQCVE 194

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 17/115 (14%)

Query: 48  GAAGH------QNVRLYDIRTTNPNPVATFEGHKGNV----------TSLSFQQDNRWMV 91
           G+AG       +NV  +DI+T   + + T     G V          T L +  +   + 
Sbjct: 32  GSAGQILTGALENVNCWDIKTGELSKILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLA 91

Query: 92  TSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
               DG IK+WD+ S +V  N+  H + +  +   P    LIS  +D +I IWDL
Sbjct: 92  VGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 60/142 (42%), Gaps = 47/142 (33%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L+S   D  I  W+                           L+G  G     LY +R+  
Sbjct: 132 LISGSKDSDIIIWD---------------------------LVGEVG-----LYKLRS-- 157

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVV 123
                    HK ++T +  + ++ W++++S+DG IK+WD+++   V  +  H +    + 
Sbjct: 158 ---------HKDSITGIWCENED-WLISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLA 207

Query: 124 IHPNQGELISCDRDGNIRIWDL 145
           IH +   +I+   +  I+IW+L
Sbjct: 208 IHNDL--VITTSTESQIKIWNL 227

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 133/297 (44%), Gaps = 22/297 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T      ++   + V  +  + D +L+      N +RL++ +  
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
            P   A  +GH   +TSL+++        D   + ++S+DGTIK+WD    +       +
Sbjct: 219 KPWGDA-MKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGH 277

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSLSVASDGSMLV 175
                 V    QG L +   D  IR+WD+    +C + L    +  +  LS+++D ++ V
Sbjct: 278 TNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINILKSHAHW-VNHLSLSTDYAIRV 336

Query: 176 AANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL-ATCSADKTARTW 234
                        P+  +A ++       A  NY   +  S  V+ L  T S D T   W
Sbjct: 337 GPFGPDGK---ASPSPQEARDI-------AKKNYEKVVRKSGQVEELMVTASDDFTMFLW 386

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +   + K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 387 NPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGH 443

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 119/279 (42%), Gaps = 22/279 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+A    C  T+    + V+ ++      L   +  + +R++DI+   
Sbjct: 251 LASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTS-SEDGTIKVWDVRSPSVPRNYKHNAPVN--E 121
              +   + H   V  LS   D    V     DG        SPS P+  +  A  N  +
Sbjct: 311 -KCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKA------SPS-PQEARDIAKKNYEK 362

Query: 122 VVIHPNQGE--LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           VV    Q E  +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+
Sbjct: 363 VVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKL-VNHVAFSPDGRYIVSAS 421

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
              +  +W      D  + K +  F+ H   + ++  SSD + L +CS D T + W +  
Sbjct: 422 FDNSIKLW------DGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

Query: 239 NFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 476 R-KLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 55/134 (41%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P++  K HSN++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCATQT------PLSVLKGHSNWVLCVAWSPDGELIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWV----WD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W           + GH +W+    W+      + D   L +AS D  +++WD S R  
Sbjct: 211 RLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 LYTLSGHTNSVSCV 284

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGV--CSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L      +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSAKPLARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   +ATF GH  +V  +++  D R +V+ S+D T+KVWDV++  +  +   H   V
Sbjct: 432 R--DGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSAD-SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + + GH   +   AF+ D S+ +VT + D+  R+WD +T+  +    GH    +CVA
Sbjct: 137 AAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVA 193

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 127/290 (43%), Gaps = 40/290 (13%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           L +AG+ D  I+ W +L G         +S+  +++ +  +  L  AG  N ++ +   +
Sbjct: 489 LAAAGFKDSYIKVW-SLDGTTL------ESKATKIQPSKSQAAL-RAGLDN-KINEKTRS 539

Query: 64  NPNPVATFE--GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVN 120
              P+ T +  GH G + S SF  DN+ +V++SED TI++W + + +    YK HN PV 
Sbjct: 540 QETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVW 599

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS----------VASD 170
           +V   P      +   D   R+W      C H        PL+  S             +
Sbjct: 600 DVQFSPVGHYFATASHDQTARLW-----SCDHIF------PLRIFSGHISDVDCVTFHPN 648

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G  +   +S   C +W      D +  + V  F  H+  I  + ++ D   LAT S D  
Sbjct: 649 GCYIFTGSSDKTCRMW------DITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGV 702

Query: 231 ARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
              W +     L+  +   +  V   +++ +S  LV+  SD+ VR+WDL+
Sbjct: 703 IHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 109/255 (42%), Gaps = 30/255 (11%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           V LYD++T  P+  + TF      + SLS+  D R      +D  IKVW +   ++    
Sbjct: 454 VPLYDLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESK- 512

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH-QLTPEDNTPL-------QSL 165
                     I P++ +  +  R G     D   N+ T  Q TP     L        S 
Sbjct: 513 -------ATKIQPSKSQ--AALRAG----LDNKINEKTRSQETPITTVKLVGHSGAIYST 559

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           S + D  +LV+A+      +W M   T       +  +K H++ +  +  S    + AT 
Sbjct: 560 SFSPDNKLLVSASEDKTIRLWSMDTRTT------LVTYKGHNHPVWDVQFSPVGHYFATA 613

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D+TAR WS D  F L     GH   V    F  +  Y+ T SSD   R+WD++T E V
Sbjct: 614 SHDQTARLWSCDHIFPLR-IFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESV 672

Query: 286 RQYGGHHKGAICVAL 300
           R + GH    + VA+
Sbjct: 673 RLFIGHTAPILSVAV 687

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 88/187 (47%), Gaps = 4/187 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRT 62
           +LVSA  D TIR W   T     T +  +  V  ++ +        A H Q  RL+    
Sbjct: 567 LLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWS--C 624

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNE 121
            +  P+  F GH  +V  ++F  +  ++ T S D T ++WD+ +    R +  H AP+  
Sbjct: 625 DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILS 684

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG 181
           V + P+   L +   DG I IWD+G  +   +L     + + SLS   + ++LV+  S  
Sbjct: 685 VAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDN 744

Query: 182 NCYVWEM 188
           +  +W++
Sbjct: 745 SVRIWDL 751

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 102/236 (43%), Gaps = 14/236 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    + H   +  +   P+  +L+S   
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+         
Sbjct: 438 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKFIAAGSLDRAVRVWDSETGFLVER 496

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSL--DDN---------FKLES 244
           L    +    H + +  ++ + D   + + S D++ + W+L  D N            E 
Sbjct: 497 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEV 556

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 557 TYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAV 612

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D  T 
Sbjct: 432 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETG 491

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++R
Sbjct: 492 FLVERLDSENELGT--GHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQ 418

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 104/237 (43%), Gaps = 15/237 (6%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    + H   +  +   P+  +L+S   
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S+  DG  + A +      VW+         
Sbjct: 499 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLG-DGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSL---DDNFKLES-------- 244
           L    +    H + +  ++ + D   + + S D++ + W+L    +N   E+        
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCE 617

Query: 245 -TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 618 VTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAV 674

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D  T 
Sbjct: 493 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETG 552

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS 106
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++ S
Sbjct: 553 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSS 600

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D+  R W +    K+   L GH++ ++   +      LV+ 
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQK-KIVMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL T
Sbjct: 497 SGDRTVRIWDLRT 509

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD++ ++IV    GH +
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 479

>NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231
          Length = 767

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 128/305 (41%), Gaps = 35/305 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD TI  W+  +    R +      V  L   +D+KL+  +  + +R+++ +T 
Sbjct: 374 LLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVKTLHF-DDQKLVTGSLDKTIRVWNYKTG 432

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++T+ GH  ++  +S     + +V+ S D TIKVW V S +      H   VN V 
Sbjct: 433 QC--ISTYRGHTDSI--MSVDSYKKIIVSGSADKTIKVWHVESRTCYTLRGHTEWVNCVK 488

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSV----------- 167
           +HP      S   D  IR+WD+  N C      H    +   PL  + V           
Sbjct: 489 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGHVGQVQKVIPLTIIDVENLVTDSEDIT 548

Query: 168 ASDGSMLVAANSKGNCYVWEMPNHTDA--SNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           ASD  + +  ++  N       ++ +    NL           Y T         HL +C
Sbjct: 549 ASDDDVAMTNDTTTNEPTTNNNDNANGVDENLPQTQTLDESIPYPT---------HLLSC 599

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D T + W +    K   T  GH   VWD A  AD+  +++ S D  +++WDL + + +
Sbjct: 600 SLDNTIKLWDVKTG-KCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCM 656

Query: 286 RQYGG 290
             + G
Sbjct: 657 HTFHG 661

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  F+GH   V +L F  + R + T S D TI +WD+ S  + R    H   V    +H 
Sbjct: 355 IQEFKGHLDGVLTLQF--NYRLLFTGSYDSTIAIWDLCSNKLIRRLSGHTDGVK--TLHF 410

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +  +L++   D  IR+W+    QC                                    
Sbjct: 411 DDQKLVTGSLDKTIRVWNYKTGQC------------------------------------ 434

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                        ++ ++ H++ I  +   S  K + + SADKT + W ++   +   TL
Sbjct: 435 -------------ISTYRGHTDSIMSV--DSYKKIIVSGSADKTIKVWHVES--RTCYTL 477

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 478 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKIFKGH 522

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 14/84 (16%)

Query: 231 ARTWSL--DDNFKLEST----------LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            R W +   + FK+ES             GH   V    F  +   L T S D  + +WD
Sbjct: 331 TRPWKVIYRERFKVESNWRKGICQIQEFKGHLDGVLTLQF--NYRLLFTGSYDSTIAIWD 388

Query: 279 LSTREIVRQYGGHHKGAICVALND 302
           L + +++R+  GH  G   +  +D
Sbjct: 389 LCSNKLIRRLSGHTDGVKTLHFDD 412

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 135/307 (43%), Gaps = 34/307 (11%)

Query: 26  RTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI-------RTTNPNPVATFEGHKGN- 77
           ++++H+ S V  ++ +ND + L    ++  +++ +       R ++ N  +   G  G+ 
Sbjct: 310 KSLEHT-SVVCCVKFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSD 368

Query: 78  -------VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQG 129
                  + S+ F  D +++ T +ED  I++WD+    +    + H+  V  +   P+  
Sbjct: 369 SGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGD 428

Query: 130 ELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMP 189
           +L+S   D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+  
Sbjct: 429 KLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSE 487

Query: 190 NHTDASNLKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLD---------DN 239
                  L    +    H + +  ++ + D   + + S D++ + W+L          DN
Sbjct: 488 TGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADN 547

Query: 240 FKLES------TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
            K +S      T  GH+ +V     +A+  ++++ S D  V  WD +T   +    GH  
Sbjct: 548 NKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRN 607

Query: 294 GAICVAL 300
             I VA+
Sbjct: 608 SVISVAV 614

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 489

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
               R  + N + T  GH+ +V S+ F +D   +V+SS D ++K+W++R      N K N
Sbjct: 490 FLVERLDSENELGT--GHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRG----YNEKEN 543

Query: 117 APVN 120
           A  N
Sbjct: 544 AADN 547

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 109/240 (45%), Gaps = 22/240 (9%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE-----MPNH 191
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+     +   
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-NFKLES------ 244
            D+ N         H + +  ++ + D + + + S D++ + W+L + N K +S      
Sbjct: 565 LDSEN----ESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 245 ----TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
               T  GH+ +V   A + +  Y+++ S D  V  WD ++   +    GH    I VA+
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAV 680

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D+  R W ++ N K+   L GH++ ++   +      LV+ 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIE-NRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL T
Sbjct: 504 SGDRTVRIWDLRT 516

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 88/205 (42%), Gaps = 30/205 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 559

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-- 114
               R  + N   T  GHK +V S+ F +D + +V+ S D ++K+W++++ +   + K  
Sbjct: 560 FLVERLDSENESGT--GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTP 617

Query: 115 -----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ 163
                      H   V  V    N   ++S  +D  +  WD         L    N+ + 
Sbjct: 618 NSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVI- 676

Query: 164 SLSVASDGSML-----VAANSKGNC 183
           S++VA +GS L     V A   G+C
Sbjct: 677 SVAVA-NGSPLGPEYNVFATGSGDC 700

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 100/221 (45%), Gaps = 21/221 (9%)

Query: 77  NVTSLSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSVPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D V + S    Y+H   ++ V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLVHNKSFTFEYEHRKNISCVALNP 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
               L+S D DG   + +       H L  ++   ++ L  + DG +   A  +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHLNFKEK--VRDLKFSPDGKLFALACGR-FVQVW 122

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILL---SSDVKHLATCSADKTARTWSLDDNFK-L 242
           + P   +     P  +++ H+ + + I+    S D + L + S D TAR WSLD   K L
Sbjct: 123 KTPEVAEDRQFAPFVRYRVHAGHFSDIISLTWSQDSRFLVSTSKDLTARIWSLDSEEKDL 182

Query: 243 ES-TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
            S T  GH+ +V    FS+D   + T S D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEYTIR 223

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 94/210 (44%), Gaps = 14/210 (6%)

Query: 78  VTSLSFQQDNRWM-VTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVVIHPNQGELISCD 135
           V ++S      W+   SS+ G + V++ +S S + +   H    N V   P+   +++  
Sbjct: 301 VNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTAS 360

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            DG I+IWD+    C      E  + +  L+ A  G +L +A+  G    W++  + +  
Sbjct: 361 EDGKIKIWDVVSGFCLVTFQ-EHTSAVTGLAFAKKGQVLFSASLDGTVRAWDLVRYRNFR 419

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATC--SADKTA-RTWSLDDNFKLESTLDGHQRW 252
                 + + +        L++D      C  S D  A   WS+    +L  TLDGH+  
Sbjct: 420 TFTAAERIQFNC-------LAADPSGEVVCAGSVDSFAIHVWSVQTG-QLVETLDGHEGP 471

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           V   +FS +++ L +AS D  +R+W +  R
Sbjct: 472 VSCLSFSRENSVLASASWDKTIRVWSIFGR 501

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 94/235 (40%), Gaps = 8/235 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L+    +   R +E       + +    + VN + + N  + L     +  +L      
Sbjct: 270 MLIVGFNNGEFRLYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKLGQLLVYEWQ 329

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEV 122
           + + +   +GH     ++++  D   +VT+SEDG IK+WDV S      ++ H + V  +
Sbjct: 330 SESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGL 389

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG- 181
                   L S   DG +R WDL   +     T  +      L+    G ++ A +    
Sbjct: 390 AFAKKGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSF 449

Query: 182 NCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
             +VW +         + V     H   ++ +  S +   LA+ S DKT R WS+
Sbjct: 450 AIHVWSVQTG------QLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSI 498

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 93/235 (39%), Gaps = 33/235 (14%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD--VR--------------SPSV---- 109
           TF GH+  V    F  D   + T S+DG +  W+  +R               PS+    
Sbjct: 186 TFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQWEYTIRPGYEALGEEPETEIDPSLYSWR 245

Query: 110 --PRNYKH--NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSL 165
              +NY +   A V  V  H     LI    +G  R+++L       QL+   N  + ++
Sbjct: 246 ITKKNYFYASQARVKCVTFHAKSNMLIVGFNNGEFRLYELPGFTLLQQLSMGQNA-VNAV 304

Query: 166 SVASDGSMLVAANSK-GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLAT 224
           SV + G  L   +SK G   V+E  + +       + K + H +    +  S D   + T
Sbjct: 305 SVNNTGEWLAFGSSKLGQLLVYEWQSES------YILKQQGHFDATNAVTYSPDGSRVVT 358

Query: 225 CSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            S D   + W +   F L  T   H   V   AF+     L +AS D  VR WDL
Sbjct: 359 ASEDGKIKIWDVVSGFCL-VTFQEHTSAVTGLAFAKKGQVLFSASLDGTVRAWDL 412

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 72/149 (48%), Gaps = 4/149 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L      +++ A    +  ++    
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAIHVWSV 456

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV--RSPSVPRNYKHNAPVN 120
                V T +GH+G V+ LSF ++N  + ++S D TI+VW +  RS  V    +  A V 
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSIFGRSQQV-EPLEVYADVL 515

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQ 149
            + + P+  E+ +   DG +  +D+ E +
Sbjct: 516 SIAVRPDGNEVAASTLDGQVLFFDINEGK 544

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 118/301 (39%), Gaps = 76/301 (25%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN--------------------VRLY 58
           +L  VC  T  +++  ++ LE ++D +L  A G Q+                     +  
Sbjct: 466 SLPSVCMYTFHNTNKDMSCLEFSDDCRL-AATGFQDSFIKIWSLDGSSLVTNKLPSYKKE 524

Query: 59  DIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNA 117
           +I TT     +   GH G V S SF  DN+++++ SED T+++W + + +   +YK HN 
Sbjct: 525 EILTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNH 584

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAA 177
           PV +V   P      +   D   R+W      C H                         
Sbjct: 585 PVWDVKFSPMGHYFATASHDQTARLW-----SCDH------------------------- 614

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW--S 235
                              + P+  F  H N +  +    +  ++ T SADKT R W  S
Sbjct: 615 -------------------IYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDIS 655

Query: 236 LDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295
             D+ +L     GH   V   A + D  +L T   D  + +WD+ T + ++Q  GH K A
Sbjct: 656 TGDSVRL---FLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNA 712

Query: 296 I 296
           I
Sbjct: 713 I 713

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 106/247 (42%), Gaps = 30/247 (12%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           +RL +I+T+ P+  + TF     +++ L F  D R   T  +D  IK+W +   S+  N 
Sbjct: 458 IRLDNIQTSLPSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNK 517

Query: 114 KHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSM 173
             +    E+        L + D   ++ I   G               + S S + D   
Sbjct: 518 LPSYKKEEI--------LTTGDETSSLLIGHSGA--------------VYSTSFSPDNKF 555

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           L++ +      +W M  HT       +  +K H++ +  +  S    + AT S D+TAR 
Sbjct: 556 LLSGSEDKTVRLWSMDTHTT------LVSYKGHNHPVWDVKFSPMGHYFATASHDQTARL 609

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           WS D  + L     GH   V   +F  +  Y+ T S+D   R+WD+ST + VR + GH  
Sbjct: 610 WSCDHIYPLR-IFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTA 668

Query: 294 GAICVAL 300
             +  A+
Sbjct: 669 PVLTTAV 675

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 93/210 (44%), Gaps = 4/210 (1%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRLYDIRT 62
            L+S   D T+R W   T     + +  +  V  ++ +        A H Q  RL+    
Sbjct: 555 FLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWS--C 612

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KHNAPVNE 121
            +  P+  F GH  +V ++SF  +  ++ T S D T ++WD+ +    R +  H APV  
Sbjct: 613 DHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLT 672

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG 181
             + P+   L +   DG I +WD+G  +   Q+       + S S   +G++L++  +  
Sbjct: 673 TAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADH 732

Query: 182 NCYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
           +  VW++   T   + +P   F  +   +T
Sbjct: 733 SVRVWDLKKATPEPSAEPEQPFAGYVGDVT 762

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 113/254 (44%), Gaps = 35/254 (13%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-----VPRNYKHNAPV 119
           P  + T+EGH   + SL+  +D +W+ T+S+D T  +W   S +       +   H++ V
Sbjct: 412 PINMETYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSV 471

Query: 120 NEVVIHPN---QGE---LISCDRDGNIRIW----------DLGENQCTHQLTPEDNT--- 160
             V + PN   +G    LI+   D  I+ W          D      TH +   + T   
Sbjct: 472 TAVGL-PNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHA 530

Query: 161 ---PLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
               + S+S++ + S++   +   +C +W +    D+  L  V     H   I  +    
Sbjct: 531 HDKDINSISISPNDSLIATGSYDKSCKLWNL----DSGEL--VATLNNHKRGIWDVSFCQ 584

Query: 218 DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             K +ATCS DKT + WSLD  F +  T  GH   V  C F      LV++ +D  +++W
Sbjct: 585 FDKLIATCSGDKTIKLWSLD-TFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIW 643

Query: 278 DLSTREIVRQYGGH 291
           D +T + ++   GH
Sbjct: 644 DCTTGDCLKTLDGH 657

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 93/202 (46%), Gaps = 22/202 (10%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHS-----------------DSQVNRLEITNDKKL 46
            L++A  D TI+ W+  T    R+   S                 D  +N + I+ +  L
Sbjct: 487 FLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISPNDSL 546

Query: 47  LGAAGH-QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
           +    + ++ +L+++ +     VAT   HK  +  +SF Q ++ + T S D TIK+W + 
Sbjct: 547 IATGSYDKSCKLWNLDS--GELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLD 604

Query: 106 SPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQS 164
           + +V + +  H   V        Q +L+S   DG I+IWD     C   L   DN  + +
Sbjct: 605 TFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNR-IWA 663

Query: 165 LSVASDGSMLVAANSKGNCYVW 186
           L+  +DG ++V+A++ G    W
Sbjct: 664 LTTWNDGELIVSADADGVLQFW 685

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 112/284 (39%), Gaps = 36/284 (12%)

Query: 30  HSDSQVNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF--- 83
           H+D  +N L  T D + L  A   +  +   Y   T+     A F GH  +VT++     
Sbjct: 421 HTD-LLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLPNV 479

Query: 84  --QQDNRWMVTSSEDGTIKVWDVRSPSVPRN------------------YKHNAPVNEVV 123
             +    +++T+S D TIK W + +PS  R+                  + H+  +N + 
Sbjct: 480 LLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSIS 539

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNC 183
           I PN   + +   D + ++W+L   +    L       +  +S      ++   +     
Sbjct: 540 ISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKR-GIWDVSFCQFDKLIATCSGDKTI 598

Query: 184 YVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLE 243
            +W +           +  F  H+N + R    +  K L +  AD   + W       L+
Sbjct: 599 KLWSL------DTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLK 652

Query: 244 STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW-DLSTREIVR 286
            TLDGH   +W      D   +V+A +D  ++ W D +  EI++
Sbjct: 653 -TLDGHDNRIWALTTWNDGELIVSADADGVLQFWNDCTELEILQ 695

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 62/154 (40%), Gaps = 23/154 (14%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYIT-----RILLS 216
           L SL+   DG  L  A+      +W+  + T  S      KF  HS+ +T      +LL 
Sbjct: 425 LNSLAATEDGQWLATASKDHTSILWKYSSET--SRFFAYAKFIGHSSSVTAVGLPNVLLR 482

Query: 217 SDVKHLATCSADKTARTWSL--------DDNFK--------LESTLDGHQRWVWDCAFSA 260
              + L T S D T + W +        DD  K         E T   H + +   + S 
Sbjct: 483 GYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISP 542

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
           + + + T S D   +LW+L + E+V     H +G
Sbjct: 543 NDSLIATGSYDKSCKLWNLDSGELVATLNNHKRG 576

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 77/166 (46%), Gaps = 29/166 (17%)

Query: 27  TIQHSDSQ-VNRLEITNDKKLLG--AAGHQNVRLYDI-----------RTTNPNPVATFE 72
           TI ++D Q +  L++T D K L   A   Q +++Y++           +  +  P+ T +
Sbjct: 57  TITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLK 116

Query: 73  GHKGNVTSLSFQQD----NRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPN 127
                ++S S+  D    +  +     DG+I V D+ +  +  ++K H   ++ V  + N
Sbjct: 117 -----LSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGN 171

Query: 128 QGE----LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS 169
                  L S D +G ++IWDL +  C H L  E N+ ++ L V S
Sbjct: 172 NDTNCWLLCSGDTNGMVKIWDLVKRSCIHTL-QEHNSAVRGLDVRS 216

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 48/101 (47%), Gaps = 3/101 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRT 62
           ++ +   D TI+ W   T    +T     + V R    N +K L ++G    ++++D   
Sbjct: 588 LIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWD--C 645

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD 103
           T  + + T +GH   + +L+   D   +V++  DG ++ W+
Sbjct: 646 TTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFWN 686

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/319 (24%), Positives = 123/319 (38%), Gaps = 68/319 (21%)

Query: 21  TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTS 80
           T +CS    H+ S+V           +   G    R++D  T  P    T  GH+  V  
Sbjct: 147 TILCSAFAPHTSSRV-----------VTGGGDNTARIWDCDTQTPK--VTLNGHRNWVLC 193

Query: 81  LSFQQDNRWMVTSSEDGTIKVWDVRS--PSVPRNYKHNAPVNEVVIHP-------NQGEL 131
           +S+  D   + T S D TI++WD  S  P       H+  +  +   P       ++  L
Sbjct: 194 VSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRL 253

Query: 132 ISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNH 191
            S  +DG IRIWD     C   L    N+ +  +    +G +   ++ K     W+M   
Sbjct: 254 ASASKDGTIRIWDSSRRVCLMTLGGHTNS-VSCVKWGGEGILYSGSHDK-TVRAWDM--- 308

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDV-------------------------------- 219
               N K +   K+H++++  + LS+D                                 
Sbjct: 309 --KQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVA 366

Query: 220 ----KH---LATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDH 272
               KH   + T S D T   W+     K  S + GHQ+ V   AFS D  Y+V+AS D+
Sbjct: 367 RKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDN 426

Query: 273 YVRLWDLSTREIVRQYGGH 291
            ++LWD      +  + GH
Sbjct: 427 SIKLWDGKEGTFLSTFRGH 445

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/336 (22%), Positives = 137/336 (40%), Gaps = 56/336 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+ G D+T R W+  T     T+    + V  +  + D +++      N +RL+D  + 
Sbjct: 161 VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESG 220

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
            P   A   GH   +TSL+++            + ++S+DGTI++WD            +
Sbjct: 221 KPLGDA-LRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGH 279

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QCTHQLTPEDNTPLQSLSVASDGSM-- 173
                 V    +G L S   D  +R WD+ +N +C + L    +  +  LS+++D ++  
Sbjct: 280 TNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHW-VNHLSLSTDYALRV 338

Query: 174 -------------------------------------LVAANSKGNCYVWEMPNHTDASN 196
                                                +V A+     ++W     T    
Sbjct: 339 GAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGT---- 394

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
            KP+++   H   +  +  S D K++ + S D + + W   +   L ST  GH   V+  
Sbjct: 395 -KPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFL-STFRGHVASVYQV 452

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 453 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 488

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 118/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TIR W++   VC  T+    + V+ ++   +  L   +  + VR +D++  N
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQ-N 311

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V + +   +K      P+  +  +  A  N   +
Sbjct: 312 GKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVK------PANAKEARDKALQNYEKV 365

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G+    +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 366 ARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKL-VNHVAFSPDGKYIVSASF 424

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W+    T  S       F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 425 DNSIKLWDGKEGTFLST------FRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTR 478

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  +RLW
Sbjct: 479 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 53/134 (39%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P      H N++  +  S+D + +AT S D T 
Sbjct: 159 SRVVTGGGDNTARIWDCDTQT------PKVTLNGHRNWVLCVSWSADGEVIATGSMDNTI 212

Query: 232 RTWSLDDNFKLESTLDGHQRWV----WD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W  +    L   L GH +W+    W+            L +AS D  +R+WD S R  
Sbjct: 213 RLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVC 272

Query: 285 VRQYGGHHKGAICV 298
           +   GGH     CV
Sbjct: 273 LMTLGGHTNSVSCV 286

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGV--CSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L G    SR   H    VN +  + D K + +A   N ++L+D 
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQ-KLVNHVAFSPDGKYIVSASFDNSIKLWDG 433

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           +      ++TF GH  +V  +++  D R +V+ S+D T+KVWDV++  +  +   H   V
Sbjct: 434 K--EGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEV 491

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 492 YTVDWSVDGKRVCSGGKDKMMRLW 515

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 139/340 (40%), Gaps = 64/340 (18%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++      N +RL+D +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTIRLWDPKTG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
                A   GH   +TSLS++            + +SS+DGTIK+WD  S      Y  +
Sbjct: 219 ECLGDA-LRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC--QYTMS 275

Query: 117 APVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQL------------------- 154
              N V  V    QG L S   D  +R+WD+  + +C + L                   
Sbjct: 276 GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALR 335

Query: 155 ------------TPEDNTPLQSLSVAS----------DGSMLVAANSKGNCYVWEMPNHT 192
                       +PED    Q  ++A+             M+V A+     ++W     T
Sbjct: 336 VGAFDHTGQKPTSPED---AQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKST 392

Query: 193 DASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRW 252
                KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   
Sbjct: 393 -----KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVAS 446

Query: 253 VWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           V+  A+S+D   LV+ S D  +++WD+ T ++     GH 
Sbjct: 447 VYQVAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLPGHQ 486

 Score = 70.1 bits (170), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+ ++ VC  T+    + V+ ++      L   +  + VR++D+ +  
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V + +    K      P+ P + +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQK------PTSPEDAQKKALANYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G     +++   D  I +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 CKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTG 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGRDKMVRLW 513

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D TI  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTIFLWNPLKSTKPIARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  RD  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGRDKMVRLW 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+   K H N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHFNWVLCVAWSPDGEVIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSDHYVRLWDLSTREI 284
           R W       L   L GH +W+   ++             L ++S D  +++WD  +R  
Sbjct: 211 RLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTMSGHTNSVSCV 284

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------STLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D+    ++    FK++      S + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGHNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVA 193

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 108/240 (45%), Gaps = 22/240 (9%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE-----MPNH 191
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+     +   
Sbjct: 506 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-NFKLES------ 244
            D+ N         H + +  ++ + D + + + S D++ + W+L + N K +S      
Sbjct: 565 LDSEN----ESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 245 ----TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
               T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 680

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D+  R W ++ N K+   L GH++ ++   +      LV+ 
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIE-NRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL T
Sbjct: 504 SGDRTVRIWDLRT 516

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 88/205 (42%), Gaps = 30/205 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 500 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 559

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-- 114
               R  + N   T  GHK +V S+ F +D + +V+ S D ++K+W++++ +   + K  
Sbjct: 560 FLVERLDSENESGT--GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTP 617

Query: 115 -----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ 163
                      H   V  V    N   ++S  +D  +  WD         L    N+ + 
Sbjct: 618 NSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVI- 676

Query: 164 SLSVASDGSML-----VAANSKGNC 183
           S++VA +GS L     V A   G+C
Sbjct: 677 SVAVA-NGSPLGPEYNVFATGSGDC 700

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 486

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 103/236 (43%), Gaps = 14/236 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG ++ A +      +W+         
Sbjct: 511 DRTVRIWDLRAGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 569

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLD-----------DNFKLES 244
           L    +    H + +  ++ + D   + + S D++ + W+L            +    E 
Sbjct: 570 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTAASEV 629

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           T  GH+ +V   A + +  ++++ S D  V  WD  +   +    GH    I VA+
Sbjct: 630 TYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 685

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+   G CS T+   D          D KL+ A    + VR++D  T 
Sbjct: 505 LVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 564

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS 106
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++RS
Sbjct: 565 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 612

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 88/207 (42%), Gaps = 22/207 (10%)

Query: 105 RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQS 164
           ++P+V  +   +  +  V   P+   L +   D  IRIWDL   +    L   +   + S
Sbjct: 437 QTPAVSTSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQD-IYS 495

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS-SDVKHLA 223
           L     G  LV+ +      +W++     +  L       +  + +T + +S  D K +A
Sbjct: 496 LDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTL-------SIEDGVTTVAVSPGDGKLIA 548

Query: 224 TCSADKTARTWSLDDNFKLESTLD-------GHQRWVWDCAFSADSAYLVTASSDHYVRL 276
             S D+T R W  +  F +E  LD       GH+  V+   F+ D   +V+ S D  V+L
Sbjct: 549 AGSLDRTVRIWDSETGFLVER-LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 607

Query: 277 WDLSTREIVRQYGGHHKGAICVALNDV 303
           W+L +       GG  +G    A ++V
Sbjct: 608 WNLRSAN-----GGSTEGKANTAASEV 629

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 75/165 (45%), Gaps = 26/165 (15%)

Query: 5   LVSAG-YDHTIRFWEALTGVCSRTIQ--------HSDSQVNRLEITNDKKLLGAAGHQNV 55
           L++AG  D T+R W++ TG     +         H DS  + +   +   ++  +  ++V
Sbjct: 546 LIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSV 605

Query: 56  RLYDIRTTN-------PNPVA---TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR 105
           +L+++R+ N        N  A   T+ GHK  V S++  Q++ ++++ S+D  +  WD  
Sbjct: 606 KLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTP 665

Query: 106 S--PSVPRNYKHNAPVNEVV-----IHPNQGELISCDRDGNIRIW 143
           S  P +      N+ ++  V     + P  G   +   D   RIW
Sbjct: 666 SGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 98/221 (44%), Gaps = 21/221 (9%)

Query: 77  NVTSLSFQQDNRWMVTSSEDGT---------IKVWD-VRSPSVPRNYKHNAPVNEVVIHP 126
           N+    ++Q N   +  SEDGT         + V+D + + S    Y+H   V  V ++P
Sbjct: 9   NLLGTVYRQGN---ILFSEDGTQLISPVGNRVSVFDLIHNKSYTFEYEHRKNVQCVALNP 65

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
               L+S D DG   + +       H    ++  P+  L  + DG +   A  +    VW
Sbjct: 66  QGTLLLSVDEDGRAILVNFRAKTVLHHFNFKE--PVSDLKFSPDGKVFAIACGR-FVQVW 122

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILL---SSDVKHLATCSADKTARTWSLDDNFK-L 242
           + P+  +     P  + + H+ + + I+    S D + L + S D TAR WSLD   K L
Sbjct: 123 KTPDVAEDRQFAPFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGL 182

Query: 243 ES-TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
            S T  GH+ +V    FSAD   + T S D  V  W+ + R
Sbjct: 183 ASVTFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPR 223

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 72  EGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGE 130
           +GH     ++++  D   +VT+SEDG IK+WDV S      ++ H A V+ +        
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 131 LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG-NCYVWEMP 189
           L S   DG +R WDL   +     T  +      L+    G ++ A +      +VW + 
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQ 457

Query: 190 NHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
                   + V     H   ++ +  S +   LA+ S DKT R WS+
Sbjct: 458 TG------QLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 498

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 13/194 (6%)

Query: 93  SSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCT 151
           SS+ G + V++ +S S + +   H    N V   P+   +++   DG I+IWD+    C 
Sbjct: 317 SSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCL 376

Query: 152 HQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
                E    + +L+ A  G +L +A+  G    W++  + +        + + +     
Sbjct: 377 VTFQ-EHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNC---- 431

Query: 212 RILLSSDVKHLATC--SADKTA-RTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
              L++D      C  S D  A   WS+    +L  TLDGH+  V   +FS +++ L +A
Sbjct: 432 ---LAADPSGEVVCAGSVDSFAVHVWSVQTG-QLVETLDGHEGPVSCLSFSQENSVLASA 487

Query: 269 SSDHYVRLWDLSTR 282
           S D  +R+W +  R
Sbjct: 488 SWDKTIRIWSIFGR 501

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 90/235 (38%), Gaps = 33/235 (14%)

Query: 70  TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD------VRSPS--------------- 108
           TF GH+  V    F  D   + T S+DG +  W+        SP                
Sbjct: 186 TFAGHRDYVMGAFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEIDPSLYSWR 245

Query: 109 -VPRNYKH--NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSL 165
              +NY +   A V  V  H N   L+    +G  R+++L E     QL+   N  + ++
Sbjct: 246 ITKKNYFYASQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLSMGQNA-VNTV 304

Query: 166 SVASDGSMLVAANSK-GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLAT 224
            V   G  L   +SK G   V+E  + +       + K + H +    +  S D   + T
Sbjct: 305 CVNDSGEWLAFGSSKLGQLLVYEWQSES------YILKQQGHFDATNAVTYSPDGSRVVT 358

Query: 225 CSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            S D   + W +   F L  T   H   V   AF+     L +AS D  VR WDL
Sbjct: 359 ASEDGKIKIWDVVSGFCL-VTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDL 412

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 94/209 (44%), Gaps = 23/209 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDS-QVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           +L SA  D T+R W+ +     RT   ++  Q N L      +++ A    +  ++    
Sbjct: 397 VLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV 456

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV--RSPSVPRNYKHNAPVN 120
                V T +GH+G V+ LSF Q+N  + ++S D TI++W +  RS  V    +  A V 
Sbjct: 457 QTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQV-EPLEVYADVL 515

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTP----------EDNTPLQ------- 163
            + + P+  E+ +   DG I  +D+ E +  + +            ED    Q       
Sbjct: 516 SLSVRPDGNEVAAATLDGQILFFDVHEGKQVNAIDGKKDILSGRHLEDRFTSQNSARSKH 575

Query: 164 --SLSVASDGSMLVAANSKGNCYVWEMPN 190
             ++  + DG  +VAA +  +  ++++PN
Sbjct: 576 FTTIDYSFDGLSIVAAGNNNSICLYDIPN 604

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 8/126 (6%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY--KHNAPVNEVVIH 125
           + TF+ H   V++L+F +  + + ++S DGT++ WD+      R +        N +   
Sbjct: 376 LVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAAD 435

Query: 126 PNQGELI---SCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
           P+ GE++   S D    + +W +   Q    L   +  P+  LS + + S+L +A+    
Sbjct: 436 PS-GEVVCAGSVDSFA-VHVWSVQTGQLVETLDGHEG-PVSCLSFSQENSVLASASWDKT 492

Query: 183 CYVWEM 188
             +W +
Sbjct: 493 IRIWSI 498

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 123/291 (42%), Gaps = 29/291 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + T++ W   T  C RT +   +   +        +LG     ++ LYD+ ++ 
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVLGTKTG-DLHLYDLASST 457

Query: 65  PNPVATFEG-HKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP------------- 110
              + T EG H G + SL    D + +VT S D T+  WD +    P             
Sbjct: 458 L--LNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLK 515

Query: 111 ----RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
                  + N  V  V I P+   L     D  ++++ +   +    L      P+ S+ 
Sbjct: 516 MFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGH-KLPVLSID 574

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  +L+ +++  N  +W + +  D           AH++ I +++   +  +  +CS
Sbjct: 575 ISFDSKLLITSSADKNIKIWGL-DFGDCHR-----SLFAHNDSIMKVVFVPESHNFFSCS 628

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            D   + W   D F+    L  HQ+ VW  A S+D  ++V+AS D  +R+W
Sbjct: 629 KDALVKYWD-GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 113/254 (44%), Gaps = 21/254 (8%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T P+P         GH+ +V ++    DN+ + T+S +GT+K+W++++ S  R ++    
Sbjct: 369 TMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATAS-NGTLKIWNIKTNSCIRTFECGYA 427

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +      P    ++   + G++ ++DL  +   + +    +  + SL + +DG  LV  +
Sbjct: 428 L-ACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGS 486

Query: 179 SKGNCYVWE-------MPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCS 226
           +      W+       +P  TD  N  P  K    +       +  + +S D + LA   
Sbjct: 487 ADKTVCFWDFQVEQEPVPGTTDKFN--PKLKMFHDTTLELNDDVLAVKISPDNRLLAVSL 544

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
            D T + + +D + K   +L GH+  V     S DS  L+T+S+D  +++W L   +  R
Sbjct: 545 LDNTVKVFFMD-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHR 603

Query: 287 QYGGHHKGAICVAL 300
               H+   + V  
Sbjct: 604 SLFAHNDSIMKVVF 617

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 77  NVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN-YKHNAPVNEVVIHPNQGELISCD 135
           +V ++    DNR +  S  D T+KV+ + S     + Y H  PV  + I  +   LI+  
Sbjct: 527 DVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSS 586

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L   +++ ++ + V    +         +C    +  + D  
Sbjct: 587 ADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFF-------SCSKDALVKYWDGD 639

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             + + K  AH   +  + +SSD + + + S D++ R WS  D+
Sbjct: 640 KFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVWSETDD 683

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 8/110 (7%)

Query: 47  LGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
           L A G+ +  ++++D+   + + + +F GHK  +T L+F Q    +++ S D  I VWD+
Sbjct: 89  LLAVGYNDGAIKIWDL--LSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDL 146

Query: 105 RSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQCTH 152
                   YK  +  + +     +GE  LIS  +DG I++WDL   QC  
Sbjct: 147 VGEV--GLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQCVE 194

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 95/225 (42%), Gaps = 21/225 (9%)

Query: 76  GNVTSLSFQQDNRWMVTSSE-DGTIKVWDVRSP-SVPRNYKHNAPVNEVVIHPNQGELIS 133
           G V + + +  N W + S E  GT+   D   P +V       A  + +  HP    L  
Sbjct: 35  GQVLTGALENVNCWSMKSGELIGTLT--DGLPPGAVDAKSTKPAETSYLQYHPETRLLAV 92

Query: 134 CDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTD 193
              DG I+IWDL              + +  L+    G+ L++ +   +  VW++     
Sbjct: 93  GYNDGAIKIWDLLSKSVLISFNGH-KSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVG 151

Query: 194 ASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWV 253
                 + K ++H + IT +    + + L + S D   + W L    K++  ++ H   V
Sbjct: 152 ------LYKLRSHKDSITGLWCEGE-EWLISTSKDGLIKVWDL----KVQQCVETHVAHV 200

Query: 254 WDC-AFSADSAYLVTASSDHYVRLWDLSTRE----IVRQYGGHHK 293
            +C +       ++TA +D+ ++LW+L+  E    ++ + G H K
Sbjct: 201 GECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIEKGTHEK 245

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEITNDKKLLGAAGHQNVRLYDI 60
           S +L+++  D  I+ W    G C R++  H+DS +  + +         +    V+ +D 
Sbjct: 579 SKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWD- 637

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
                  +     H+  V +L+   D R++V++S D +I+VW
Sbjct: 638 -GDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 108/240 (45%), Gaps = 22/240 (9%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE-----MPNH 191
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+     +   
Sbjct: 510 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-NFKLES------ 244
            D+ N         H + +  ++ + D + + + S D++ + W+L + N K +S      
Sbjct: 569 LDSEN----ESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 624

Query: 245 ----TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
               T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 625 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 684

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 209 YITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTA 268
           YI  +  S D K LAT + D+  R W ++ N K+   L GH++ ++   +      LV+ 
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIE-NRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 269 SSDHYVRLWDLST 281
           S D  VR+WDL T
Sbjct: 508 SGDRTVRIWDLRT 520

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 69/161 (42%), Gaps = 23/161 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 504 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 563

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-- 114
               R  + N   T  GHK +V S+ F +D   +V+ S D ++K+W++++ +   + K  
Sbjct: 564 FLVERLDSENESGT--GHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTP 621

Query: 115 -----------HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
                      H   V  V    N   ++S  +D  +  WD
Sbjct: 622 NSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 662

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQ 490

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 52/148 (35%), Gaps = 13/148 (8%)

Query: 155 TPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRIL 214
           TP  +  ++S+  + DG  L          +W      D  N K V   + H   I  + 
Sbjct: 443 TPSSDLYIRSVCFSPDGKFLATGAEDRLIRIW------DIENRKIVMILQGHEQDIYSLD 496

Query: 215 LSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYV 274
                  L + S D+T R W L    +   TL              D  Y+   S D  V
Sbjct: 497 YFPSGDKLVSGSGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAV 555

Query: 275 RLWDLSTREIVR------QYGGHHKGAI 296
           R+WD  T  +V       + G  HK ++
Sbjct: 556 RVWDSETGFLVERLDSENESGTGHKDSV 583

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 5   LVSAGYDHTIRFWEAL------------TGVCSRT-IQHSDSQVNRLEITNDKKLLGAAG 51
           +VS   D +++ W               +G C  T I H D  ++     ND+ +L  + 
Sbjct: 595 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 654

Query: 52  HQNVRLYDIRTTNPNPVATFEGHKGNVTSLS 82
            + V  +D ++   NP+   +GH+ +V S++
Sbjct: 655 DRGVLFWDKKSG--NPLLMLQGHRNSVISVA 683

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 103/237 (43%), Gaps = 15/237 (6%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   +G  + A +      VW+         
Sbjct: 441 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLDRTLRVWDSETGFLVER 499

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN------------FKLE 243
           L    +    H + +  ++ + D + + + S D++ + W+L +                E
Sbjct: 500 LDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCE 559

Query: 244 STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 560 VTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAV 616

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH--QNVRLYDIRT 62
           LVS   D T+R W+  TG CS T+   D  V  + ++  +    AAG   + +R++D  T
Sbjct: 435 LVSGSGDRTVRIWDLRTGQCSLTLSIEDG-VTTVAVSPGEGKFIAAGSLDRTLRVWDSET 493

Query: 63  T-------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
                   + N + T  GHK +V S+ F +D + +V+ S D ++K+W++
Sbjct: 494 GFLVERLDSENELGT--GHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WDLST+ IV    GH +
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQ 421

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 103/236 (43%), Gaps = 14/236 (5%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+ +  +    + H   +  +   P+  +L+S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           D  +RIWDL   QC+  L+ ED     ++S   DG ++ A +      +W+         
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIWDSETGFLVER 591

Query: 197 LKPVTKF-KAHSNYITRILLSSDVKHLATCSADKTARTWSLD-----------DNFKLES 244
           L    +    H + +  ++ + D   + + S D++ + W+L            +    E 
Sbjct: 592 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEV 651

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           T  GH+ +V   A + +  ++++ S D  V  WD  +   +    GH    I VA+
Sbjct: 652 TYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAV 707

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 95/222 (42%), Gaps = 32/222 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDIRTT 63
           LVS   D T+R W+  TG CS T+   D          D KL+ A    + VR++D  T 
Sbjct: 527 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG 586

Query: 64  -------NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSP-SVPRNYKH 115
                  + N + T  GHK +V S+ F +D   +V+ S D ++K+W++RS        K 
Sbjct: 587 FLVERLDSENELGT--GHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKA 644

Query: 116 NAPVNE------------VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ 163
           N   +E            V    N   ++S  +D  +  WD         L    N+ + 
Sbjct: 645 NTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVI- 703

Query: 164 SLSVASDGSM----LVAANSKGNCY--VWEMPNHTDASNLKP 199
           S++VA+D  +     V A   G+C   +W+    T  SN +P
Sbjct: 704 SVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQT--SNAEP 743

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 83/205 (40%), Gaps = 20/205 (9%)

Query: 106 SPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSL 165
           SP+V  +   +  +  V   P+   L +   D  IRIWDL   +    L   +   + SL
Sbjct: 460 SPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQD-IYSL 518

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
                G  LV+ +      +W++   T   +L             T  +   D K +A  
Sbjct: 519 DYFPSGDKLVSGSGDRTVRIWDL--RTGQCSL----TLSIEDGVTTVAVSPGDGKLIAAG 572

Query: 226 SADKTARTWSLDDNFKLESTLD-------GHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
           S D+T R W  +  F +E  LD       GH+  V+   F+ D   +V+ S D  V+LW+
Sbjct: 573 SLDRTVRIWDSETGFLVER-LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 279 LSTREIVRQYGGHHKGAICVALNDV 303
           L +       GG  +G    A ++V
Sbjct: 632 LRSAN-----GGTAEGKANTAASEV 651

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 189 PNHTDAS----NLK--PVTKFKAHSN-YITRILLSSDVKHLATCSADKTARTWSLDDNFK 241
           P+  DAS    N K  P     A S+ YI  +  S D K LAT + DK  R W L    +
Sbjct: 445 PSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATR-R 503

Query: 242 LESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
           +  TL GH++ ++   +      LV+ S D  VR+WDL T
Sbjct: 504 IVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 543

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 138/339 (40%), Gaps = 62/339 (18%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++      N +RL++ +T 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTIRLWNPKTG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPR--NYK 114
                A   GH   +T LS++            + +SS+DGTIK+WD    SV R   Y 
Sbjct: 219 ECLGDA-LRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWD----SVNRVCQYT 273

Query: 115 HNAPVNEV--VIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT---------------- 155
            +   N V  V    QG L S   D  +R+WD+  + +C + L                 
Sbjct: 274 LSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYA 333

Query: 156 ------------PEDNTPLQSLSV----------ASDGSMLVAANSKGNCYVWEMPNHTD 193
                       P  +   Q  ++           S   M+V A+     ++W     T 
Sbjct: 334 LRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKST- 392

Query: 194 ASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWV 253
               KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V
Sbjct: 393 ----KPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASV 447

Query: 254 WDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           +  A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 117/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L S+  D TI+ W+++  VC  T+    + V+ ++      L   +  + VR++D+ +  
Sbjct: 251 LASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDMNSQG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V + +    K      P+     +  A  N   I
Sbjct: 311 -RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKK------PATSEEAQKKALENYEKI 363

Query: 125 HPNQGE----LISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G     +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 CKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 MMVTASDDFTMFLWNPLKSTKPIARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 51/134 (38%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+   K H N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQT------PMHTLKGHFNWVLCVSWSPDGEVIATGSMDNTI 210

Query: 232 RTWSLDDNFKLESTLDGHQRWV----WD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W+      L   L GH +W+    W+            L ++S D  +++WD   R  
Sbjct: 211 RLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWDSVNRVC 270

Query: 285 VRQYGGHHKGAICV 298
                GH     CV
Sbjct: 271 QYTLSGHTNSVSCV 284

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------STLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D+    ++    FK++      S + GH   +   AF+   S
Sbjct: 97  ITDNLYSSLIKPGFNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT + D+  R+WD  T+  +    GH    +CV+
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMHTLKGHFNWVLCVS 193

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 123/282 (43%), Gaps = 29/282 (10%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           L +AG+ D  I+ W +L G    T+  +++     + T D  L     HQ          
Sbjct: 502 LAAAGFQDSYIKIW-SLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQE--------- 551

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEV 122
           + N      GH G V S SF  DN+ +++ SED T+++W + + S   +YK HN PV +V
Sbjct: 552 HVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDV 611

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTH----QLTPEDNTPLQSLSVASDGSMLVAAN 178
              P      +   D   R+W      C H    ++     + +  ++   +G  +   +
Sbjct: 612 AFSPMGHYFATASHDQTARLW-----SCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGS 666

Query: 179 SKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD 238
           S   C +W      D S  + V  F  H+  +  + +S D + LA+ S D     W +  
Sbjct: 667 SDKTCRMW------DVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 239 NFKLESTLDGHQR-WVWDCAFSADSAYLVTASSDHYVRLWDL 279
             +L+  + GH R  V    FS +   +++  +D+ VR+WD+
Sbjct: 721 GKRLKQ-MRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 89/202 (44%), Gaps = 16/202 (7%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH-QNVRL----- 57
           +L+S   D T+R W   T     + +  +  V  +  +        A H Q  RL     
Sbjct: 577 LLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCDH 636

Query: 58  -YDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY-KH 115
            Y +R         F GH  +V  ++F  +  ++ T S D T ++WDV +    R +  H
Sbjct: 637 IYSLRI--------FAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLV 175
            APV  + + P+   L S   DG I +WD+G  +   Q+       + S+  + +G++++
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVII 748

Query: 176 AANSKGNCYVWEMPNHTDASNL 197
           +  +  +  VW+M    + S++
Sbjct: 749 SGGTDNSVRVWDMYKSNNESSI 770

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 103/255 (40%), Gaps = 33/255 (12%)

Query: 55  VRLYDIRTTNPNP-VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           V L ++R+  P+  + TF      + SL F  D R      +D  IK+W +   S+    
Sbjct: 467 VDLSNLRSELPSVCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSL---- 522

Query: 114 KHNAPVNEVVIHPNQGELISCDR-DGNIRIWDLGENQCTHQLTPEDNTPL-------QSL 165
                  + +   N       +  D N+       ++  HQ     NT L        S 
Sbjct: 523 -------DTLTSTNNTHFTKKNTADNNLH------SKKKHQEHVNTNTKLVGHSGAVYST 569

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
           S + D  +L++ +      +W M   +       +  +K H++ +  +  S    + AT 
Sbjct: 570 SFSPDNKLLISGSEDKTVRLWAMDTQS------TLVSYKGHNHPVWDVAFSPMGHYFATA 623

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIV 285
           S D+TAR WS D  + L     GH   V    F  +  Y+ T SSD   R+WD+ST E V
Sbjct: 624 SHDQTARLWSCDHIYSLR-IFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETV 682

Query: 286 RQYGGHHKGAICVAL 300
           R + GH    + + +
Sbjct: 683 RLFLGHTAPVVSLGV 697

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 64/149 (42%), Gaps = 7/149 (4%)

Query: 1   MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLGAAGHQNVRLYD 59
           M     +A +D T R W        R      S V+ +    N   +   +  +  R++D
Sbjct: 616 MGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWD 675

Query: 60  IRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS---VPRNYKHN 116
           + T     V  F GH   V SL    D RW+ + SEDG I VWD+ S       R +  N
Sbjct: 676 VSTGET--VRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRN 733

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL 145
           A VN +V       +IS   D ++R+WD+
Sbjct: 734 A-VNSIVFSQEGTVIISGGTDNSVRVWDM 761

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 131/298 (43%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 31  LLLSASRDKTLISWK-LTGNDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLR 89

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+++ T        F GHK +V S++  +    +++ S D TIKVW ++   +     HN
Sbjct: 90  LWNVAT--GETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGDCLATMLGHN 147

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+ E      LIS   D  ++ W++ + Q        +N  + +++ + D
Sbjct: 148 DWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNY-INTITASPD 206

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A   G+  +W +   +    L    +  A +    R  L++     AT S  K 
Sbjct: 207 GTLIASAGKDGDIMLWNLKEKSPLYTLNAQDEVFALAFSPNRYWLTA-----ATSSGIKV 261

Query: 231 --ARTWSLDDNFKLEST-----LDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
                  L D  K E T      D H       A+SAD   L    +D+ +R+W + T
Sbjct: 262 FDLEEKKLIDELKPEFTGFNKAADPHAV---SLAWSADGQTLFAGYTDNVIRVWQVMT 316

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 106/228 (46%), Gaps = 24/228 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVWDV----RSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W +    +   VP R++K H+  V 
Sbjct: 10  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQ 68

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+W++   +   + T    + + S+++    SM+++ +  
Sbjct: 69  DCALTADGAYALSASWDKTLRLWNVATGETYQRFTGH-KSDVMSVAIDRKASMIISGSRD 127

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS------SDVKHLATCSADKTARTW 234
               VW +     A+ L        H+++++++ ++       +   L +   DK  + W
Sbjct: 128 KTIKVWTIKGDCLATML-------GHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAW 180

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E+   GH  ++     S D   + +A  D  + LW+L  +
Sbjct: 181 NVN-QFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKEK 227

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 57/104 (54%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSLDDNFKLES----TLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L  N +       +  GH   V DCA
Sbjct: 12  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCA 71

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 72  LTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAID 115

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/189 (19%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPEDNTP----LQSLSVAS 169
           HN  V  +     Q  L+ S  RD  +  W L  N   + +           +Q  ++ +
Sbjct: 15  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHSHIVQDCALTA 74

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
           DG+  ++A+      +W +         +   +F  H + +  + +      + + S DK
Sbjct: 75  DGAYALSASWDKTLRLWNVATG------ETYQRFTGHKSDVMSVAIDRKASMIISGSRDK 128

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTRE 283
           T + W++  +    +T+ GH  WV     +       ++  L++A  D  V+ W+++  +
Sbjct: 129 TIKVWTIKGD--CLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQ 186

Query: 284 IVRQYGGHH 292
           I   + GH+
Sbjct: 187 IEADFVGHN 195

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 136/334 (40%), Gaps = 54/334 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +    + +++      N +RL++ ++ 
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEGKSG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
            P   A   GH   +TSL+++        +   + ++S+DGTIK+WD            +
Sbjct: 219 KPVGDA-LRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLSGH 277

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT-------------------- 155
                 +    QG L S   D  +R WD+  E +C + L                     
Sbjct: 278 TNSVSCIKWGGQGILYSGSHDKTVRAWDMNSEGRCINVLKSHAHWVNHLSLSTDYALRVG 337

Query: 156 PEDNTPLQSLS---------------VASDG---SMLVAANSKGNCYVWEMPNHTDASNL 197
           P D+T ++  S               V  +G    ++V A+     ++W     T     
Sbjct: 338 PFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKST----- 392

Query: 198 KPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCA 257
           KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V+  A
Sbjct: 393 KPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFISTFRGHVASVYQVA 451

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +SAD   LV+ S D  +++WD+ TR++     GH
Sbjct: 452 WSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 118/295 (40%), Gaps = 57/295 (19%)

Query: 45  KLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P   AT  GH   V  +S+  +   + T S D TI++W+ 
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPK--ATLTGHTNWVLCVSWCPNGEVIATGSMDNTIRLWEG 215

Query: 105 RS--PSVPRNYKHNAPVNEVVIHP-------NQGELISCDRDGNIRIWDLGENQCTHQLT 155
           +S  P       H   +  +   P        Q  L S  +DG I+IWD     C + L+
Sbjct: 216 KSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLS 275

Query: 156 PEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILL 215
              N+ +  +     G +   ++ K     W+M +     N+      K+H++++  + L
Sbjct: 276 GHTNS-VSCIKWGGQGILYSGSHDK-TVRAWDMNSEGRCINV-----LKSHAHWVNHLSL 328

Query: 216 SSD--------------------------------VKH-------LATCSADKTARTWSL 236
           S+D                                VK        + T S D T   W+ 
Sbjct: 329 STDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNP 388

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
             + K    + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 389 LKSTKPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGH 443

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L   +  + VR +D+ +  
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGGQGILYSGSHDKTVRAWDMNSEG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN-EVV 123
              +   + H   V  LS   D    V   +   ++      P+ P + +  A  N E V
Sbjct: 311 -RCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVE------PTSPEDARDKALKNYEKV 363

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
           +  N   +  +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 VKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  S+D + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 477 -KLSVDLPGHKDEVFTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T    R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSTKPLGRMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 490 FTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 57/147 (38%), Gaps = 13/147 (8%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSD 218
           +T L S    +  S +V         +W+    T      P      H+N++  +    +
Sbjct: 144 STILCSAFAPNSSSRMVTGAGDNTARIWDCDTQT------PKATLTGHTNWVLCVSWCPN 197

Query: 219 VKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAF-------SADSAYLVTASSD 271
            + +AT S D T R W       +   L GH +W+   A+       + +   L +AS D
Sbjct: 198 GEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKD 257

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICV 298
             +++WD S R  +    GH     C+
Sbjct: 258 GTIKIWDTSRRVCLYTLSGHTNSVSCI 284

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSADSA-YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+ +S+  +VT + D+  R+WD  T+       GH    +CV+
Sbjct: 137 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTPKATLTGHTNWVLCVS 193

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 134/336 (39%), Gaps = 56/336 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T   W+  T     T+Q   + V     + D +L+      N +RL++    
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSVPRNYKH 115
            P   A   GH   +TSLS++        D   + T+S+DGTIK+WD  R   +     H
Sbjct: 219 KPYGDA-LRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QCTHQL-------------------- 154
            + V+  V    +  L S   D  IR WD+  N +C + L                    
Sbjct: 278 TSSVS-CVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRL 336

Query: 155 --------TPEDNTPLQSLSV----------ASDGSMLVAANSKGNCYVWEMPNHTDASN 196
                   TP      Q  ++               ++V A+     Y+W     T    
Sbjct: 337 GAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKST---- 392

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
            KP+T+   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V+  
Sbjct: 393 -KPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFLSTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQ 486

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 106/281 (37%), Gaps = 65/281 (23%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRLYDIR 61
           +L S  +D TIR W+  L G C   ++     VN L ++ D  L LGA  H+        
Sbjct: 291 VLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPE 350

Query: 62  TTNPNPVATFEG---HKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP--RNYKHN 116
                 +  +E     KG+   L        MVT+S+D T+ +W+    + P  R   H 
Sbjct: 351 EAQQKALKNYEKVAKRKGDFEEL--------MVTASDDFTMYLWNPLKSTKPITRMTGHQ 402

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVA 176
             VN V   P                                           DG  +V+
Sbjct: 403 KLVNHVAFSP-------------------------------------------DGRYIVS 419

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
           A+   +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +
Sbjct: 420 ASFDNSIKLW------DGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDV 473

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
               KL   L GHQ  V+   +S D   + +   D  VR+W
Sbjct: 474 KTR-KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 55/147 (37%), Gaps = 13/147 (8%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSD 218
           +T L S    +  S +V         +W+    T    L+       H N++     S D
Sbjct: 144 STILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQ------GHHNWVLCCSWSPD 197

Query: 219 VKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSD 271
            + +AT S D T R W           L GH +W+   ++         D   L TAS D
Sbjct: 198 GELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKD 257

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICV 298
             +++WD + R  +    GH     CV
Sbjct: 258 GTIKIWDTTRRVCLLTLCGHTSSVSCV 284

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 107/248 (43%), Gaps = 28/248 (11%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-----VPRNYKHNAPV 119
           P  V  +EGH+  + SL   +D  W+ T+S+D T  +W     +       +   H++ V
Sbjct: 378 PLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAV 437

Query: 120 NEVVIHPN---QGE---LISCDRDGNIRIW---------DLGENQCTHQLTPEDNTPLQS 164
             V + PN   +G    L++   D  I+ W         D+   + +          + +
Sbjct: 438 TAVGL-PNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINA 496

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLAT 224
           LSV+ + S+   A+    C +W + N    + L        H   +  +      K LAT
Sbjct: 497 LSVSPNDSIFATASYDKTCKIWSLENGELEATLA------NHKRGLWDVSFCQYDKLLAT 550

Query: 225 CSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
            S DKT + WSLD  F +  TL+GH   V  C+F      LV+  +D  +++WD S+ E 
Sbjct: 551 SSGDKTVKIWSLD-TFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGEC 609

Query: 285 VRQYGGHH 292
           +    GH+
Sbjct: 610 LNTLDGHN 617

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 95/196 (48%), Gaps = 15/196 (7%)

Query: 4   ILVSAGYDHTIRFWEA----------LTGVCSRTIQHSDSQVNRLEIT-NDKKLLGAAGH 52
            L++A  D TI+ W+           +  V   T    +  +N L ++ ND     A+  
Sbjct: 453 FLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYD 512

Query: 53  QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN 112
           +  +++ +   N    AT   HK  +  +SF Q ++ + TSS D T+K+W + + SV + 
Sbjct: 513 KTCKIWSLE--NGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKT 570

Query: 113 YK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDG 171
            + H+  V        Q +L+SC  DG I+IWD    +C + L   +N  L +L+  +DG
Sbjct: 571 LEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNR-LWALNTMNDG 629

Query: 172 SMLVAANSKGNCYVWE 187
            M+V+A++ G    W+
Sbjct: 630 DMIVSADADGVFQFWK 645

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 101/262 (38%), Gaps = 27/262 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF-----QQD 86
           +N L+ T D   +  A   N  +   Y+ RT+  +  A + GH   VT++       +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGY 450

Query: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYK-----------HNAPVNEVVIHPNQGELISCD 135
             +++T+S D TIK W V  P+   + +           H   +N + + PN     +  
Sbjct: 451 PEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATAS 510

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D   +IW L EN             L  +S      +L  ++      +W +   +   
Sbjct: 511 YDKTCKIWSL-ENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWD 255
            L+       HSN + R    +  K L +C AD   + W       L +TLDGH   +W 
Sbjct: 570 TLE------GHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECL-NTLDGHNNRLWA 622

Query: 256 CAFSADSAYLVTASSDHYVRLW 277
                D   +V+A +D   + W
Sbjct: 623 LNTMNDGDMIVSADADGVFQFW 644

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 94/225 (41%), Gaps = 23/225 (10%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T+L    D +++   S+   +K++ +++  + R+ K ++P   +   P    L     D
Sbjct: 64  ITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISSPSYILDTDPTSTLLAVGGTD 123

Query: 138 GNIRIWDLGENQCTHQLTPEDNTPLQSLS----VASDGSMLVAANSKGNCYVWEMPNHTD 193
           G+I I D+     TH L     T + SL     + S+  +L + ++ G   VW++     
Sbjct: 124 GSIVIVDIENGYITHSLKGHGGT-ISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKR-- 180

Query: 194 ASNLKPVTKFKAHSNYITRILL----SSDVKHLATCSA--DKTARTWSLD--DNFKLEST 245
               K +   + HS+ +  + +    S D   L   S   D     W  D     KL  T
Sbjct: 181 ----KCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKCKLVKT 236

Query: 246 LDGHQRWVWDCAFSAD---SAYLVTASSDHYVRLWDLSTREIVRQ 287
           L  +Q+ V  C F  +      + TA  D   +L DL +  ++++
Sbjct: 237 LPVNQQ-VESCGFLKNHDGKRIIYTAGGDAIFQLIDLESGTVLKR 280

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 62/312 (19%), Positives = 120/312 (38%), Gaps = 45/312 (14%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK-------KLLGAAGHQNVR 56
           +L S   +  ++ W+ +   C  T+Q   S V  L+I   +       KLL       V 
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVN 221

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQD---NRWMVTSSEDGTIKVWDVRSPSVPRNY 113
           ++D        +         V S  F ++    R + T+  D   ++ D+ S +V +  
Sbjct: 222 VWDFDMKKKCKLVKTLPVNQQVESCGFLKNHDGKRIIYTAGGDAIFQLIDLESGTVLK-- 279

Query: 114 KHNAPVNEVVIHP-----NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVA 168
           + N P+ E+ I       N  E+     D  +++ ++ E      L  E++T     ++A
Sbjct: 280 RTNKPIEELFIIGVLPIMNDSEMFLVMSDQTLQLINIEE-----VLENENDTINARSTIA 334

Query: 169 SDGSM-------------LVAANSKGNCYVWEMPNHT--DASNLKPVTKFKAHSNYITRI 213
            +  +             L  A +  +  +  +P+ +  DAS    V  ++ H + +  +
Sbjct: 335 GNNGIIADMRFVGPELNKLALATNSPSLRIIPIPDLSGADASLPLDVEIYEGHEDLLNSL 394

Query: 214 LLSSDVKHLATCSADKTARTWSLDD---NFKLESTLDGHQRWVWDCAF-----SADSAYL 265
             + D   +AT S D TA  W  ++    F + +   GH   V               +L
Sbjct: 395 DATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFL 454

Query: 266 VTASSDHYVRLW 277
           +TAS+D  ++ W
Sbjct: 455 LTASNDLTIKKW 466

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 57/147 (38%), Gaps = 16/147 (10%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL    DG  +  A+      +W+    T  S      K+  HS+ +T + L + +  
Sbjct: 391 LNSLDATEDGLWIATASKDNTAILWKYNERT--SKFDIYAKYIGHSSAVTAVGLPNVMPK 448

Query: 220 ---KHLATCSADKTARTWSLDDNFKL---------ESTLDGHQRWVWDCAFSADSAYLVT 267
              + L T S D T + W +     +         E T   H++ +   + S + +   T
Sbjct: 449 GYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFAT 508

Query: 268 ASSDHYVRLWDLSTREIVRQYGGHHKG 294
           AS D   ++W L   E+      H +G
Sbjct: 509 ASYDKTCKIWSLENGELEATLANHKRG 535

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 75.5 bits (184), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 132/298 (44%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ Q  +  V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDKQYGVPVRSFQGHNHIVQDCSLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S++  +    +++ S D T+KVW +R   +     HN
Sbjct: 91  LWDVATGQT--YQRFVGHKSDVMSVAIDRKASMIISGSRDRTVKVWTIRGQCLATMLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V I P +        +IS   D  ++ W++ + Q        +N  + +++ + D
Sbjct: 149 DWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQFQIEADFIGHNNY-VNTITASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           GS++ +A   G   +W + +      L    +  A +    R  LS+     AT S  K 
Sbjct: 208 GSLVASAGKDGEIMLWNLADKVPMYTLSAQDEVFALAFSPNRYWLSA-----ATSSGIK- 261

Query: 231 ARTWSLDDNF---KLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
              + LD  +   +L+    G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 262 --IFCLDPKYLVDELKPEFAGYTKASEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 109/228 (47%), Gaps = 24/228 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R+++ HN  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   Q T+Q      + + S+++    SM+++ +  
Sbjct: 70  DCSLTADGAYALSASWDKTLRLWDVATGQ-TYQRFVGHKSDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS------SDVKHLATCSADKTARTW 234
               VW +     A+ L        H+++++++ ++       D   + +   DK  + W
Sbjct: 129 RTVKVWTIRGQCLATML-------GHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E+   GH  +V     S D + + +A  D  + LW+L+ +
Sbjct: 182 NVN-QFQIEADFIGHNNYVNTITASPDGSLVASAGKDGEIMLWNLADK 228

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 57/104 (54%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSLDDNFKLES----TLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L  + K       +  GH   V DC+
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDCS 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T +  +++ GH    + VA++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAID 116

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 79/189 (41%), Gaps = 19/189 (10%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPED----NTPLQSLSVAS 169
           HN  V  +     Q  L+ S  RD  +  W L  +   + +        N  +Q  S+ +
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQGHNHIVQDCSLTA 75

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
           DG+  ++A+      +W      D +  +   +F  H + +  + +      + + S D+
Sbjct: 76  DGAYALSASWDKTLRLW------DVATGQTYQRFVGHKSDVMSVAIDRKASMIISGSRDR 129

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLSTRE 283
           T + W++    +  +T+ GH  WV     +       D+  +++A  D  V+ W+++  +
Sbjct: 130 TVKVWTIRG--QCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNVNQFQ 187

Query: 284 IVRQYGGHH 292
           I   + GH+
Sbjct: 188 IEADFIGHN 196

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 106/240 (44%), Gaps = 22/240 (9%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDR 136
           + S+ F  D +++ T +ED  I++WD+    +    + H   +  +   P+  +L+S   
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 501

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE-----MPNH 191
           D  +RIWDL   QC+  L+ ED     ++S   DG  + A +      VW+     +   
Sbjct: 502 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDSETGFLVER 560

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-NFKLES------ 244
            D+ N         H + +  ++ + D   + + S D++ + W+L + N K +S      
Sbjct: 561 LDSEN----ESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSG 616

Query: 245 ----TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
               T  GH+ +V   A + +  Y+++ S D  V  WD  +   +    GH    I VA+
Sbjct: 617 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAV 676

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 30/205 (14%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAG-HQNVRLYDI--- 60
           LVS   D T+R W+  TG CS T+   D          D K + A    + VR++D    
Sbjct: 496 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 555

Query: 61  ----RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-- 114
               R  + N   T  GHK +V S+ F +D   +V+ S D ++K+W++++ +   + K  
Sbjct: 556 FLVERLDSENESGT--GHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAP 613

Query: 115 -----------HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ 163
                      H   V  V    N   ++S  +D  +  WD         L    N+ + 
Sbjct: 614 NSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVI- 672

Query: 164 SLSVASDGSML-----VAANSKGNC 183
           S++VA +GS L     V A   G+C
Sbjct: 673 SVAVA-NGSPLGPEYNVFATGSGDC 696

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
           ++    FS D  +L T + D  +R+WD+  R+IV    GH +
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQ 482

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 76.3 bits (186), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 128/319 (40%), Gaps = 68/319 (21%)

Query: 21  TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTS 80
           T +CS+   H+ S           +++  AG    R++D  T  P  +AT  GH+  V  
Sbjct: 145 TILCSQFAPHTSS-----------RMVTGAGDNTARVWDCDTQTP--MATLSGHQNWVLC 191

Query: 81  LSFQQDNRWMVTSSEDGTIKVWDVRS--PSVPRNYKHNAPVNEVVIHP-------NQGEL 131
           +++  D   + T S D T+++WD ++  P       H   +  +V  P       ++  L
Sbjct: 192 VAWSPDGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRL 251

Query: 132 ISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNH 191
            S  +DG I+IWD     C + L+   N+ +  +     G +L + +      VW+M   
Sbjct: 252 ASASKDGTIKIWDTSRRVCIYTLSGHTNS-VSCVKWGGQG-LLYSGSHDKTVRVWDMNVG 309

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDV-------------------------------- 219
               N+      K+H++++  + LS++                                 
Sbjct: 310 GKCINI-----LKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIA 364

Query: 220 -------KHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDH 272
                  + + T S D T   W    + K  + L GHQ+ V   AFS D  ++V+AS D+
Sbjct: 365 KRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDN 424

Query: 273 YVRLWDLSTREIVRQYGGH 291
            ++LWD      +  + GH
Sbjct: 425 SIKLWDGRNGTFISTFRGH 443

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 135/335 (40%), Gaps = 56/335 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQ-NVRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D + +        VRL+D +  
Sbjct: 159 MVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVAWSPDGETIATGSMDCTVRLWDSKAG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSVPRNYKH 115
            P   A  +GH+  +TSL ++        D   + ++S+DGTIK+WD  R   +     H
Sbjct: 219 QPLGDA-LKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCTHQLT------------------- 155
              V+  V    QG L S   D  +R+WD+    +C + L                    
Sbjct: 278 TNSVS-CVKWGGQGLLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRV 336

Query: 156 -PEDNTPLQSLSV------------------ASDGSMLVAANSKGNCYVWEMPNHTDASN 196
            P D+T  +  S                        ++V A+     ++W+ P  +    
Sbjct: 337 GPFDHTATKFTSAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWD-PTKSG--- 392

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
            KP+ +   H   +  +  S D + + + S D + + W    N    ST  GH   V+  
Sbjct: 393 -KPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWD-GRNGTFISTFRGHVASVYQV 450

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           A+S+D   LV+ S D  +++WD+ TR++     GH
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGH 485

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 113/283 (39%), Gaps = 30/283 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L   +  + VR++D+    
Sbjct: 251 LASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGGQGLLYSGSHDKTVRVWDMNVGG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMV----------TSSEDGTIKVWDVRSPSVPRNYK 114
              +   + H   V  LS   +    V          TS+E+   K  +    +  +  K
Sbjct: 311 -KCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALE----NYEKIAK 365

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSML 174
            N    E+++        +   D  + +WD  ++             +  ++ + DG  +
Sbjct: 366 RNGKAEELIV--------TASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFI 417

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW 234
           V+A+   +  +W      D  N   ++ F+ H   + ++  SSD + L +CS D T + W
Sbjct: 418 VSASFDNSIKLW------DGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            +    KL   L GH+  V+   +S D   + +   D  VRLW
Sbjct: 472 DVRTR-KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 53/134 (39%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         VW+    T      P+     H N++  +  S D + +AT S D T 
Sbjct: 157 SRMVTGAGDNTARVWDCDTQT------PMATLSGHQNWVLCVAWSPDGETIATGSMDCTV 210

Query: 232 RTWSLDDNFKLESTLDGHQRW----VWD---CAFSADSAYLVTASSDHYVRLWDLSTREI 284
           R W       L   L GHQ+W    VW+        D   L +AS D  +++WD S R  
Sbjct: 211 RLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVC 270

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 271 IYTLSGHTNSVSCV 284

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 72/143 (50%), Gaps = 5/143 (3%)

Query: 4   ILVSAGYDHTIRFWEAL-TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIR 61
           ++V+A  D T+  W+   +G     +      VN +  + D + + +A   N ++L+D R
Sbjct: 373 LIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSPDGRFIVSASFDNSIKLWDGR 432

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVN 120
             N   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V 
Sbjct: 433 --NGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVY 490

Query: 121 EVVIHPNQGELISCDRDGNIRIW 143
            V    +   + S  +D  +R+W
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 90/224 (40%), Gaps = 42/224 (18%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRLYDIR 61
           +L S  +D T+R W+  + G C   ++     VN L ++ +  L +G   H   +     
Sbjct: 291 LLYSGSHDKTVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAE 350

Query: 62  --------------------------------------TTNPNPVATFEGHKGNVTSLSF 83
                                                 T +  P+A   GH+  V  ++F
Sbjct: 351 EARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAF 410

Query: 84  QQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRI 142
             D R++V++S D +IK+WD R+ +    ++ H A V +V    +   L+SC +D  +++
Sbjct: 411 SPDGRFIVSASFDNSIKLWDGRNGTFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 470

Query: 143 WDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           WD+   + +  L P     + ++  + DG  + +        +W
Sbjct: 471 WDVRTRKLSVDL-PGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 210 ITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------STLDGHQRWVWDCAFSA-DS 262
           IT  L SS +K     + D+    ++    FK++      S + GH   +    F+   S
Sbjct: 97  ITDNLYSSLLKPGLKTTEDQITLIYTPRAVFKVKPITRSSSAIAGHGATILCSQFAPHTS 156

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           + +VT + D+  R+WD  T+  +    GH    +CVA
Sbjct: 157 SRMVTGAGDNTARVWDCDTQTPMATLSGHQNWVLCVA 193

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 141/336 (41%), Gaps = 56/336 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +++      N +RL++    
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVSWSPDGEIIATGSMDNTIRLWESDRG 218

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWD-VRSPSVPRNYKH 115
            P       GH   +TSLS++        +   + ++S+DGTIK+WD VR   V     H
Sbjct: 219 KPLG-EPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVRRVCVYTLSGH 277

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCTHQLT------------------- 155
              V+  V    QG L S   D  +R+WD+    +C + L                    
Sbjct: 278 TNSVS-CVKWGGQGVLYSGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLSTDYALRR 336

Query: 156 -PEDNTPLQSLS---------------VASDGS---MLVAANSKGNCYVWEMPNHTDASN 196
            P D+T  +  S               V  +G+   ++V A+     ++W  P  ++   
Sbjct: 337 GPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLWN-PLKSN--- 392

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
            KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  GH   V+  
Sbjct: 393 -KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFLSTFRGHVSSVYQV 450

Query: 257 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
           A+S+D   LV+ S D  +++WD+ TR++     GH 
Sbjct: 451 AWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQ 486

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 122/305 (40%), Gaps = 61/305 (20%)

Query: 45  KLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW-- 102
           +++  AG    R++D  T  P  + T  GH+  V  +S+  D   + T S D TI++W  
Sbjct: 158 RMVTGAGDNTARIWDCDTQTP--MTTLTGHQNWVLCVSWSPDGEIIATGSMDNTIRLWES 215

Query: 103 DVRSPSVPRNYKHNAPVNEVVIHP----NQGE---LISCDRDGNIRIWDLGENQCTHQLT 155
           D   P       H   +  +   P      GE   L S  +DG I+IWD     C + L+
Sbjct: 216 DRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWDTVRRVCVYTLS 275

Query: 156 PEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNL--KPVTKFKAHSNYITRI 213
              N+ +  +     G +   ++ K    VW+M       NL  K +   K H++++  +
Sbjct: 276 GHTNS-VSCVKWGGQGVLYSGSHDK-TVRVWDM-------NLGGKCINILKNHAHWVNHL 326

Query: 214 LLSSD--------------------------------VKH-------LATCSADKTARTW 234
            LS+D                                VK        + T S D T   W
Sbjct: 327 SLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLW 386

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
           +   + K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH   
Sbjct: 387 NPLKSNKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVSS 446

Query: 295 AICVA 299
              VA
Sbjct: 447 VYQVA 451

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+ +  VC  T+    + V+ ++      L   +  + VR++D+    
Sbjct: 251 LASASKDGTIKIWDTVRRVCVYTLSGHTNSVSCVKWGGQGVLYSGSHDKTVRVWDMNLGG 310

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN-EVV 123
              +   + H   V  LS   D        +    K+      + P   +  A  N E V
Sbjct: 311 -KCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKM------ASPEEAREKALKNYEKV 363

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
           +  N   +  +++   D  + +W+ L  N+   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 VKKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H + + ++  SSD + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFLSTFRGHVSSVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  +RLW
Sbjct: 477 -KLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMIRLW 513

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTG--VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L      +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPLARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFLSTFRGHVSSVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  IR+W
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMIRLW 513

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+   S+ +VT + D+  R+WD  T+  +    GH    +CV+
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVS 193

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 109/248 (43%), Gaps = 29/248 (11%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW-----DVRSPSVPRNYKHNAPV 119
           P  V  +EGH+  + ++   +D  W+ T+S+D T  VW       +     +   H++ V
Sbjct: 412 PIDVDMYEGHEDLLNAVDATEDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSV 471

Query: 120 NEVVIHPN------QGELISCDRDGNIRIWDL----GENQCTHQLTPEDNT------PLQ 163
             V + PN         L++   D  I+ W++     + +  H +   + T       + 
Sbjct: 472 TAVGL-PNVMLRHWPEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDIN 530

Query: 164 SLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLA 223
           +LSV+ + S+   A+      +W++      + L        H   +  +      K LA
Sbjct: 531 ALSVSPNDSVFATASYDKTSKIWDLETGELTATLA------NHKRGLWDVSFCQYDKLLA 584

Query: 224 TCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           TCS DKT + WSLD  F +  TL+GH   V  C F      LV++ +D  +++WD S+ E
Sbjct: 585 TCSGDKTIKIWSLD-TFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGE 643

Query: 284 IVRQYGGH 291
            V+   GH
Sbjct: 644 CVKTLDGH 651

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 91/196 (46%), Gaps = 16/196 (8%)

Query: 4   ILVSAGYDHTIRFW------EALTGV-----CSRTIQHSDSQVNRLEIT-NDKKLLGAAG 51
            L++A  D TI+ W      + + G+        T +  +  +N L ++ ND     A+ 
Sbjct: 487 FLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASY 546

Query: 52  HQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPR 111
            +  +++D+ T      AT   HK  +  +SF Q ++ + T S D TIK+W + + SV R
Sbjct: 547 DKTSKIWDLETGELT--ATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVR 604

Query: 112 NYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             + H   V        Q +L+S   DG I+IWD    +C   L    N  + +L++  D
Sbjct: 605 TLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANR-IWALTIQRD 663

Query: 171 GSMLVAANSKGNCYVW 186
           G ++ +A++ G    W
Sbjct: 664 GELIASADADGVFQFW 679

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/263 (21%), Positives = 93/263 (35%), Gaps = 28/263 (10%)

Query: 35  VNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSFQQDN---- 87
           +N ++ T D   L  A      +   YD  T    P A F GH  +VT++          
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHW 484

Query: 88  -RWMVTSSEDGTIKVWDVRSPSVPRN------------YKHNAPVNEVVIHPNQGELISC 134
             +++T+S D TIK W++  PS                  H   +N + + PN     + 
Sbjct: 485 PEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATA 544

Query: 135 DRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDA 194
             D   +IWDL   + T  L       L  +S      +L   +      +W +      
Sbjct: 545 SYDKTSKIWDLETGELTATLA-NHKRGLWDVSFCQYDKLLATCSGDKTIKIWSL------ 597

Query: 195 SNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVW 254
                V   + H+N + R    +    L +  AD   + W      +   TLDGH   +W
Sbjct: 598 DTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSG-ECVKTLDGHANRIW 656

Query: 255 DCAFSADSAYLVTASSDHYVRLW 277
                 D   + +A +D   + W
Sbjct: 657 ALTIQRDGELIASADADGVFQFW 679

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 17/148 (11%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L ++    DG  L  A+      VW   + T  +  KP  KF  HS+ +T + L + +  
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDET--AKFKPYAKFIGHSSSVTAVGLPNVMLR 482

Query: 220 ---KHLATCSADKTARTWSL---DDNFK-------LESTLDGHQRWVWDCAFSADSAYLV 266
              + L T S D T + W++    D  +        E T   H++ +   + S + +   
Sbjct: 483 HWPEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 267 TASSDHYVRLWDLSTREIVRQYGGHHKG 294
           TAS D   ++WDL T E+      H +G
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRG 570

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 62/138 (44%), Gaps = 18/138 (13%)

Query: 26  RTIQHSDSQ-VNRLEITNDKKLLGAAGH-QNVRLYDIRTTNPNPVATFEGHKGNVTSLSF 83
           +TI + D Q +  L++T D K L      Q +++ ++ T               ++S S+
Sbjct: 83  QTISNEDEQEITALKLTADGKYLCFTSQAQLLKIVEVATGKVM-------RSMKISSPSY 135

Query: 84  QQDNR----WMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI----HPNQGELISC 134
             D+      +     DG+I V D+ +  V  ++K H   ++ +      + N   L S 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 135 DRDGNIRIWDLGENQCTH 152
           D +G I++W+L   +CTH
Sbjct: 196 DTNGMIKVWNLVTRKCTH 213

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 76/344 (22%), Positives = 139/344 (40%), Gaps = 60/344 (17%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T+    + V  +  + D +++      N +RL++    
Sbjct: 158 MVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVAWSPDAEVIATGSMDNTIRLWN--GI 215

Query: 64  NPNPVA-TFEGHKGNVTSLSFQ--------QDNRWMVTSSEDGTIKVWDVRSPSVPRNYK 114
           N  P+  +  GH   +TSL+++        Q  R + ++S+DGTIKVWD           
Sbjct: 216 NGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPR-LASASKDGTIKVWDTTGRVCLYTLS 274

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QCTH--------------------Q 153
            +      V    Q  L +   D  IR+WD+  N +C +                    +
Sbjct: 275 GHTSSVSCVRWGGQNMLYTGSHDKTIRVWDMNSNGRCINILKSHAHWVNHLSLSTDYALR 334

Query: 154 LTPEDNTPLQSLSVASDG-------------------SMLVAANSKGNCYVWEMPNHTDA 194
           + P D++  +  ++A +                     ++V A+     ++W     T  
Sbjct: 335 IGPFDHSGAKP-AIAEEARDKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKST-- 391

Query: 195 SNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVW 254
              KP+ +   H   +  +  S D +H+ + S D + + W   D  K  ST  GH   V+
Sbjct: 392 ---KPLARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDGRDG-KFISTFRGHVASVY 447

Query: 255 DCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
             A+S+D   LV+ S D  +++WD+ T+++     GH      V
Sbjct: 448 QVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHQDEVFTV 491

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 118/278 (42%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    S V+ +       L   +  + +R++D+  +N
Sbjct: 250 LASASKDGTIKVWDTTGRVCLYTLSGHTSSVSCVRWGGQNMLYTGSHDKTIRVWDM-NSN 308

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN-EVV 123
              +   + H   V  LS   D    +   +    K      P++    +  A  N E +
Sbjct: 309 GRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAK------PAIAEEARDKALKNYEKI 362

Query: 124 IHPN---QGELISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
           +  N   +  +++   D  + +W+ L   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 363 VKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKL-VNHVAFSPDGRHIVSASF 421

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 422 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK 475

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VRLW
Sbjct: 476 -KLSVDLPGHQDEVFTVDWSVDGKRVCSGGKDKMVRLW 512

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEAL--TGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L  T   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 372 LMVTASDDFTMFLWNPLKSTKPLARMTGH-QKLVNHVAFSPDGRHIVSASFDNSIKLWDG 430

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 431 R--DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHQDEV 488

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 489 FTVDWSVDGKRVCSGGKDKMVRLW 512

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 13/147 (8%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSD 218
           +T L S    +  S +V         +W+    T      P+     HSN++  +  S D
Sbjct: 143 STILCSAFAPNSSSRMVTGAGDNTARLWDCDTQT------PMATLSGHSNWVLCVAWSPD 196

Query: 219 VKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSD 271
            + +AT S D T R W+  +   +  +L GH +W+   A+             L +AS D
Sbjct: 197 AEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASKD 256

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICV 298
             +++WD + R  +    GH     CV
Sbjct: 257 GTIKVWDTTGRVCLYTLSGHTSSVSCV 283

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLE------S 244
           +T + +++P     A +  IT  L SS +K     + D     ++    FK++      S
Sbjct: 77  YTFSCSIQPKKNEPAKTIDITDNLYSSLLKPGYNTTEDIITLIYTPRAVFKVKPVTRSSS 136

Query: 245 TLDGHQRWVWDCAFSADSA-YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
            + GH   +   AF+ +S+  +VT + D+  RLWD  T+  +    GH    +CVA
Sbjct: 137 AIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCDTQTPMATLSGHSNWVLCVA 192

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 107/252 (42%), Gaps = 36/252 (14%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV-----PRNYKHNAPV 119
           P  V  +EGH+  + SL   +D  W+ T S+D +  +W     +       +   H+A V
Sbjct: 371 PLDVEVYEGHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVETAKFFPYAKFTGHSASV 430

Query: 120 NEVVIHPN------QGELISCDRDGNIRIWD--------------LGENQCTHQLTPEDN 159
             V + PN         LI+   D  ++ W               + +++ T  +  +D 
Sbjct: 431 TAVAL-PNVMLRGWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVHAKD- 488

Query: 160 TPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV 219
             + +LS+A + S+   A+    C +W++      + L        H   +  +      
Sbjct: 489 --INALSLAPNDSLFATASYDKTCKIWDVETGESKATLA------GHKRGLWDVSFCQYD 540

Query: 220 KHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           K LAT S DKT + W+LD  F    TL+GH   V  CAF      LV++ +D  +++WD 
Sbjct: 541 KLLATSSGDKTIKIWNLD-TFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDC 599

Query: 280 STREIVRQYGGH 291
            T + ++   GH
Sbjct: 600 ITGDCLKTLDGH 611

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 94/246 (38%), Gaps = 30/246 (12%)

Query: 58  YDIRTTNPNPVATFEGHKGNVTSLSFQQDN-----RWMVTSSEDGTIKVWDVRSP----- 107
           +++ T    P A F GH  +VT+++           +++T+S D T+K W V  P     
Sbjct: 410 FNVETAKFFPYAKFTGHSASVTAVALPNVMLRGWPEFLITASNDLTVKRWKVPKPANEDI 469

Query: 108 --------SVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL--GENQCTHQLTPE 157
                   S    + H   +N + + PN     +   D   +IWD+  GE++ T      
Sbjct: 470 SDLLTIKQSEYTFHVHAKDINALSLAPNDSLFATASYDKTCKIWDVETGESKAT---LAG 526

Query: 158 DNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
               L  +S      +L  ++      +W +           V   + H+N + R    +
Sbjct: 527 HKRGLWDVSFCQYDKLLATSSGDKTIKIWNL------DTFSCVKTLEGHTNAVQRCAFMN 580

Query: 218 DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             K L +  AD   + W       L+ TLDGH   +W      D   +++A +D   + W
Sbjct: 581 KQKQLVSSGADGLIKIWDCITGDCLK-TLDGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

Query: 278 DLSTRE 283
              T E
Sbjct: 640 RDCTEE 645

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 73/184 (39%), Gaps = 45/184 (24%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +  +A YD T + W+  TG                                         
Sbjct: 500 LFATASYDKTCKIWDVETG----------------------------------------- 518

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEV 122
                AT  GHK  +  +SF Q ++ + TSS D TIK+W++ + S  +  + H   V   
Sbjct: 519 --ESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQRC 576

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
                Q +L+S   DG I+IWD     C   L    N  + +++V +DG ++++A++ G 
Sbjct: 577 AFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNR-IWAMNVCNDGDLIISADADGV 635

Query: 183 CYVW 186
              W
Sbjct: 636 FQFW 639

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 18/149 (12%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL    DG  L   +   +  +W    + + +   P  KF  HS  +T + L + +  
Sbjct: 384 LNSLDATEDGLWLATCSKDSSAILWRF--NVETAKFFPYAKFTGHSASVTAVALPNVMLR 441

Query: 220 ---KHLATCSADKTARTWSL-----DDNFKL------ESTLDGHQRWVWDCAFSADSAYL 265
              + L T S D T + W +     +D   L      E T   H + +   + + + +  
Sbjct: 442 GWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVHAKDINALSLAPNDSLF 501

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            TAS D   ++WD+ T E      GH +G
Sbjct: 502 ATASYDKTCKIWDVETGESKATLAGHKRG 530

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 80/194 (41%), Gaps = 31/194 (15%)

Query: 27  TIQHSDSQ-VNRLEITNDKKLLGAAGH-QNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQ 84
           TI++ D Q +  L +T D + L      Q ++++ + +               ++S S+ 
Sbjct: 54  TIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKIT-------RSMKISSPSYV 106

Query: 85  QDN----RWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGEL-------I 132
            D+      +     DG+I V DV +  +  ++K H   ++ +  H   GEL        
Sbjct: 107 MDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFH---GELNGDKWLLA 163

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS-DGSMLVAANSKG-----NCYVW 186
           S D +G  ++WDL + +C H +  E  + ++ L     +G   V   S G     N + +
Sbjct: 164 SGDTNGVAKVWDLVKRRCLHTM-QEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWEF 222

Query: 187 EMPNHTDASNLKPV 200
            M  H+      PV
Sbjct: 223 NMKKHSKLLKTVPV 236

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 114/254 (44%), Gaps = 21/254 (8%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T+P P+ T     +G + ++ S+    DNR + T+S +G++K+W+V++    R ++    
Sbjct: 375 TSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYA 433

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +    + P    +I   R+G ++++DL  +     +    +  + SL + SDG  LV  +
Sbjct: 434 LTCKFL-PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492

Query: 179 SKGNCYVWE-------MPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCS 226
           +      W+       +P   D     P+ K    +       I  + +S D ++LA   
Sbjct: 493 ADKTVKFWDFQVENTLVPGTKD--KFLPILKLNHDTTLELNDDILSLRISPDDRYLAISL 550

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
            D T + + LD + K   +L GH+  V     S DS  ++T+S+D  +++W L   +  +
Sbjct: 551 LDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609

Query: 287 QYGGHHKGAICVAL 300
               H    + V  
Sbjct: 610 SLFAHQDSIMSVKF 623

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 125/292 (42%), Gaps = 29/292 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C RT +   +   +        +LG    + ++L+D+ +++
Sbjct: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGE-LQLFDLASSS 463

Query: 65  PNPVATFE-GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSVP 110
              + T E  H   + SL    D + +VT S D T+K WD +              P + 
Sbjct: 464 L--LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILK 521

Query: 111 RNYKHNAPVNEVV----IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
            N+     +N+ +    I P+   L     D  ++++ L   +    L      P+ S+ 
Sbjct: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSID 580

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  M++ +++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 581 ISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCS 634

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 635 KDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 123/291 (42%), Gaps = 28/291 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q   + +  ++I++D +LL  A + ++++++++T     + TFE   G   +  F    
Sbjct: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 G-EN--------------QCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
             EN              +  H  T E N  + SL ++ D   L  +       V+ +  
Sbjct: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL-- 560

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                ++K       H   +  I +S D K + T SADK  + W LD       +L  HQ
Sbjct: 561 ----DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++   LE+  D  LL A G+ +  ++++D+ +     +  F GHK  +T L F      +
Sbjct: 80  AECTYLEVHQDTDLL-AVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRL 136

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148
           ++ S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   
Sbjct: 137 ISGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQ 194

Query: 149 QC 150
           QC
Sbjct: 195 QC 196

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 53  QNVRLYDIRTTN---------PNPVATFEGHK-GNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           +NV ++DI+T +         P   +   G K    T L   QD   +     DG IKVW
Sbjct: 47  ENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVW 106

Query: 103 DVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
           D+ S +V  N+  H A +  +        LIS  +D NI +WDL
Sbjct: 107 DLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTS 93
           V  ++I+ D K++  ++  +N++++ +   + +   +   H+ ++ S+ F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   + + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 40/204 (19%), Positives = 75/204 (36%), Gaps = 27/204 (13%)

Query: 90  MVTSSEDGTIKVWDVRSPSVPRNYKHNAP-------------VNEVVIHPNQGELISCDR 136
           ++TS+ +  + VWD+++  +        P                + +H +   L     
Sbjct: 41  LITSALE-NVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYA 99

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           DG I++WDL                +  L     G+ L++ +   N  VW++        
Sbjct: 100 DGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEV---- 154

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
              + K ++H + IT      +   L + S D   + W L    K +  ++ H     +C
Sbjct: 155 --GLYKLRSHKDSITGFWCQGE-DWLISTSKDGMIKLWDL----KTQQCIETHIAHTGEC 207

Query: 257 -AFSADSAYLVTASSDHYVRLWDL 279
              S     L+T  +D  V+LW L
Sbjct: 208 WGLSVKDDLLITTGTDSQVKLWKL 231

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 129/278 (46%), Gaps = 26/278 (9%)

Query: 19  ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRL-------YDIRTTNP---NPV 68
           +L  V   T  ++   +  LE +N+ KL  A+G Q+  +       Y +   +    NP+
Sbjct: 505 SLPSVSIYTFHNTQKNMTSLEFSNNYKL-AASGFQDSYIKIWSLDGYPLSENDEMPNNPI 563

Query: 69  A----TFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVV 123
           +    TF GH G V S SF   + +++++SED T+++W V+      +YK H  PV +V 
Sbjct: 564 SSTCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVE 623

Query: 124 IHPNQGELI-SCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
             P+   L  +   D   R+W          +    N  +  +S  S+G  +   +S   
Sbjct: 624 FSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLND-VDCVSFHSNGRYIFTGSSDKT 682

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKL 242
             +W++ N  D+  L     F  H++ +T + +S D K ++T S D     W +    KL
Sbjct: 683 VRMWDI-NTGDSVRL-----FMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKL 736

Query: 243 ESTLDGHQRW-VWDCAFSADSAYLVTASSDHYVRLWDL 279
           ++ + GH +  +   +++ +   LV+  +D  VR+WDL
Sbjct: 737 KN-MRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (48%), Gaps = 5/158 (3%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLGAAGHQNVRLYDIRT 62
           +  +A  D T R W        R +    + V+ +   +N + +   +  + VR++DI T
Sbjct: 631 LFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINT 690

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVN 120
            +   V  F GH   VTSLS   D +W+ T S+DG I +WD+ S    +N +    + ++
Sbjct: 691 GDS--VRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIH 748

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
            +  +P    L+S   D ++R+WDL +      LTPE+
Sbjct: 749 SLSYNPEGTLLVSGGADQSVRVWDLNKGTFEPSLTPEE 786

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 91/198 (45%), Gaps = 5/198 (2%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITN--DKKLLGAAGHQNVRLYDIRT 62
           L+SA  D T+R W         + +  +  V  +E +   +     A+  Q  RL+    
Sbjct: 589 LLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDR 648

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
             P  +    GH  +V  +SF  + R++ T S D T+++WD+ +    R +  HN+ V  
Sbjct: 649 VYP--LRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTS 706

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG 181
           + + P+   + +   DG I IWD+G  +    +     + + SLS   +G++LV+  +  
Sbjct: 707 LSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQ 766

Query: 182 NCYVWEMPNHTDASNLKP 199
           +  VW++   T   +L P
Sbjct: 767 SVRVWDLNKGTFEPSLTP 784

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 101/234 (43%), Gaps = 36/234 (15%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 127
           + TF   + N+TSL F  + +   +  +D  IK+W +             P++E    PN
Sbjct: 511 IYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSL----------DGYPLSENDEMPN 560

Query: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE 187
                +C            +    H  T      + S S ++    L++A+      +W 
Sbjct: 561 NPISSTC------------KTFIGHSGT------VYSTSFSAGDEYLLSASEDKTVRLWS 602

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL-ATCSADKTARTWSLDDNFKLESTL 246
           + +       KP+  +K H   +  +  S    +L AT S D+TAR WS D  + L   +
Sbjct: 603 VQDD------KPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLR-VM 655

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            GH   V   +F ++  Y+ T SSD  VR+WD++T + VR + GH+     +++
Sbjct: 656 AGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSV 709

>NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa]
           {ON} Anc_7.231
          Length = 608

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 127/294 (43%), Gaps = 20/294 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L +  YD T+  W+  +    R +      V  L   ++ KL+  +  + +R+++ +T 
Sbjct: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323

Query: 64  NPNPVATFEGHKGNVTSL-SFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
               ++T+ GH  +V S+ +F+   + +V+ S D T+K+W V S +      H   VN V
Sbjct: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDNTPLQSLSVASDGSMLVAA 177
            +HP      S   D  IR+WD+  N C      H    +   PL  +    D   LV  
Sbjct: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII----DAENLVVD 434

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVK-HLATCSADKTARTWSL 236
           N  G+    + P  T         +   +      +  S     HL +CS D T + W +
Sbjct: 435 NISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290
                + +   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 495 QTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 88/225 (39%), Gaps = 58/225 (25%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           V  F+GH   V +L F  + R + T S D T+ +WD+ S  + R    H   V    ++ 
Sbjct: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           ++ +L++   D  IR+W+    +C                                  + 
Sbjct: 302 DEAKLVTGSLDKTIRVWNYKTGEC----------------------------------IS 327

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
               HTD+  +  V  FK       +I++S         SADKT + W ++   +   TL
Sbjct: 328 TYRGHTDS--VMSVDAFK-------KIIVSG--------SADKTVKIWHVES--RTCYTL 368

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 47/119 (39%), Gaps = 20/119 (16%)

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
           KGNC V E   H D                   + L  + + L T S D T   W L  N
Sbjct: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
            KL   L GH   V    F  D A LVT S D  +R+W+  T E +  Y GH    + V
Sbjct: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295
            +L++ S D+ ++LWD+ T + +R   GH +G 
Sbjct: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 140/299 (46%), Gaps = 26/299 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+  R W+  T     T++   + V  +  + D +++      N +RL+D +T 
Sbjct: 186 MVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSADGEVIATGSMDNTIRLWDAQTG 245

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWD-VRSPSVPRNYKH 115
           +    A   GH   +TS+S++        +   + ++S+DGTIKVWD VR   +     H
Sbjct: 246 DSKGDA-LRGHSKWITSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGH 304

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSLSVASDGSML 174
            + V+  +    QG + +   D  IR WD+    +C + L    +  +  LS+++D ++ 
Sbjct: 305 TSSVS-CIKWGGQGVIYTGSHDRTIRCWDMNAGGKCINILKSHAHW-VNHLSLSTDYALK 362

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFK--AHSNYITRILLSSDVKHLATCSADKTAR 232
           V A      + +  P   + +  + +  ++  A  N +   L+       AT S D T  
Sbjct: 363 VGAFD----HTYSRPATAEEAQKRALKNYEKVAKRNGVLEELI-------ATASDDFTMY 411

Query: 233 TWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
            W+     K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LW+ S+ + +  + GH
Sbjct: 412 LWNPLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGH 470

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 119/280 (42%), Gaps = 24/280 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           + SA  D TI+ W+ +   C  T+    S V+ ++      +   +  + +R +D+    
Sbjct: 278 IASASKDGTIKVWDTVRRQCILTLSGHTSSVSCIKWGGQGVIYTGSHDRTIRCWDMNAGG 337

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMV-----TSSEDGTIKVWDVRSPSVPRNYKHNAPV 119
              +   + H   V  LS   D    V     T S   T +    R+    +NY+  A  
Sbjct: 338 -KCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAEEAQKRAL---KNYEKVAKR 393

Query: 120 NEVVIHPNQGELI-SCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAA 177
           N V+      ELI +   D  + +W+ L   +   ++T      +  ++ + DG  +V+A
Sbjct: 394 NGVL-----EELIATASDDFTMYLWNPLKGTKPLTRMTGHQKL-VNHVAFSPDGRYIVSA 447

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
           +   +  +WE       S+ K ++ F+ H   + ++  SSD + L +CS D T + W + 
Sbjct: 448 SFDNSIKLWE------GSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 501

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
              KL   L GH   V+   +SAD   + +   D  VRLW
Sbjct: 502 TR-KLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGV--CSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++ +A  D T+  W  L G    +R   H    VN +  + D + + +A   N ++L++ 
Sbjct: 400 LIATASDDFTMYLWNPLKGTKPLTRMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWE- 457

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
             ++   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   HN  V
Sbjct: 458 -GSSGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLAVDLPGHNDEV 516

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +R+W
Sbjct: 517 YTVDWSADGKSVCSGGKDKMVRLW 540

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V  +   N  +W+    T      P+   K H+N++  +  S+D + +AT S D T 
Sbjct: 184 SRMVTGSGDNNARIWDCDTQT------PIYTLKGHTNWVLCVAWSADGEVIATGSMDNTI 237

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVT---------ASSDHYVRLWDLSTR 282
           R W           L GH +W+   + S +  +LVT         AS D  +++WD   R
Sbjct: 238 RLWDAQTGDSKGDALRGHSKWI--TSMSWEPIHLVTPGNKPRIASASKDGTIKVWDTVRR 295

Query: 283 EIVRQYGGHHKGAICV 298
           + +    GH     C+
Sbjct: 296 QCILTLSGHTSSVSCI 311

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 95/239 (39%), Gaps = 22/239 (9%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRLYDIR 61
           ++ +  +D TIR W+    G C   ++     VN L ++ D  L +GA  H   R     
Sbjct: 318 VIYTGSHDRTIRCWDMNAGGKCINILKSHAHWVNHLSLSTDYALKVGAFDHTYSRPATAE 377

Query: 62  TTNPNPVATFEG---HKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVP--RNYKHN 116
                 +  +E      G +  L        + T+S+D T+ +W+    + P  R   H 
Sbjct: 378 EAQKRALKNYEKVAKRNGVLEEL--------IATASDDFTMYLWNPLKGTKPLTRMTGHQ 429

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVA 176
             VN V   P+   ++S   D +I++W+    +          +  Q ++ +SD  +LV+
Sbjct: 430 KLVNHVAFSPDGRYIVSASFDNSIKLWEGSSGKFISTFRGHVASVYQ-VAWSSDCRLLVS 488

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWS 235
            +      VW      D    K       H++ +  +  S+D K + +   DK  R W+
Sbjct: 489 CSKDTTLKVW------DVRTRKLAVDLPGHNDEVYTVDWSADGKSVCSGGKDKMVRLWT 541

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +    F+   S+ +VT S D+  R+WD  T+  +    GH    +CVA
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVA 220

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 115/244 (47%), Gaps = 33/244 (13%)

Query: 67  PVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-PSVPRNYKHNAPVNEVVIH 125
           PV +F+GH   +   +   D ++ +++S D T+++WD+ S  S+ R   H + V  V I 
Sbjct: 57  PVKSFKGHSHIIQDCTVTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSID 116

Query: 126 PNQGELISCDRDGNIRIWD---------LGENQ-CTH-QLTPEDNTPLQSLSVASDGSML 174
               +++S  RD  +++W+         LG N   +H ++ P+DN        A D   +
Sbjct: 117 AGATQIVSASRDKTVKVWNTVGECVVTLLGHNDWVSHVRIAPKDN--------ADDPVTV 168

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW 234
           ++A       VW++ + T  ++      F  H+NY+  +  S D    A+   D     W
Sbjct: 169 ISAGMDKVVKVWDLQSFTIEAD------FIGHNNYVNTVTPSPDGSIFASAGKDGQIMLW 222

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR----EIVRQYGG 290
           +L+    L S LD     V+  AFS +  Y +TA++   ++++DL  R    ++  ++ G
Sbjct: 223 NLNAKIALYS-LDAKDE-VFAVAFSPNR-YWLTAATASGIKIFDLEQRLPVDDLKPEFAG 279

Query: 291 HHKG 294
           + K 
Sbjct: 280 YAKA 283

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 126/296 (42%), Gaps = 29/296 (9%)

Query: 4   ILVSAGYDHTIRFW-----EALTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRL 57
           +L+SA  D T+  W     +   GV  ++ +     +    +TND K  L A+  + +RL
Sbjct: 32  MLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHIIQDCTVTNDGKYALSASWDKTLRL 91

Query: 58  YDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNA 117
           +D+   +   +  F GHK +V S+S       +V++S D T+KVW+     V     HN 
Sbjct: 92  WDL--ASGESLIRFVGHKSDVMSVSIDAGATQIVSASRDKTVKVWNTVGECVVTLLGHND 149

Query: 118 PVNEVVIHPNQGE-----LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGS 172
            V+ V I P         +IS   D  +++WDL            +N  + +++ + DGS
Sbjct: 150 WVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQSFTIEADFIGHNNY-VNTVTPSPDGS 208

Query: 173 MLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT-- 230
           +  +A   G   +W +       +L    +  A +    R  L++     AT S  K   
Sbjct: 209 IFASAGKDGQIMLWNLNAKIALYSLDAKDEVFAVAFSPNRYWLTA-----ATASGIKIFD 263

Query: 231 -ARTWSLDDNFKLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
             +   +DD   L+    G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 264 LEQRLPVDD---LKPEFAGYAKAQEPHAISLAWSADGQTLFAGYTDNVIRVWQVMT 316

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 102/227 (44%), Gaps = 23/227 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVWDV----RSPSVP-RNYKHNAPVNE 121
            T EGH G VTSL  S  Q N  ++++S D T+  W +    +   VP +++K ++ + +
Sbjct: 11  GTLEGHNGWVTSLATSPAQPNM-LLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHIIQ 69

Query: 122 VVIHPNQGEL-ISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
                N G+  +S   D  +R+WDL   +   +      + + S+S+ +  + +V+A+  
Sbjct: 70  DCTVTNDGKYALSASWDKTLRLWDLASGESLIRFVGH-KSDVMSVSIDAGATQIVSASRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS-----DVKHLATCSADKTARTWS 235
               VW             V     H+++++ + ++      D   + +   DK  + W 
Sbjct: 129 KTVKVWNTVGEC-------VVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWD 181

Query: 236 LDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           L  +F +E+   GH  +V     S D +   +A  D  + LW+L+ +
Sbjct: 182 LQ-SFTIEADFIGHNNYVNTVTPSPDGSIFASAGKDGQIMLWNLNAK 227

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLS-SDVKHLATCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S +    L + S DKT  TW L   D  + +   +  GH   + DC 
Sbjct: 13  LEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHIIQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            + D  Y ++AS D  +RLWDL++ E + ++ GH    + V+++
Sbjct: 73  VTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSID 116

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 82/195 (42%), Gaps = 32/195 (16%)

Query: 115 HNAPVNEVVIHPNQ-GELISCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +   P Q   L+S  RD  +  W L GE+Q       +   P++S        
Sbjct: 16  HNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQ-------QYGVPVKSFKGHSHII 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              +V +DG   ++A+      +W++ +       + + +F  H + +  + + +    +
Sbjct: 69  QDCTVTNDGKYALSASWDKTLRLWDLASG------ESLIRFVGHKSDVMSVSIDAGATQI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA-----DSAYLVTASSDHYVRLW 277
            + S DKT + W+      +  TL GH  WV     +      D   +++A  D  V++W
Sbjct: 123 VSASRDKTVKVWNTVGECVV--TLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVW 180

Query: 278 DLSTREIVRQYGGHH 292
           DL +  I   + GH+
Sbjct: 181 DLQSFTIEADFIGHN 195

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 70/193 (36%), Gaps = 51/193 (26%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           V ++SAG D  ++ W+    + S TI+                                 
Sbjct: 166 VTVISAGMDKVVKVWD----LQSFTIE--------------------------------- 188

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
                 A F GH   V +++   D     ++ +DG I +W++ +     +      V  V
Sbjct: 189 ------ADFIGHNNYVNTVTPSPDGSIFASAGKDGQIMLWNLNAKIALYSLDAKDEVFAV 242

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQ-------SLSVASDGSMLV 175
              PN+  L +    G I+I+DL +      L PE     +       SL+ ++DG  L 
Sbjct: 243 AFSPNRYWLTAATASG-IKIFDLEQRLPVDDLKPEFAGYAKAQEPHAISLAWSADGQTLF 301

Query: 176 AANSKGNCYVWEM 188
           A  +     VW++
Sbjct: 302 AGYTDNVIRVWQV 314

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 109/261 (41%), Gaps = 44/261 (16%)

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           + T P  V  +EGH   + SL    D  W+ T+S+D ++ +W   +      Y+   P  
Sbjct: 376 KETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHA-----KYEDFYPYT 430

Query: 121 EVVIH---------PNQGE------LISCDRDGNIRIWDLGENQCTHQLTPED------- 158
           + V H         PN         +I+   D  I+ W + +        PED       
Sbjct: 431 KFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDE---PEDLILVKTS 487

Query: 159 -------NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYIT 211
                     + ++S++ + S+   A+    C +W + +    + L        H   + 
Sbjct: 488 EYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLA------NHKRGLW 541

Query: 212 RILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSD 271
            +      K LATCS DKT + WSL+ ++ +  TL+GH   V  C+F   +  L++  +D
Sbjct: 542 DVAFCQYDKLLATCSGDKTIKIWSLE-SYAVVKTLEGHTNAVQRCSFINKNKQLISTGAD 600

Query: 272 HYVRLWDLSTREIVRQYGGHH 292
             V +WDLST E V+    H+
Sbjct: 601 GLVIIWDLSTGESVKTLDAHN 621

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 86/233 (36%), Gaps = 34/233 (14%)

Query: 67  PVATFEGHKGNVTSLSFQQDN-----RWMVTSSEDGTIKVWDVRSPSV----PRNY---- 113
           P   F GH G+V ++            +++T+S D TIK W V  P V    P +     
Sbjct: 428 PYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKV--PKVTSDEPEDLILVK 485

Query: 114 -------KHNAPVNEVVIHPNQGELISCDRDGNIRIWDL--GENQCTHQLTPEDNTPLQS 164
                   H   +N + I PN     +   D   +IW+L  GE Q T          L  
Sbjct: 486 TSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQAT---LANHKRGLWD 542

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLAT 224
           ++      +L   +      +W + ++        V   + H+N + R    +  K L +
Sbjct: 543 VAFCQYDKLLATCSGDKTIKIWSLESYA------VVKTLEGHTNAVQRCSFINKNKQLIS 596

Query: 225 CSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             AD     W L     ++ TLD H   +W  A   D    VTA +D +   W
Sbjct: 597 TGADGLVIIWDLSTGESVK-TLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTI-QHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           +  +A YD T + W    G    T+  H     +      DK L   +G + ++++ + +
Sbjct: 509 LFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLES 568

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-PSVPRNYKHNAPVNE 121
                V T EGH   V   SF   N+ ++++  DG + +WD+ +  SV     HN  +  
Sbjct: 569 YAV--VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWA 626

Query: 122 VVIHPNQGELISCDRDGNIRIW 143
           + +  +    ++ D DG    W
Sbjct: 627 LAVMNDGESFVTADADGFFEFW 648

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 18/155 (11%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV-- 219
           L SL   +DG  +  A+   +  +W    H    +  P TKF  H   +  + L + +  
Sbjct: 393 LNSLDATADGLWVATASKDHSVILWRY--HAKYEDFYPYTKFVGHVGSVNAVGLPNVMPR 450

Query: 220 ---KHLATCSADKTARTWSL-----DDNFKL------ESTLDGHQRWVWDCAFSADSAYL 265
              + + T S D T + W +     D+   L      E T   H++ +   + S + +  
Sbjct: 451 SWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLF 510

Query: 266 VTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
            TAS D   ++W+L   E       H +G   VA 
Sbjct: 511 ATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAF 545

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 115/254 (45%), Gaps = 21/254 (8%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T+P P+ T     +G + +V S+    DN+ + T+S +G++K+W+V++    R ++    
Sbjct: 375 TSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA 433

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           ++   + P    +I   R G ++++DL  +     +    +  + SL + SDG  LV  +
Sbjct: 434 LSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGS 492

Query: 179 SKGNCYVWE-------MPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCS 226
           +      W+       +P   D   L P+ K    +       I  + +S D ++LA   
Sbjct: 493 ADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
            D T + + LD + K   +L GH+  V     S DS  ++T+S+D  +++W L   +  +
Sbjct: 551 LDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609

Query: 287 QYGGHHKGAICVAL 300
               H    + V  
Sbjct: 610 SLFAHQDSIMSVKF 623

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 124/291 (42%), Gaps = 27/291 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C RT +   +   +        +LG    + ++L+D+ +++
Sbjct: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGE-LQLFDLASSS 463

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSVPR 111
                  + H   + SL    D + +VT S D T+K WD +              P +  
Sbjct: 464 LLDTVE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522

Query: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSV 167
           N+     +N+    V I P+   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDI 581

Query: 168 ASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSA 227
           + D  M++ +++  N  +W + +  D           AH + I  +    +  +  +CS 
Sbjct: 582 SFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCSK 635

Query: 228 DKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
           D   + W   + F+    L  HQ  VW  A +++ +++V++S DH +R+W+
Sbjct: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 121/290 (41%), Gaps = 28/290 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q   + V  ++I++D KLL  A + ++++++++T     + TFE   G   S  F    
Sbjct: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 G-EN--------------QCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
             EN              +  H  T E N  + S+ ++ D   L  +       V+ +  
Sbjct: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                ++K       H   +  I +S D K + T SADK  + W LD       +L  HQ
Sbjct: 561 ----DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 92/218 (42%), Gaps = 25/218 (11%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++   LE+  D  LL A G+ +  ++++D+ +     +  F GHK  +T L F      +
Sbjct: 80  AECTYLEVHEDTDLL-AVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRL 136

Query: 91  VTSSEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147
           ++ S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL  
Sbjct: 137 ISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKT 193

Query: 148 NQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE--MPNHTDASNLKPVTKFKA 205
            QC             SLSV  D  +L+   +     +W+  M N      L  V  F+ 
Sbjct: 194 QQCIETHIAHTG-ECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEK 250

Query: 206 HSN-------YITRILLSSDVKHLATCSADKTARTWSL 236
            S        +IT    S  V      +ADKT  T+ +
Sbjct: 251 QSKQRGLKVEFITNA--SDGVSFFYIQNADKTIETFRI 286

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTS 93
           V  ++I+ D K++  ++  +N++++ +   + +   +   H+ ++ S+ F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   + + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/204 (20%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 90  MVTSSEDGTIKVWDVRS-----------PSVPRNYKHNAPVN--EVVIHPNQGELISCDR 136
           ++TS+ +  + +WD+++           P    + + + P     + +H +   L     
Sbjct: 41  LITSALEN-VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYA 99

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           DG I++WDL                +  L   S G+ L++ +   N  VW++        
Sbjct: 100 DGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEV---- 154

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
              + K ++H + IT I    +   L + S D   + W L    K +  ++ H     +C
Sbjct: 155 --GLYKLRSHKDCITGIWCQGE-DWLISTSKDGMIKLWDL----KTQQCIETHIAHTGEC 207

Query: 257 -AFSADSAYLVTASSDHYVRLWDL 279
            + S     L+T  +D  V++W L
Sbjct: 208 WSLSVKDDLLITTGTDSQVKIWKL 231

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 125/298 (41%), Gaps = 55/298 (18%)

Query: 45  KLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P  +AT EGH   V  +S+  D   + T S D TI++W+ 
Sbjct: 154 RMVTGAGDNTARIWDCDTQTP--LATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWES 211

Query: 105 -----------RSPSVPRNYKHNAPVNEVVIH--PNQGE--LISCDRDGNIRIWDLGENQ 149
                       S ++  + K    ++   +H  P+  +  L S  +DG I+IWD     
Sbjct: 212 TKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRV 271

Query: 150 CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEM------------PNHT----- 192
           C + L+   N+ +  +    +G +L + +      VW+M             NH      
Sbjct: 272 CLYTLSGHSNS-VACVKWGGEG-LLYSGSHDKTVRVWDMNSATVGKCISILKNHAHWVNH 329

Query: 193 --------------DASNLKPVT----KFKAHSNYITRILLSSDVKHL-ATCSADKTART 233
                         D + +KP T    K +A +NY      +   + L  T S D T   
Sbjct: 330 LSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFL 389

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           W+     K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 390 WNPKKLTKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGH 447

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 142/350 (40%), Gaps = 64/350 (18%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +  + D +++      + +RL++  +T
Sbjct: 155 MVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVSWSPDGEVIATGSMDSTIRLWE--ST 212

Query: 64  NPNPV-------ATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSV 109
              PV       +  +GH   +TSLS++            + ++S+DGTIK+WD      
Sbjct: 213 KGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWDTARRVC 272

Query: 110 PRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGE---NQCTH-------------- 152
                 ++     V    +G L S   D  +R+WD+      +C                
Sbjct: 273 LYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSATVGKCISILKNHAHWVNHLSL 332

Query: 153 ------QLTPEDNTPLQSLSVAS---------------DGS---MLVAANSKGNCYVWEM 188
                 ++ P D+T ++  + A                +GS   ++V A+     ++W  
Sbjct: 333 STDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNP 392

Query: 189 PNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDG 248
              T     KP+ +   H   +  +  S D +++ + S D + + W   D  K  ST  G
Sbjct: 393 KKLT-----KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-KFLSTFRG 446

Query: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICV 298
           H   V+  A+S+D   LV+ S D  +++WD+ TR++     GH      V
Sbjct: 447 HVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEVFTV 496

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 114/278 (41%), Gaps = 18/278 (6%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT-T 63
           L SA  D TI+ W+    VC  T+    + V  ++   +  L   +  + VR++D+ + T
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSAT 312

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVV 123
               ++  + H   V  LS   D    +   +   +K      PS P   K  A  N   
Sbjct: 313 VGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVK------PSTPAEAKRRAQANYDK 366

Query: 124 IHPNQGE----LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
           +    G     +++   D  + +W+  +              +  ++ + DG  +V+A+ 
Sbjct: 367 VAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPDGRYIVSASF 426

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 427 DNSIKLW------DGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTR 480

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GHQ  V+   +S D   + +   D  VR+W
Sbjct: 481 -KLSVDLPGHQDEVFTVDWSVDGKRVCSGGKDKMVRIW 517

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFW--EALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  + LT   +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 377 LMVTASDDFTMFLWNPKKLTKPLARMTGH-QKLVNHVAFSPDGRYIVSASFDNSIKLWDG 435

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 436 R--DGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEV 493

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 494 FTVDWSVDGKRVCSGGKDKMVRIW 517

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 19/140 (13%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+    T      P+   + HSN++  +  S D + +AT S D T 
Sbjct: 153 SRMVTGAGDNTARIWDCDTQT------PLATLEGHSNWVLCVSWSPDGEVIATGSMDSTI 206

Query: 232 RTWSLDDNFKL------ESTLDGHQRWVWDCAFSA-----DSAY--LVTASSDHYVRLWD 278
           R W       +       S L GH +W+   ++       D A   L +AS D  +++WD
Sbjct: 207 RLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPRLASASKDGTIKIWD 266

Query: 279 LSTREIVRQYGGHHKGAICV 298
            + R  +    GH     CV
Sbjct: 267 TARRVCLYTLSGHSNSVACV 286

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSAD-SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+ D S+ +VT + D+  R+WD  T+  +    GH    +CV+
Sbjct: 133 SAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCDTQTPLATLEGHSNWVLCVS 189

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 108/232 (46%), Gaps = 21/232 (9%)

Query: 64  NPNPVATF----EGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPV 119
           NP+P   +    +GH+ ++ S+    DN+ ++ S+ +G +K+W++++ S  R +     +
Sbjct: 372 NPSPSKLYTIEQKGHRTDIRSIDISDDNK-LLASASNGLLKIWNLKTKSCIRTFDCGYAL 430

Query: 120 NEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               + P+    +   R+G I+++DL  +     +    N  + SL +  DG  LV  ++
Sbjct: 431 TCKFL-PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSA 489

Query: 180 KGNCYVWE-------MPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCSA 227
             +   W        +P  TD     PV K    +       I  + +S + K+LA    
Sbjct: 490 DKSIKFWNFSIEQDLVPGTTD--KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLL 547

Query: 228 DKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           D T + + LD + K   +L GH+  V     S DS  ++T+S+D  +++W L
Sbjct: 548 DNTVKVFFLD-SMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/291 (20%), Positives = 121/291 (41%), Gaps = 29/291 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L+++  +  ++ W   T  C RT     +   +   +    ++G    Q ++L+D+ T+ 
Sbjct: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQ-IQLFDLVTST 459

Query: 65  PNPVATFE-GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD--VRSPSVPRNYKHNAPVNE 121
              + + +  H   + SL   QD + +VT S D +IK W+  +    VP       PV +
Sbjct: 460 L--IESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMK 517

Query: 122 VV---------------IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
           ++               I P    L     D  ++++ L   +    L      P+ S+ 
Sbjct: 518 LIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSID 576

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  +++ +++  N  +W + +  D           AH + I  +    +  +  + S
Sbjct: 577 ISFDSKLIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMNVCFLPESHNFFSSS 630

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            D   + W   D F+    L  HQ  VW  A ++D + +V++S DH +R+W
Sbjct: 631 KDGLVKYWD-GDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 76/161 (47%), Gaps = 14/161 (8%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++V  LE  ++  LL AAG+ +  ++++D+ +     + +F GHK  VT L F      +
Sbjct: 78  AEVTYLEYHDETNLL-AAGYADGVIKIWDLMS--KTVLLSFSGHKSGVTILKFDSTGTRL 134

Query: 91  VTSSEDGTIKVWDVRSP-SVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147
           ++ S D  I +WD+ S   V +   H   +  +     +GE  L+S  +DG I++WDL  
Sbjct: 135 MSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC---EGEDWLVSTAKDGLIKLWDLKT 191

Query: 148 NQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEM 188
            QC      +     +  ++   G ++V   +     +W +
Sbjct: 192 QQCVETHIAQTG---ECWALGVHGDLVVTTGTDSQIKIWNL 229

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 11/104 (10%)

Query: 53  QNVRLYDIRTTN----------PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           +N+ L+DI+T            P  +         VT L +  +   +     DG IK+W
Sbjct: 45  ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104

Query: 103 DVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
           D+ S +V  ++  H + V  +        L+S  RD +I IWDL
Sbjct: 105 DLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 77  NVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRN-YKHNAPVNEVVIHPNQGELISCD 135
           ++ S+    +++++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 529 DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSS 588

Query: 136 RDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS 195
            D NI+IW L    C   L    ++ + ++    +     +++  G    W      D  
Sbjct: 589 ADKNIKIWGLDFGDCHKSLFAHQDS-IMNVCFLPESHNFFSSSKDGLVKYW------DGD 641

Query: 196 NLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             + V K  AH + +  + ++SD   + + S D + R W   D+
Sbjct: 642 KFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDD 685

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 123/295 (41%), Gaps = 57/295 (19%)

Query: 45  KLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
           +++  AG    R++D  T  P   AT  GH   V  +S+  +   + T S D TI++WD 
Sbjct: 158 RMVTGAGDNTARIWDCDTQTPK--ATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDS 215

Query: 105 R--SPSVPRNYKHNAPVNEVVIHP----NQGE---LISCDRDGNIRIWDLGENQCTHQLT 155
           +   P       H   +  +   P      GE   L S  +DG IRIWD+    C + ++
Sbjct: 216 KDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMS 275

Query: 156 PEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILL 215
              N+ +  +  +  G +   ++ K    VW+M      ++ K +   K+H++++  + L
Sbjct: 276 GHTNS-VSCIKWSGQGIIYSGSHDK-TVRVWDM-----NADGKCINILKSHAHWVNHLSL 328

Query: 216 SSD--------------------------------VKH-------LATCSADKTARTWSL 236
           S+D                                VK        + T S D T   W+ 
Sbjct: 329 STDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNP 388

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
             + K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LWD    + +  + GH
Sbjct: 389 LKSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGH 443

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 127/303 (41%), Gaps = 32/303 (10%)

Query: 4   ILVSAGYDHTIRFW---------EALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN 54
           ++ +   D+TIR W         +AL G        +   ++ ++     +L  A+    
Sbjct: 200 VIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGT 259

Query: 55  VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK 114
           +R++DI  T    + T  GH  +V+ + +      + + S D T++VWD+ +        
Sbjct: 260 IRIWDI--TRRVCLYTMSGHTNSVSCIKWSGQGI-IYSGSHDKTVRVWDMNA-------- 308

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDL---GENQCTHQLTPEDNTPLQSLSVASDG 171
               +N +  H +    +S   D  +R+      G    + +   +         V  +G
Sbjct: 309 DGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKKNG 368

Query: 172 S---MLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSAD 228
               ++V A+     ++W  P  ++    KP+ +   H   +  +  S D +++ + S D
Sbjct: 369 KLEELMVTASDDFTMFLWN-PLKSN----KPIARMTGHQKLVNHVAFSPDGRYIVSASFD 423

Query: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
            + + W   D  K  ST  GH   V+  A+SAD   LV+ S D  +++WD+ TR++    
Sbjct: 424 NSIKLWDGRDG-KFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDL 482

Query: 289 GGH 291
            GH
Sbjct: 483 PGH 485

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 120/278 (43%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TIR W+    VC  T+    + V+ ++ +    +   +  + VR++D+   +
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDM-NAD 309

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   V  LS   D    V + +    +      P+  ++ +  A  N   +
Sbjct: 310 GKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQ------PASAKDARDKALANYEKV 363

Query: 125 HPNQGEL----ISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G+L    ++   D  + +W+ L  N+   ++T      +  ++ + DG  +V+A+ 
Sbjct: 364 VKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKL-VNHVAFSPDGRYIVSASF 422

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  + K ++ F+ H   + ++  S+D + L +CS D T + W +   
Sbjct: 423 DNSIKLW------DGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTR 476

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +   D  VR+W
Sbjct: 477 -KLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 72/144 (50%), Gaps = 7/144 (4%)

Query: 4   ILVSAGYDHTIRFWEALTG--VCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDI 60
           ++V+A  D T+  W  L      +R   H    VN +  + D + + +A   N ++L+D 
Sbjct: 373 LMVTASDDFTMFLWNPLKSNKPIARMTGHQ-KLVNHVAFSPDGRYIVSASFDNSIKLWDG 431

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPV 119
           R  +   ++TF GH  +V  +++  D R +V+ S+D T+KVWDVR+  +  +   H   V
Sbjct: 432 R--DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEV 489

Query: 120 NEVVIHPNQGELISCDRDGNIRIW 143
             V    +   + S  +D  +RIW
Sbjct: 490 YTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 13/147 (8%)

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSD 218
           +T L S    +  S +V         +W+    T      P      H N++  +    +
Sbjct: 144 STILCSAFAPNTSSRMVTGAGDNTARIWDCDTQT------PKATLTGHFNWVLCVSYCPN 197

Query: 219 VKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSD 271
            + +AT S D T R W   D   L   L GH +W+   A+         +S  L +AS D
Sbjct: 198 GEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKD 257

Query: 272 HYVRLWDLSTREIVRQYGGHHKGAICV 298
             +R+WD++ R  +    GH     C+
Sbjct: 258 GTIRIWDITRRVCLYTMSGHTNSVSCI 284

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSAD-SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+ + S+ +VT + D+  R+WD  T+       GH    +CV+
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCDTQTPKATLTGHFNWVLCVS 193

>SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} similar
           to uniprot|P36037 Saccharomyces cerevisiae YKL213C DOA1
           WD repeat protein required for ubiquitin- mediated
           protein degradation forms complex with Cdc48p plays a
           role in controlling cellular ubiquitin concentration
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 711

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 124/285 (43%), Gaps = 23/285 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQH-SDSQVNRLEITNDKKLLGAAGHQNV--RLYDIR 61
           + S   D T+R W    GV +  I H S+  +N L      +LL   G   +   +  + 
Sbjct: 26  VASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYGGQDTLVGGISPLA 85

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
           TT+ +PV    GHKGNV SLS    N ++++SS D T KVW   S ++     H+A V +
Sbjct: 86  TTDEDPVYMLIGHKGNVCSLS--SKNNFVISSSWDKTAKVWHNGS-AIYDLVGHSASVWD 142

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKG 181
               P +   ++   D  I++W    N+     +      ++ L ++ DG    + ++ G
Sbjct: 143 AKFLPEKDFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDG 200

Query: 182 NCYVWEMPNHTDASNLKPVTKFKAHSNYI--TRILLSSDVKHLATCSADKTARTWSLDDN 239
              +    N  D + LK    F  H +++   + L + D   L +C  D++ R WS    
Sbjct: 201 TVKI----NDMDGNILK---TFTGHESFVYSVKFLPNGD---LVSCGEDRSVRVWSKTGA 250

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
            K    L     W  D   + D   ++  SSD+ VR++ +    I
Sbjct: 251 VKQVLRLPAVSIWDLDILPNGD---ILVGSSDNMVRIFTVEESRI 292

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 71/174 (40%), Gaps = 10/174 (5%)

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
           V+  N  ++ SC RDG +R+W   +      +       + SL       +L      G 
Sbjct: 18  VVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQLLFYG---GQ 74

Query: 183 CYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKL 242
             +    +    ++  PV     H   +    LSS    + + S DKTA+ W    N   
Sbjct: 75  DTLVGGISPLATTDEDPVYMLIGHKGNVCS--LSSKNNFVISSSWDKTAKVWH---NGSA 129

Query: 243 ESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAI 296
              L GH   VWD  F  +  + +TAS+D  ++LW     ++++ + G HK  I
Sbjct: 130 IYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLW--HGNKLIKTFSGIHKDVI 181

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 111/255 (43%), Gaps = 43/255 (16%)

Query: 67  PVAT--FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-------HNA 117
           PV T  + GH   + +L   +D  W+ T+S+D T+ +W  R      ++K       H  
Sbjct: 371 PVETNMYGGHVDLLNALDASEDGLWIATASKDHTVLLW--RYSEQLGDFKQYAKFIGHAG 428

Query: 118 PVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTP---------- 161
            V  V + PN  +      L+S   D  ++ W + +     Q   ED  P          
Sbjct: 429 SVTAVAL-PNIMDQHFPNFLLSSSTDMTVKKWKVPKPT---QNPTEDEIPVVKTSEYTRR 484

Query: 162 -----LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS 216
                + +LS++ + S+   A+    C +W++         + V     H   +  +   
Sbjct: 485 AHEKDINALSISPNDSIFATASYDKTCKIWDLVTG------ELVATLANHKRGLWDVSFC 538

Query: 217 SDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL 276
              K +ATCS DKT + WSL+ N+ +++TL+GH   V   +F   +  LV+  +D  V++
Sbjct: 539 QHDKLIATCSGDKTIKIWSLE-NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKI 597

Query: 277 WDLSTREIVRQYGGH 291
           WD ST E +R    H
Sbjct: 598 WDCSTGECLRTLDAH 612

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 69  ATFEGHKGNVTSLSF-----QQDNRWMVTSSEDGTIKVWDVRSPS-------VP------ 110
           A F GH G+VT+++      Q    ++++SS D T+K W V  P+       +P      
Sbjct: 421 AKFIGHAGSVTAVALPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSE 480

Query: 111 -RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVAS 169
                H   +N + I PN     +   D   +IWDL   +    L       L  +S   
Sbjct: 481 YTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKR-GLWDVSFCQ 539

Query: 170 DGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADK 229
              ++   +      +W + N+    N+K     + H+N + RI   +  K L +C AD 
Sbjct: 540 HDKLIATCSGDKTIKIWSLENY----NIKAT--LEGHTNAVQRISFINKNKQLVSCGADG 593

Query: 230 TARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
             + W       L  TLD H   +W    + D    VTA +D   + W  ++ E
Sbjct: 594 LVKIWDCSTGECLR-TLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 90/199 (45%), Gaps = 18/199 (9%)

Query: 4   ILVSAGYDHTIRFWEA-------------LTGVCSRTIQHSDSQVNRLEIT-NDKKLLGA 49
            L+S+  D T++ W+              +      T +  +  +N L I+ ND     A
Sbjct: 446 FLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFATA 505

Query: 50  AGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSV 109
           +  +  +++D+ T     VAT   HK  +  +SF Q ++ + T S D TIK+W + + ++
Sbjct: 506 SYDKTCKIWDLVT--GELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNI 563

Query: 110 PRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVA 168
               + H   V  +       +L+SC  DG ++IWD    +C   L   DN  + +L VA
Sbjct: 564 KATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNR-IWALEVA 622

Query: 169 SDGSMLVAANSKGNCYVWE 187
            DG   V A++ G    W+
Sbjct: 623 DDGDRFVTADADGLFQFWK 641

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 60/150 (40%), Gaps = 19/150 (12%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
           L +L  + DG  +  A+      +W         + K   KF  H+  +T + L + +  
Sbjct: 384 LNALDASEDGLWIATASKDHTVLLWRYSEQL--GDFKQYAKFIGHAGSVTAVALPNIMDQ 441

Query: 222 -----LATCSADKTARTWSL--------DDNFKL----ESTLDGHQRWVWDCAFSADSAY 264
                L + S D T + W +        +D   +    E T   H++ +   + S + + 
Sbjct: 442 HFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSI 501

Query: 265 LVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
             TAS D   ++WDL T E+V     H +G
Sbjct: 502 FATASYDKTCKIWDLVTGELVATLANHKRG 531

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 71/159 (44%), Gaps = 17/159 (10%)

Query: 32  DSQVNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           + ++  L++T D   L   A +Q +R+Y + +     +         V  +   + +  +
Sbjct: 60  EQEITALKLTPDGSYLCFVAQNQLLRIYSLAS---KKIVRSMKVSSPVYVMDCDETSTLL 116

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGEL-------ISCDRDGNIRI 142
           V    DG++ ++D+ +  V  ++K H   ++ V  +   GEL        S D +G ++I
Sbjct: 117 VIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFY---GELDGANWLLASGDTNGVVKI 173

Query: 143 WDLGENQCTHQLTPEDNTPLQSLSV-ASDGSMLVAANSK 180
           WDL + +C H +  E    ++ L     D  ML+ +  +
Sbjct: 174 WDLVKRRCMHTI-QEHTAAVRGLDFCVKDSEMLLISGGR 211

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/155 (17%), Positives = 67/155 (43%), Gaps = 5/155 (3%)

Query: 38  LEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDG 97
           + ITND  LL  +    + +  ++  +          +  +T+L    D  ++   +++ 
Sbjct: 23  VSITNDGSLLATSVLDVINIVQLKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQ 82

Query: 98  TIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
            ++++ + S  + R+ K ++PV  +        L+    DG++ I+D+     TH     
Sbjct: 83  LLRIYSLASKKIVRSMKVSSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGH 142

Query: 158 DNTPLQSLSVAS--DGS--MLVAANSKGNCYVWEM 188
               + S+      DG+  +L + ++ G   +W++
Sbjct: 143 GGI-ISSVKFYGELDGANWLLASGDTNGVVKIWDL 176

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 85/157 (54%), Gaps = 5/157 (3%)

Query: 32  DSQVNRLEIT-NDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           D  +N L I+ ND     A+  +  +++D+ + +    AT   HK  +  +SF Q ++++
Sbjct: 516 DKDINALSISPNDSIFATASYDKTCKIWDLESGDLK--ATLVNHKRGLWDVSFCQYDKFI 573

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           VT+S D TIK+W + + +V + ++ H+  V        Q +L+SC  DG I+IWD    +
Sbjct: 574 VTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGE 633

Query: 150 CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           C   L    N  + +LSV +DG ++++A++ G    W
Sbjct: 634 CIKTLDGHSNR-IWALSVINDGDVIISADADGVFQFW 669

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 112/254 (44%), Gaps = 36/254 (14%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-------HNA 117
           P  V  +EGH   + SL   +D+ W+ T+S+D +  +W  R  +V   Y+       H +
Sbjct: 397 PIDVDMYEGHTDLLNSLDSTEDSLWIATASKDNSCILW--RYNAVLEKYQIYAKFLGHAS 454

Query: 118 PVNEV----VIHPNQGE-LISCDRDGNIRIW---------DLGENQCTHQLTPEDNT--- 160
            V  V    V+  N  + +I+   D  I+ W         D  ++   H++   + T   
Sbjct: 455 SVTAVGLPNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRA 514

Query: 161 ---PLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
               + +LS++ + S+   A+    C +W++    ++ +LK       H   +  +    
Sbjct: 515 HDKDINALSISPNDSIFATASYDKTCKIWDL----ESGDLKAT--LVNHKRGLWDVSFCQ 568

Query: 218 DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
             K + T S DKT + WSLD  F +  T +GH   V  C F      LV+  +D  +++W
Sbjct: 569 YDKFIVTASGDKTIKMWSLD-TFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIW 627

Query: 278 DLSTREIVRQYGGH 291
           D S+ E ++   GH
Sbjct: 628 DCSSGECIKTLDGH 641

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 104/273 (38%), Gaps = 34/273 (12%)

Query: 30  HSDSQVNRLEITNDKKLLGAAGHQNVRL---YDIRTTNPNPVATFEGHKGNVTSLSF--- 83
           H+D  +N L+ T D   +  A   N  +   Y+         A F GH  +VT++     
Sbjct: 406 HTD-LLNSLDSTEDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVGLPNV 464

Query: 84  --QQDNRWMVTSSEDGTIKVWDVRSPSV---------PRNYK--------HNAPVNEVVI 124
             +    +++T+S D TIK W V  P+          P   K        H+  +N + I
Sbjct: 465 LTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSI 524

Query: 125 HPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCY 184
            PN     +   D   +IWDL        L       L  +S       +V A+      
Sbjct: 525 SPNDSIFATASYDKTCKIWDLESGDLKATLVNH-KRGLWDVSFCQYDKFIVTASGDKTIK 583

Query: 185 VWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLES 244
           +W +   T       V  F+ HSN + R    +  K L +C AD   + W       ++ 
Sbjct: 584 MWSLDTFT------VVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIK- 636

Query: 245 TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
           TLDGH   +W  +   D   +++A +D   + W
Sbjct: 637 TLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 6/150 (4%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRT-IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRT 62
           I  +A YD T + W+  +G    T + H     +      DK ++ A+G + ++++ + T
Sbjct: 530 IFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDT 589

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNE 121
                V TFEGH   V    F    + +V+   DG IK+WD  S    +    H+  +  
Sbjct: 590 F--TVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWA 647

Query: 122 VVIHPNQGELISCDRDGNIRIWD--LGENQ 149
           + +  +   +IS D DG  + W    GEN+
Sbjct: 648 LSVINDGDVIISADADGVFQFWRDCTGENR 677

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 22/153 (14%)

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVK- 220
           L SL    D   +  A+   +C +W    +      +   KF  H++ +T + L + +  
Sbjct: 410 LNSLDSTEDSLWIATASKDNSCILWRY--NAVLEKYQIYAKFLGHASSVTAVGLPNVLTK 467

Query: 221 ----HLATCSADKTARTWSL---------DDNFK------LESTLDGHQRWVWDCAFSAD 261
               ++ T S D T + W +         +D+FK       E T   H + +   + S +
Sbjct: 468 NYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPN 527

Query: 262 SAYLVTASSDHYVRLWDLSTREIVRQYGGHHKG 294
            +   TAS D   ++WDL + ++      H +G
Sbjct: 528 DSIFATASYDKTCKIWDLESGDLKATLVNHKRG 560

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 42/230 (18%), Positives = 94/230 (40%), Gaps = 28/230 (12%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRD 137
           +T+L    D +++  +S +  +K++++      ++ K ++P   + I      L     D
Sbjct: 64  ITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQTSTLLAVGGTD 123

Query: 138 GNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGS-------MLVAANSKGNCYVWEMPN 190
           G++ + D+  +  TH       T + ++   SD S       +L + ++ G   V +M  
Sbjct: 124 GSVTVIDIENSYITHSFKGHGAT-ISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVK 182

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKH---------LATCSADKTARTW--SLDDN 239
                  + +  F+ H++ I  + +     H         L +   D     W  +L   
Sbjct: 183 R------RCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRK 236

Query: 240 FKLESTLDGHQRWVWDCAFSADSA--YLVTASSDHYVRLWDLSTREIVRQ 287
            KL  T+  +Q+ V  C F   +    + T  SD   ++  +S+ +I+++
Sbjct: 237 SKLIKTIPVYQQ-VEACGFLNGNYEDLIYTGGSDAIFQILSISSNKILKK 285

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 130/298 (43%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S+   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         N+ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A   G   +W +         K +    A  + +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQ-DEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARTWSLDDNF---KLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            + +SLD  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 107/229 (46%), Gaps = 24/229 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   + T+Q      + + S+ +    SM+++ +  
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
               VW +     A+ L        H+++++++ +  + K       + +   DK  + W
Sbjct: 129 KTIKVWTIKGQCLATLL-------GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           +L+  F++E+   GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 182 NLN-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  F +   +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------KFGVPVRSFKGHSHIV 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D +  +   +F  H + +  + +      +
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASMI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRL 276
            + S DKT + W++    +  +TL GH  WV             DS  +++A +D  V+ 
Sbjct: 123 ISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 277 WDLSTREIVRQYGGHH 292
           W+L+  +I   + GH+
Sbjct: 181 WNLNQFQIEADFIGHN 196

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 68/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
                    F GH  N+ +L+   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DNTPLQSLSVASDGSML 174
           +   PN+  L +    G I+++ L        L PE             SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 VAANSKGNCYVWEM 188
            A  +     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 130/298 (43%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S+   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         N+ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A   G   +W +         K +    A  + +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQ-DEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARTWSLDDNF---KLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            + +SLD  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 107/229 (46%), Gaps = 24/229 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   + T+Q      + + S+ +    SM+++ +  
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
               VW +     A+ L        H+++++++ +  + K       + +   DK  + W
Sbjct: 129 KTIKVWTIKGQCLATLL-------GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           +L+  F++E+   GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 182 NLN-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  F +   +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------KFGVPVRSFKGHSHIV 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D +  +   +F  H + +  + +      +
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASMI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRL 276
            + S DKT + W++    +  +TL GH  WV             DS  +++A +D  V+ 
Sbjct: 123 ISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 277 WDLSTREIVRQYGGHH 292
           W+L+  +I   + GH+
Sbjct: 181 WNLNQFQIEADFIGHN 196

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 68/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
                    F GH  N+ +L+   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DNTPLQSLSVASDGSML 174
           +   PN+  L +    G I+++ L        L PE             SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 VAANSKGNCYVWEM 188
            A  +     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 130/298 (43%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S+   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         N+ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A   G   +W +         K +    A  + +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQ-DEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARTWSLDDNF---KLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            + +SLD  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 107/229 (46%), Gaps = 24/229 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   + T+Q      + + S+ +    SM+++ +  
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
               VW +     A+ L        H+++++++ +  + K       + +   DK  + W
Sbjct: 129 KTIKVWTIKGQCLATLL-------GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           +L+  F++E+   GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 182 NLN-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  F +   +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------KFGVPVRSFKGHSHIV 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D +  +   +F  H + +  + +      +
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASMI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRL 276
            + S DKT + W++    +  +TL GH  WV             DS  +++A +D  V+ 
Sbjct: 123 ISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 277 WDLSTREIVRQYGGHH 292
           W+L+  +I   + GH+
Sbjct: 181 WNLNQFQIEADFIGHN 196

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 68/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
                    F GH  N+ +L+   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DNTPLQSLSVASDGSML 174
           +   PN+  L +    G I+++ L        L PE             SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 VAANSKGNCYVWEM 188
            A  +     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 130/298 (43%), Gaps = 32/298 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S+   +    +++ S D TIKVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHN 148

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN+        +IS   D  ++ W+L + Q         N+ + +L+ + D
Sbjct: 149 DWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGH-NSNINTLTASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           G+++ +A   G   +W +         K +    A  + +  +  S +   LA  +A   
Sbjct: 208 GTLIASAGKDGEIMLWNLAAK------KAMYTLSAQ-DEVFSLAFSPNRYWLAAATATGI 260

Query: 231 ARTWSLDDNF---KLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
            + +SLD  +    L     G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 261 -KVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 107/229 (46%), Gaps = 24/229 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   + T+Q      + + S+ +    SM+++ +  
Sbjct: 70  DCTLTADGAYALSASWDKTLRLWDVATGE-TYQRFVGHKSDVMSVDIDKKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
               VW +     A+ L        H+++++++ +  + K       + +   DK  + W
Sbjct: 129 KTIKVWTIKGQCLATLL-------GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRE 283
           +L+  F++E+   GH   +     S D   + +A  D  + LW+L+ ++
Sbjct: 182 NLN-QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  F +   +  GH   V DC 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + V ++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDID 116

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------KFGVPVRSFKGHSHIV 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D +  +   +F  H + +  + +      +
Sbjct: 69  QDCTLTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVDIDKKASMI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRL 276
            + S DKT + W++    +  +TL GH  WV             DS  +++A +D  V+ 
Sbjct: 123 ISGSRDKTIKVWTIKG--QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 277 WDLSTREIVRQYGGHH 292
           W+L+  +I   + GH+
Sbjct: 181 WNLNQFQIEADFIGHN 196

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 68/194 (35%), Gaps = 51/194 (26%)

Query: 2   SVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           SV ++SAG D  ++ W                 +N+ +I  D                  
Sbjct: 166 SVTIISAGNDKMVKAW----------------NLNQFQIEAD------------------ 191

Query: 62  TTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNE 121
                    F GH  N+ +L+   D   + ++ +DG I +W++ +            V  
Sbjct: 192 ---------FIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFS 242

Query: 122 VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE-------DNTPLQSLSVASDGSML 174
           +   PN+  L +    G I+++ L        L PE             SL+ ++DG  L
Sbjct: 243 LAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTL 301

Query: 175 VAANSKGNCYVWEM 188
            A  +     VW++
Sbjct: 302 FAGYTDNVIRVWQV 315

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 131/305 (42%), Gaps = 36/305 (11%)

Query: 26  RTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN-------PNPVATFEGHKGN- 77
           RT+ H DS V  ++ +N+ + L    ++  +++++ T N            T + +  + 
Sbjct: 313 RTLLH-DSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASS 371

Query: 78  ----VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELI 132
               + S+ F  D +++ T +ED  I++WD+    +    + H   +  +    +  +L+
Sbjct: 372 ADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 133 SCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE----- 187
           S   D  IRIWDL   QC+  L+ ED     ++S   +G+ + A +      VW+     
Sbjct: 432 SGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVS-PGNGNYVAAGSLDRTVRVWDSNSGF 490

Query: 188 MPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD--------- 238
           +    D+     V     H + +  ++ + D K++ + S D++ + W+L +         
Sbjct: 491 LVERLDSEGETGV----GHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQ 546

Query: 239 ---NFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295
                  E T  GH+ +V     + +  Y+++ S D  V  WD  +   +    GH    
Sbjct: 547 PKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSV 606

Query: 296 ICVAL 300
           I VA+
Sbjct: 607 ISVAV 611

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 102/260 (39%), Gaps = 24/260 (9%)

Query: 43  DKKLLGAAGHQN-VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKV 101
           D K L        +R++DI       V    GH+ ++ SL + Q    +V+ S D TI++
Sbjct: 384 DGKFLATGAEDKLIRIWDI--AQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRI 441

Query: 102 WDVRSPSVPRNYKHNAPVNEVVIHPNQGELISCDR-DGNIRIWDLGENQCTHQLTPEDNT 160
           WD+ +            V  V + P  G  ++    D  +R+WD        +L  E  T
Sbjct: 442 WDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGET 501

Query: 161 ------PLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDAS-NLKPVTK------FKAHS 207
                  + S+    DG  +V+ +   +  +W + N   AS + +P T+      +  H 
Sbjct: 502 GVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHK 561

Query: 208 NYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCA------FSAD 261
           +++  +  + + +++ + S D+    W       L   L GH+  V   A        A+
Sbjct: 562 DFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPL-LMLQGHRNSVISVAVANGKPLGAN 620

Query: 262 SAYLVTASSDHYVRLWDLST 281
                T S D   ++W   T
Sbjct: 621 YNVFATGSGDCKAKIWKFQT 640

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 72/161 (44%), Gaps = 22/161 (13%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGH--QNVRLYD--- 59
           LVS   D TIR W+  TG CS T+   D  V  + ++       AAG   + VR++D   
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLTLSIEDG-VTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 60  --IRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS---------PS 108
             +     +   T  GHK +V S+ F +D + +V+ S D ++K+W++R+         P 
Sbjct: 489 GFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPK 548

Query: 109 VPRNYK-----HNAPVNEVVIHPNQGELISCDRDGNIRIWD 144
              N +     H   V  V    N   ++S  +D  +  WD
Sbjct: 549 TEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWD 589

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 113/254 (44%), Gaps = 21/254 (8%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T+P P+ T     +G + +V S+    DN+ + T+S +G++K+W+V++    R ++    
Sbjct: 375 TSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA 433

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +    + P    +I   R G ++++DL  +     +    +  + SL + SDG  LV  +
Sbjct: 434 LTCKFL-PGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492

Query: 179 SKGNCYVWE-------MPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCS 226
           +      W+       +P   D     P+ K    +       I  + +S D ++LA   
Sbjct: 493 ADKTVKFWDFQVEKTLVPGTKD--KFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
            D T + + LD + K   +L GH+  V     S DS  ++T+S+D  +++W L   +  +
Sbjct: 551 LDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609

Query: 287 QYGGHHKGAICVAL 300
               H    + V  
Sbjct: 610 SLFAHQDSIMSVKF 623

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 125/292 (42%), Gaps = 29/292 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C RT +   +   +        +LG    + ++L+D+ +++
Sbjct: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRSGE-LQLFDLASSS 463

Query: 65  PNPVATFE-GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSVP 110
              + T E  H   + SL    D + +VT S D T+K WD +              P + 
Sbjct: 464 L--LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLK 521

Query: 111 RNYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
            N+     +N+    V I P+   L     D  ++++ L   +    L      P+ S+ 
Sbjct: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSID 580

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  M++ +++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 581 ISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCS 634

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 635 KDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 120/291 (41%), Gaps = 28/291 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q   + V  +++++D KLL  A + ++++++++T     + TFE   G   +  F    
Sbjct: 387 LQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 443 LLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502

Query: 146 GENQ---------------CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
              +                 H  T E N  + S+ ++ D   L  +       V+ +  
Sbjct: 503 QVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                ++K       H   +  I +S D K + T SADK  + W LD       +L  HQ
Sbjct: 561 ----DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 93/215 (43%), Gaps = 19/215 (8%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++   LE+  D  LL A G+ +  ++++D+   +   +  F GHK  +T + F      +
Sbjct: 80  AECTYLEVHQDTNLL-AVGYADGVIKVWDL--VSKTVLLNFNGHKAAITLMQFDSTGTRL 136

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148
           ++ S+D  I VWD+        YK  +  + +     QGE  L+S  +DG I+IWDL   
Sbjct: 137 ISGSKDSNIIVWDLVGE--VGLYKLRSHKDAITGFWCQGEDWLVSTSKDGLIKIWDLKTQ 194

Query: 149 QCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWE--MPNHTDASNLKPVTKFKAH 206
           QC            +   +A    +L+  ++     +W+  M N      L  +  F+  
Sbjct: 195 QCIETHIAHTG---ECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGEKLTEMGIFEKQ 251

Query: 207 SNY----ITRILLSSD-VKHLATCSADKTARTWSL 236
           S      I  I  +SD V      +ADKT  T+ +
Sbjct: 252 SKQRGLKIEFITNASDGVSFFYIQNADKTIETYRI 286

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 80/203 (39%), Gaps = 25/203 (12%)

Query: 90  MVTSSEDGTIKVWDVRS-----------PSVPRNYKHNAPVN--EVVIHPNQGELISCDR 136
           ++TS+ +  + +WD+++           P    + K + P     + +H +   L     
Sbjct: 41  LITSALEN-VNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYA 99

Query: 137 DGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASN 196
           DG I++WDL                +  +   S G+ L++ +   N  VW++        
Sbjct: 100 DGVIKVWDLVSKTVLLNFNGH-KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEV---- 154

Query: 197 LKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC 256
              + K ++H + IT      +   L + S D   + W L     +E+ +  H    W  
Sbjct: 155 --GLYKLRSHKDAITGFWCQGE-DWLVSTSKDGLIKIWDLKTQQCIETHI-AHTGECWGL 210

Query: 257 AFSADSAYLVTASSDHYVRLWDL 279
           A   D   L+T S+D  V++W L
Sbjct: 211 AVKDD--LLITTSTDSQVKIWKL 231

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTS 93
           V  ++I+ D K++  ++  +N++++ +   + +   +   H+ ++ S+ F  ++    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   + + Y H + V  + I  +   ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 93/212 (43%), Gaps = 10/212 (4%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVVIHP 126
           +   +GH G V ++ F    R++ ++S D T ++WD+ S + +     H   V  +    
Sbjct: 268 LTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQN 327

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           +   L S   D    +WD+   +    L      P+ S+  + DG  +      G   +W
Sbjct: 328 DGALLCSGGLDNAAIVWDVRTGKSIMNLQGH-AKPIYSVDWSPDGYHIATGGGDGVINIW 386

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH-LATCSADKTARTWSLDDNFKLEST 245
           ++   T+       T+  AH+N +T +       H L +C  DK  R +S  DN+    T
Sbjct: 387 DIRKTTET------TRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYS-SDNWIQVKT 439

Query: 246 LDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
           L+GH   + D   S D+  +V++  D  ++LW
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 9/180 (5%)

Query: 56  RLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK- 114
           RL+DI +     +   EGH   V SLSFQ D   + +   D    VWDVR+     N + 
Sbjct: 300 RLWDIES--ETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQG 357

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSML 174
           H  P+  V   P+   + +   DG I IWD+ +   T +L   +N         S G  L
Sbjct: 358 HAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCL 417

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTW 234
           V+        ++       + N   V   + H++ I  + +S D + + +   D++ + W
Sbjct: 418 VSCGYDKQIRIYS------SDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 75/176 (42%), Gaps = 3/176 (1%)

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAA 177
           P+++V +  +     +    G+I+I D         +    +  +  L+  S  + LV+ 
Sbjct: 188 PISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSG 247

Query: 178 NSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
               +C V       D   +K +T  + H+  +  +      + +A+ S D T R W ++
Sbjct: 248 AD--DCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIE 305

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHK 293
              +L+   +GH + V+  +F  D A L +   D+   +WD+ T + +    GH K
Sbjct: 306 SETELQFQ-EGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAK 360

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 46/142 (32%), Gaps = 45/142 (31%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTT 63
           +L S G D+    W+  TG                                         
Sbjct: 331 LLCSGGLDNAAIVWDVRTG----------------------------------------- 349

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR-SPSVPRNYKHNAPVNEV 122
               +   +GH   + S+ +  D   + T   DG I +WD+R +    R   HN  V  V
Sbjct: 350 --KSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGV 407

Query: 123 VIHPNQGE-LISCDRDGNIRIW 143
               + G  L+SC  D  IRI+
Sbjct: 408 RFQKSTGHCLVSCGYDKQIRIY 429

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/216 (18%), Positives = 85/216 (39%), Gaps = 15/216 (6%)

Query: 78  VTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCD 135
           ++ +    DN    T S  G IK+ D ++  V    +  H+  +  +  +     L+S  
Sbjct: 189 ISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGA 248

Query: 136 RDGNIRIWDLGEN-QCTHQLTPEDNTPLQSLSVA--SDGSMLVAANSKGNCYVWEMPNHT 192
            D  ++I     + +   +LT       + ++V     G  + +A+      +W++ + T
Sbjct: 249 DDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESET 308

Query: 193 DASNLKPVTKFK-AHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQR 251
           +        +F+  H   +  +   +D   L +   D  A  W +     +   L GH +
Sbjct: 309 EL-------QFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSI-MNLQGHAK 360

Query: 252 WVWDCAFSADSAYLVTASSDHYVRLWDL-STREIVR 286
            ++   +S D  ++ T   D  + +WD+  T E  R
Sbjct: 361 PIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTR 396

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 112/234 (47%), Gaps = 23/234 (9%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T+P P+ T     +G + +V S+    DN+ + T+S +G++K+W++++    R ++    
Sbjct: 375 TSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNIKTHKCIRTFECGYA 433

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +    + P    +I   R+G ++++DL  +     +    +  + SL + SDG  LV  +
Sbjct: 434 LTCKFL-PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492

Query: 179 SKGNCYVWEMPNHTDASNLKPVTK------FKAH-------SNYITRILLSSDVKHLATC 225
           +      W+       ++L P TK       K H       ++ I  + +S D ++LA  
Sbjct: 493 ADKTVKFWDFKVE---NSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAIS 549

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
             D T + + LD + K   +L GH+  V     S DS  ++T+S+D  +++W L
Sbjct: 550 LLDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 122/292 (41%), Gaps = 29/292 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C RT +   +   +        +LG    + ++L+D+ +++
Sbjct: 405 LLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGE-LQLFDLASSS 463

Query: 65  PNPVATFE-GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWD--VRSPSVPRNYKHNAPVNE 121
              + T E  H   + SL    D + +VT S D T+K WD  V +  VP       PV +
Sbjct: 464 L--LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLK 521

Query: 122 ---------------VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
                          V + P+   L     D  ++++ L   +    L      P+ S+ 
Sbjct: 522 LHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSID 580

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  M++ +++  N  +W + +  D           AH + I  +       +  +CS
Sbjct: 581 ISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMNVKFLPQSHNFFSCS 634

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            D   + W   + F+    L  HQ  VW  A + D  ++V++S DH +R+W+
Sbjct: 635 KDAVVKYWD-GEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 91/215 (42%), Gaps = 19/215 (8%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++   LE   D  LL A G+ +  ++++D+ +     +  F GHK  +T L F      +
Sbjct: 80  AECTYLEAHKDTDLL-AVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRL 136

Query: 91  VTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148
           ++ S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL  +
Sbjct: 137 ISGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTH 194

Query: 149 QCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTD--ASNLKPVTKFKAH 206
           QC            +   +A    +L+   +     +W++    D     L  +  F+  
Sbjct: 195 QCIETHIAHTG---ECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGGKLTEMGIFEKQ 251

Query: 207 SNY----ITRILLSSD-VKHLATCSADKTARTWSL 236
           S      I  I  SSD        +ADKT  T+ +
Sbjct: 252 SKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRI 286

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 79/196 (40%), Gaps = 21/196 (10%)

Query: 53  QNVRLYDIRTTN---------PNPVATFEGHK-GNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           ++V ++DI+T +         P   +   G K    T L   +D   +     DG IKVW
Sbjct: 47  EDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVW 106

Query: 103 DVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTP 161
           D+ S +V  N+  H A +  +        LIS  +D NI +WDL      ++L    ++ 
Sbjct: 107 DLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI 166

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
                   D   L++ +  G   +W++  H      + +    AH+     + +  D+  
Sbjct: 167 TGFWCQGED--WLISTSKDGMIKLWDLKTH------QCIETHIAHTGECWGLAVKDDL-- 216

Query: 222 LATCSADKTARTWSLD 237
           L T   D   + W LD
Sbjct: 217 LITTGTDSQVKIWKLD 232

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTS 93
           V  ++I+ D K++  ++  +N++++ +   + +   +   H+ ++ ++ F   +    + 
Sbjct: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPQSHNFFSC 633

Query: 94  SEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D  +K WD  +   + + Y H + V  + +  + G ++S   D +IRIW+  E+Q 
Sbjct: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWEETEDQV 691

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 36/93 (38%), Gaps = 13/93 (13%)

Query: 189 PNHTDASNLKPV--TKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
           P  +DA   KP   T  +AH           D   LA   AD   + W L     L +  
Sbjct: 69  PGASDARGAKPAECTYLEAHK----------DTDLLAVGYADGVIKVWDLMSKTVLLN-F 117

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
           +GH+  +    F      L++ S D  + +WDL
Sbjct: 118 NGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 72.8 bits (177), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/298 (23%), Positives = 128/298 (42%), Gaps = 36/298 (12%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 30  LLLSASRDKTLISWK-LTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIR 88

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHKG+V S++  +    +++ S D TIKVW ++   +     HN
Sbjct: 89  LWDVSTGET--FQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGECLATMLGHN 146

Query: 117 APVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V + PN         +IS   D  ++ W++ + Q        +N  + ++  + D
Sbjct: 147 DWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVNQFQIDADFIGHNNY-INAIVASPD 205

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           GS++ +A   G   +W++         + +    AH       L  S  ++    +    
Sbjct: 206 GSLIASAGKDGEIMMWDLAQK------RALYTLSAHDEVFA--LAFSPNRYWLAAATSSG 257

Query: 231 ARTWSLD-----DNFKLESTLDGHQRWV----WDCAFSADSAYLVTASSDHYVRLWDL 279
            + +SL+     DN   E    G+ +         A+SAD   L    +D+ +R+W +
Sbjct: 258 IKIFSLEPQGIIDNLNPE--FAGYTKAAEPHPLSLAWSADGQTLFAGYTDNVIRVWQV 313

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 111/237 (46%), Gaps = 24/237 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 9   GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQ 67

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  IR+WD+   + T Q        + S+++    SM+++ +  
Sbjct: 68  DCALTADGAYALSASWDKTIRLWDVSTGE-TFQRFVGHKGDVMSVAIDRKASMIISGSRD 126

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLS------SDVKHLATCSADKTARTW 234
               VW +     A+ L        H+++++++ ++       D   + +  +DK  ++W
Sbjct: 127 KTIKVWSIKGECLATML-------GHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSW 179

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +++  F++++   GH  ++     S D + + +A  D  + +WDL+ +  +     H
Sbjct: 180 NVN-QFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQKRALYTLSAH 235

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  + +   +  GH   V DCA
Sbjct: 11  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCA 70

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD+ST E  +++ GH    + VA++
Sbjct: 71  LTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAID 114

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 14  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------QYGVPVRSFKGHSHIV 66

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D S  +   +F  H   +  + +      +
Sbjct: 67  QDCALTADGAYALSASWDKTIRLW------DVSTGETFQRFVGHKGDVMSVAIDRKASMI 120

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRL 276
            + S DKT + WS+    +  +T+ GH  WV     +       D+  +++A SD  V+ 
Sbjct: 121 ISGSRDKTIKVWSIKG--ECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKS 178

Query: 277 WDLSTREIVRQYGGHH 292
           W+++  +I   + GH+
Sbjct: 179 WNVNQFQIDADFIGHN 194

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 7/109 (6%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYD---- 59
           ++ SAG D  I  W+        T+   D +V  L  + ++  L AA    ++++     
Sbjct: 208 LIASAGKDGEIMMWDLAQKRALYTLSAHD-EVFALAFSPNRYWLAAATSSGIKIFSLEPQ 266

Query: 60  --IRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS 106
             I   NP      +  + +  SL++  D + +     D  I+VW V S
Sbjct: 267 GIIDNLNPEFAGYTKAAEPHPLSLAWSADGQTLFAGYTDNVIRVWQVMS 315

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 127/298 (42%), Gaps = 29/298 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   +  ++ W   T  C RT +   S   +        ++G  G + ++L+D+ ++ 
Sbjct: 417 LLATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGE-LQLFDLASST 475

Query: 65  PNPVATFE-GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVR----------SPSVPR-- 111
              + T E  H   + SL    D + +VT S D ++K WD +             +P+  
Sbjct: 476 L--LETIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLK 533

Query: 112 -----NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
                  + N  +  V I P    L     D  ++++ +   +    L      P+ S+ 
Sbjct: 534 LFHDTTLELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGH-KLPVLSID 592

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  +++ +++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 593 ISFDSKLIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMNVKFVPESHNFFSCS 646

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 284
            D   + W   D F+    L GHQ  VW  A + D++++V++S DH +R+W+ +  E+
Sbjct: 647 KDGLIKYWD-GDKFECIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEV 703

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 111/248 (44%), Gaps = 15/248 (6%)

Query: 65  PNPVATFE--GHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 122
           PN + T E  G + ++ S+    DN+ + T+S +G +K+W++++ S  R ++    +   
Sbjct: 391 PNKLHTIELQGQRTDIRSIDISDDNKLLATAS-NGLLKIWNIKTKSCIRTFECGYSLTCK 449

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGN 182
            + P    +I   R G ++++DL  +     +    +  + SL + SDG  LV  ++  +
Sbjct: 450 FL-PGGTLVIVGTRGGELQLFDLASSTLLETIEDAHDAAIWSLDLTSDGKRLVTGSADKS 508

Query: 183 CYVWEMPNHTD---ASNLKPVTKFKAH-------SNYITRILLSSDVKHLATCSADKTAR 232
              W+     +    +  K + K K         ++ I  + +S + K LA    D T +
Sbjct: 509 VKFWDFQLEQELVAGTVDKYLPKLKLFHDTTLELNDDILSVKISPEDKFLAVSLLDNTVK 568

Query: 233 TWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
            + +D   K   +L GH+  V     S DS  ++T+S+D  +++W L   +  +    H 
Sbjct: 569 VFFMD-TMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQ 627

Query: 293 KGAICVAL 300
              + V  
Sbjct: 628 DSIMNVKF 635

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/290 (20%), Positives = 121/290 (41%), Gaps = 28/290 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q   + +  ++I++D KLL  A +  +++++I+T   + + TFE   G   +  F    
Sbjct: 399 LQGQRTDIRSIDISDDNKLLATASNGLLKIWNIKT--KSCIRTFEC--GYSLTCKFLPGG 454

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             ++  +  G ++++D+ S ++    +  H+A +  + +  +   L++   D +++ WD 
Sbjct: 455 TLVIVGTRGGELQLFDLASSTLLETIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDF 514

Query: 146 GENQ---------------CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
              Q                 H  T E N  + S+ ++ +   L  +       V+ M  
Sbjct: 515 QLEQELVAGTVDKYLPKLKLFHDTTLELNDDILSVKISPEDKFLAVSLLDNTVKVFFM-- 572

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                 +K       H   +  I +S D K + T SADK  + W LD       +L  HQ
Sbjct: 573 ----DTMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG-DCHKSLFAHQ 627

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
             + +  F  +S    + S D  ++ WD    E +++  GH      +A+
Sbjct: 628 DSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFECIQKLAGHQSEVWSIAI 677

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 90/243 (37%), Gaps = 61/243 (25%)

Query: 53  QNVRLYDIRTTN------------PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIK 100
           +N+ ++DI+T              P  +          T L   +D   +     DG IK
Sbjct: 45  ENINIWDIKTGELSSHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIK 104

Query: 101 VWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDN 159
           VWD+ S +V  N   H++ +  +        LIS  RD NI +WDL              
Sbjct: 105 VWDLYSKTVLCNLNGHSSAITVLKFDSTGTRLISGSRDSNIIVWDL-------------- 150

Query: 160 TPLQSLSVASDGSMLVAANSKGNCYVW--EMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
                  V+  G   + ++      +W  EM N+ +                       +
Sbjct: 151 -------VSEVGLYKLRSHKDAITGIWCNEMQNNGEDD--------------------EN 183

Query: 218 DVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC-AFSADSAYLVTASSDHYVRL 276
           ++  L + S D   + W L    K++  ++ H     +C + +  +  L+T SSD  +++
Sbjct: 184 ELDWLISTSKDGLIKIWDL----KIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKI 239

Query: 277 WDL 279
           W+L
Sbjct: 240 WEL 242

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 73/155 (47%), Gaps = 19/155 (12%)

Query: 5   LVSAGY-DHTIRFWE--ALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIR 61
           L++ GY D  I+ W+  + T +C+     S   V + + T   +L+  +   N+ ++D+ 
Sbjct: 93  LLAVGYNDGVIKVWDLYSKTVLCNLNGHSSAITVLKFDSTG-TRLISGSRDSNIIVWDL- 150

Query: 62  TTNPNPVATFEGHKGNVTSL--SFQQDN--------RWMVTSSEDGTIKVWDVR-SPSVP 110
             +   +     HK  +T +  +  Q+N         W++++S+DG IK+WD++    + 
Sbjct: 151 -VSEVGLYKLRSHKDAITGIWCNEMQNNGEDDENELDWLISTSKDGLIKIWDLKIQQCIE 209

Query: 111 RNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
            +  H      V +  +   LI+   D  I+IW+L
Sbjct: 210 THIAHTGECWSVAVRNDL--LITTSSDSQIKIWEL 242

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 134/334 (40%), Gaps = 54/334 (16%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T    +T++   + V  +  + D +L+      N +RL+     
Sbjct: 158 MVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQ-SEK 216

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
             N      GH   +TSLS++        D   + ++S+DGTIK+WD            +
Sbjct: 217 GENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTLSGH 276

Query: 117 APVNEVVIHPNQGELISCDRDGNIRIWDL-GENQCTHQLT-------------------- 155
                 V    +G L S   D  IR WD+    +C + L                     
Sbjct: 277 TNSVSCVKWGGRGVLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRVG 336

Query: 156 ------PEDNTPLQSLSVASDG------------SMLVAANSKGNCYVWEMPNHTDASNL 197
                  + ++P ++ + A +              ++V A+     Y+W+    T     
Sbjct: 337 AFDHTGKKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKST----- 391

Query: 198 KPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCA 257
           KP+T+   H   +  +  S D +++ + S D + + W   D     +T  GH   V+  A
Sbjct: 392 KPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDG-TFIATFRGHVASVYQVA 450

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           +S+D   LV+ S D  +++WD+ T+++     GH
Sbjct: 451 WSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGH 484

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 114/278 (41%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L   +  + +R +D+    
Sbjct: 250 LASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGGRGVLYSGSHDKTIRAWDMNAGG 309

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   +  LS   D    V + +    K      PS P   +  A  N   I
Sbjct: 310 -KCINILKSHAHWINHLSLSTDYALRVGAFDHTGKK------PSSPEEARAKALENYEKI 362

Query: 125 HPNQGEL----ISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G+L    ++   D  + +WD +   +   ++T      +  ++ + DG  +V+A+ 
Sbjct: 363 AKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKL-VNHVAFSPDGRYIVSASF 421

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  +   +  F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 422 DNSIKLW------DGRDGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK 475

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH+  V+   +S D   + +A  D  VR+W
Sbjct: 476 -KLSVDLPGHKDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 94/224 (41%), Gaps = 42/224 (18%)

Query: 4   ILVSAGYDHTIRFWEA-LTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGH--------- 52
           +L S  +D TIR W+    G C   ++     +N L ++ D  L +GA  H         
Sbjct: 290 VLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALRVGAFDHTGKKPSSPE 349

Query: 53  ---------------QNVRLYDIRTT--------------NPNPVATFEGHKGNVTSLSF 83
                          +N +L ++  T              +  P+    GH+  V  ++F
Sbjct: 350 EARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAF 409

Query: 84  QQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRI 142
             D R++V++S D +IK+WD R  +    ++ H A V +V    +   L+SC +D  +++
Sbjct: 410 SPDGRYIVSASFDNSIKLWDGRDGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 469

Query: 143 WDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           WD+   + +  L P     + ++  + DG  + +A       +W
Sbjct: 470 WDVRTKKLSVDL-PGHKDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 54/134 (40%), Gaps = 13/134 (9%)

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S +V         +W+   +T      P+   K H N++  +  S D + +AT S D T 
Sbjct: 156 SRMVTGAGDNTARIWDCNTNT------PMQTLKGHFNWVLCVAWSPDGELIATGSMDNTI 209

Query: 232 RTWSLDDNFKLESTLDGHQRWVWDCAFS-------ADSAYLVTASSDHYVRLWDLSTREI 284
           R W  +        L GH +W+   ++         D   L +AS D  +++WD + R  
Sbjct: 210 RLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVC 269

Query: 285 VRQYGGHHKGAICV 298
           +    GH     CV
Sbjct: 270 LFTLSGHTNSVSCV 283

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 244 STLDGHQRWVWDCAFSA-DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVA 299
           S + GH   +   AF+   S+ +VT + D+  R+WD +T   ++   GH    +CVA
Sbjct: 136 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVA 192

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 129/297 (43%), Gaps = 30/297 (10%)

Query: 4   ILVSAGYDHTIRFWEAL-----TGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVRL 57
           +LVSA  D T+  W+        GV  R+ +     V  + +T D    L A+  + +RL
Sbjct: 32  LLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLRL 91

Query: 58  YDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNA 117
           +++ T        F GHK +V S++  +    +++ S D +IKVW ++   +     HN 
Sbjct: 92  WEVATGET--FQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQCLATLLGHND 149

Query: 118 PVNEVVIHPNQGE------LISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDG 171
            V++V + PN  +      +IS   D  ++ W+L + Q         N  + +++ + DG
Sbjct: 150 WVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGH-NGNVNTITASPDG 208

Query: 172 SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTA 231
           S++ +A   G   +W + +        P+    A  + +  +  S +   LA  +A    
Sbjct: 209 SLIASAGKDGEIMLWNLADKV------PMYTLNAQ-DEVFALAFSPNRYWLAAATASGI- 260

Query: 232 RTWSLDDNF---KLESTLDGHQRWVWDCA----FSADSAYLVTASSDHYVRLWDLST 281
           + +SLD       L     G+ +     A    +SAD   L    +D+ +R+W + T
Sbjct: 261 KVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 111/228 (48%), Gaps = 24/228 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  +V++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +V + P+    +S   D  +R+W++   + T Q      + + S+++    SM+++ +  
Sbjct: 70  DVTLTPDGAYALSASWDKTLRLWEVATGE-TFQRFVGHKSDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH------LATCSADKTARTW 234
            +  VW +     A+ L        H+++++++ ++ + K       + +   DK  + W
Sbjct: 129 KSIKVWTIKGQCLATLL-------GHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +L+  F++E+   GH   V     S D + + +A  D  + LW+L+ +
Sbjct: 182 NLN-QFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADK 228

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHL-ATCSADKTARTWSL-DDNFKLE---STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L  D+ K+     +  GH   V D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVT 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            + D AY ++AS D  +RLW+++T E  +++ GH    + VA++
Sbjct: 73  LTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAID 116

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 82/191 (42%), Gaps = 23/191 (12%)

Query: 115 HNAPVNEVVIHPNQGEL-ISCDRDGNIRIWDL-GENQCTHQLTPEDNTP-----LQSLSV 167
           HN  V  +     Q  L +S  RD  +  W L G++Q      P  +       +Q +++
Sbjct: 16  HNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVG--VPVRSFKGHSHIVQDVTL 73

Query: 168 ASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSA 227
             DG+  ++A+      +WE+         +   +F  H + +  + +      + + S 
Sbjct: 74  TPDGAYALSASWDKTLRLWEVATG------ETFQRFVGHKSDVMSVAIDRKASMIISGSR 127

Query: 228 DKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA------DSAYLVTASSDHYVRLWDLST 281
           DK+ + W++    +  +TL GH  WV     +       ++  +++A +D  V+ W+L+ 
Sbjct: 128 DKSIKVWTIKG--QCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQ 185

Query: 282 REIVRQYGGHH 292
            +I   + GH+
Sbjct: 186 FQIEADFVGHN 196

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 121/291 (41%), Gaps = 29/291 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C RT +   +   +        ++G     ++ L+D+ ++ 
Sbjct: 399 LLATASNGSLKIWNIKTKSCIRTFECGYALACKFLPGGALVVIGTKTG-DLNLFDLASST 457

Query: 65  PNPVATFEG-HKGNVTSLSFQQDNRWMVTSSEDGTIKVWD--VRSPSVPRNYKHNAP--- 118
              +++ E  H G + SL    D + +VT S D +++ WD  V    VP       P   
Sbjct: 458 L--LSSIEAAHSGAIWSLDLTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLK 515

Query: 119 ------------VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
                       V  V I P+   L     D  ++++ L   +    L      P+ S+ 
Sbjct: 516 MFHDTTLELNDDVLAVKISPDNRLLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSID 574

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  +L+ +++  N  VW + +  D           AHS+ I ++    +  +  +C 
Sbjct: 575 ISFDSKLLITSSADKNIKVWGL-DFGDCHK-----SLFAHSDSIMKVAFLPESHNFFSCG 628

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            D   + W   D F+    L  HQ+ VW  A S D  ++V+AS D  +R+W
Sbjct: 629 KDGLVKYWD-GDKFECIQKLAAHQKEVWTIAISHDGTFVVSASHDQSIRVW 678

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 117/254 (46%), Gaps = 25/254 (9%)

Query: 65  PNPVATF----EGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVN 120
           P+P   +    +GH+ +V ++    DN+ + T+S +G++K+W++++ S  R ++    + 
Sbjct: 371 PSPPKIYSIDIKGHRTDVRAIDISDDNKLLATAS-NGSLKIWNIKTKSCIRTFECGYALA 429

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
              + P    ++   + G++ ++DL  +     +    +  + SL + +DG  LV  ++ 
Sbjct: 430 CKFL-PGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSAD 488

Query: 181 GNCYVWE-------MPNHTDASNLKPVTKFKAH-------SNYITRILLSSDVKHLATCS 226
            +   W+       +P  TD    K V K K         ++ +  + +S D + LA   
Sbjct: 489 KSVRFWDFQVEQELVPGTTD----KFVPKLKMFHDTTLELNDDVLAVKISPDNRLLAISL 544

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 286
            D T + + LD + K   +L GH+  V     S DS  L+T+S+D  +++W L   +  +
Sbjct: 545 LDNTVKVFFLD-SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFGDCHK 603

Query: 287 QYGGHHKGAICVAL 300
               H    + VA 
Sbjct: 604 SLFAHSDSIMKVAF 617

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 87/218 (39%), Gaps = 23/218 (10%)

Query: 38  LEITND-KKLLGAAGHQNVRLYDIRTTN---PNPVATFEGH-----------KGNVTSLS 82
           L++T D K+L+  +  ++VR +D +      P     F                +V ++ 
Sbjct: 473 LDLTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVK 532

Query: 83  FQQDNRWMVTSSEDGTIKVWDVRSPSVPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIR 141
              DNR +  S  D T+KV+ + S     + Y H  PV  + I  +   LI+   D NI+
Sbjct: 533 ISPDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIK 592

Query: 142 IWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVT 201
           +W L    C   L    ++ ++ ++   +     +    G    W      D    + + 
Sbjct: 593 VWGLDFGDCHKSLFAHSDSIMK-VAFLPESHNFFSCGKDGLVKYW------DGDKFECIQ 645

Query: 202 KFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
           K  AH   +  I +S D   + + S D++ R W   D+
Sbjct: 646 KLAAHQKEVWTIAISHDGTFVVSASHDQSIRVWVETDD 683

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++   L+   + KLL AAG+ +  V+++D+   + + +  F GHK  +T L F      +
Sbjct: 76  AETTFLQYHPETKLL-AAGYNDGVVKIWDL--LSKSVLINFNGHKSAITVLKFDSTGTRL 132

Query: 91  VTSSEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGE 147
           ++ S+D  I VWD V    + +   H   +  +     +GE  L+S  +DG I++WDL  
Sbjct: 133 ISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWC---EGEDWLVSTSKDGLIKVWDLKT 189

Query: 148 NQCTH 152
            QC  
Sbjct: 190 QQCVE 194

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 67/174 (38%), Gaps = 11/174 (6%)

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVV 123
           P  V          T L +  + + +     DG +K+WD+ S SV  N+  H + +  + 
Sbjct: 65  PGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSAITVLK 124

Query: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNC 183
                  LIS  +D +I +WDL       +L    ++         D   LV+ +  G  
Sbjct: 125 FDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGED--WLVSTSKDGLI 182

Query: 184 YVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
            VW++         + V    AH      + +  D+  + TC  D   + WS+D
Sbjct: 183 KVWDLKTQ------QCVETHVAHVGECWSMGVHEDL--VVTCGGDNQIKLWSVD 228

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 82/214 (38%), Gaps = 51/214 (23%)

Query: 68  VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 126
           +  FE        ++F     W++ +    TI++WD R  ++   Y+ H  PV  V  HP
Sbjct: 4   LTKFESKSTRAKGIAFHSSRPWVLVALFSSTIQLWDYRMGTLLHRYEDHEGPVRAVDFHP 63

Query: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
            Q   +S   D NI++W L  N+C + LT                               
Sbjct: 64  TQPLFVSAGDDYNIKVWSLDTNKCLYTLT------------------------------- 92

Query: 187 EMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTL 246
                              H +Y+  +   +++  + + S D+T R W+   N K  + L
Sbjct: 93  ------------------GHLDYVRTVFFHNELPWIISASDDQTIRIWNW-QNRKEIACL 133

Query: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLS 280
            GH  +V    F      +V+AS D  +R+WD+S
Sbjct: 134 TGHNHFVMSAQFHPTEDLVVSASLDETIRVWDIS 167

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 121/291 (41%), Gaps = 32/291 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQ-NVRLYDIRTT 63
           ++ A +  TI+ W+   G      +  +  V  ++    + L  +AG   N++++ + T 
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRYEDHEGPVRAVDFHPTQPLFVSAGDDYNIKVWSLDTN 85

Query: 64  NPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS-PSVPRNYKHNAPVNEV 122
               + T  GH   V ++ F  +  W++++S+D TI++W+ ++   +     HN  V   
Sbjct: 86  KC--LYTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMSA 143

Query: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQL----TPEDNTPLQSLSVASDGSMLVAAN 178
             HP +  ++S   D  IR+WD+   +  H      + ED   +Q   +  DG       
Sbjct: 144 QFHPTEDLVVSASLDETIRVWDISGLRKKHSAPGATSLEDQMLMQQNLL--DGGF----- 196

Query: 179 SKGNCYV-WEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLD 237
             G+C V + +  HT   N      + +    +  I+   D + +       T + W +D
Sbjct: 197 --GDCVVKFILEGHTRGVN------WASFHPTLPLIVSGGDDRQVKLWRMSST-KAWEVD 247

Query: 238 DNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
                  T  GH   V    F      +++   D  +R+WDL  R  V+Q+
Sbjct: 248 -------TCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 77/187 (41%), Gaps = 33/187 (17%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLE---ITNDKKLLGAAGHQNVRLYDI 60
           ++VSA  D TIR W+ ++G+  +   HS      LE   +     L G  G   V+    
Sbjct: 151 LVVSASLDETIRVWD-ISGLRKK---HSAPGATSLEDQMLMQQNLLDGGFGDCVVKF--- 203

Query: 61  RTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSP---SVPRNYKHNA 117
                      EGH   V   SF      +V+  +D  +K+W + S     V     H  
Sbjct: 204 ---------ILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTN 254

Query: 118 PVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAA 177
            V+ V+ HP+Q  +IS   D  +R+WDL           +  TP++     +D   L+AA
Sbjct: 255 NVDSVIFHPHQNLIISVGEDKTLRVWDL-----------DKRTPVKQFKRENDRFWLIAA 303

Query: 178 NSKGNCY 184
           +   N +
Sbjct: 304 HPHINLF 310

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 97/241 (40%), Gaps = 31/241 (12%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKK-LLGAAGHQNVRLYDIRT 62
           + VSAG D+ I+ W   T  C  T+      V  +   N+   ++ A+  Q +R+++ + 
Sbjct: 67  LFVSAGDDYNIKVWSLDTNKCLYTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQ- 125

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP---- 118
            N   +A   GH   V S  F      +V++S D TI+VWD+         KH+AP    
Sbjct: 126 -NRKEIACLTGHNHFVMSAQFHPTEDLVVSASLDETIRVWDISG----LRKKHSAPGATS 180

Query: 119 -VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNT-PLQSLSVASDGSMLVA 176
             +++++  N              + D G   C  +   E +T  +   S      ++V+
Sbjct: 181 LEDQMLMQQN--------------LLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 177 ANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSL 236
                   +W M     ++    V   + H+N +  ++       + +   DKT R W L
Sbjct: 227 GGDDRQVKLWRM----SSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDL 282

Query: 237 D 237
           D
Sbjct: 283 D 283

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 222 LATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLST 281
             +   D   + WSLD N K   TL GH  +V    F  +  ++++AS D  +R+W+   
Sbjct: 68  FVSAGDDYNIKVWSLDTN-KCLYTLTGHLDYVRTVFFHNELPWIISASDDQTIRIWNWQN 126

Query: 282 REIVRQYGGHH 292
           R+ +    GH+
Sbjct: 127 RKEIACLTGHN 137

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV- 104
           ++     + V+L+ + +T    V T  GH  NV S+ F      +++  ED T++VWD+ 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLD 283

Query: 105 -RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG-ENQCT--HQ 153
            R+P V +  + N     +  HP+   L     D  I ++ L  E  C+  HQ
Sbjct: 284 KRTP-VKQFKRENDRFWLIAAHPHIN-LFGAAHDSGIMVFKLDRERPCSVIHQ 334

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 130/297 (43%), Gaps = 30/297 (10%)

Query: 4   ILVSAGYDHTIRFWEALTG------VCSRTIQHSDSQVNRLEITNDKKL-LGAAGHQNVR 56
           +L+SA  D T+  W+ LTG      V  R+ +     V    +T D    L A+  + +R
Sbjct: 32  LLLSASRDKTLISWK-LTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLR 90

Query: 57  LYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHN 116
           L+D+ T        F GHK +V S++  +    +++ S D T+KVW ++   +     HN
Sbjct: 91  LWDVAT--GETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTVKVWTIKGQCLATMLGHN 148

Query: 117 APVNEVVIHPNQG------ELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASD 170
             V++V I P +        +IS   D  ++ W++ + Q        +N  + +++ + D
Sbjct: 149 DWVSQVRIVPTEDVNDDTVTVISAGMDKMVKAWNVNQFQIEADFIGHNNY-VNTVTASPD 207

Query: 171 GSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKT 230
           GS++ +A   G   +W + + +    L    +  A +    R  LS+     AT S  K 
Sbjct: 208 GSLIASAGKDGEIMLWNLADKSAMYTLSAQDEVFALAFSPNRYWLSA-----ATASGIKI 262

Query: 231 --ARTWSLDDNFKLESTLDGHQRW----VWDCAFSADSAYLVTASSDHYVRLWDLST 281
                 SL D  K E    G+ +         A+SAD   L    +D+ +R+W + T
Sbjct: 263 FCLDPKSLVDELKPE--FAGYTKAAEPHAVSLAWSADGQTLFAGYTDNVIRVWQVMT 317

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 110/228 (48%), Gaps = 24/228 (10%)

Query: 69  ATFEGHKGNVTSL--SFQQDNRWMVTSSEDGTIKVW----DVRSPSVP-RNYK-HNAPVN 120
            T EGH G VTSL  S  Q N  ++++S D T+  W    D +   VP R++K H+  V 
Sbjct: 11  GTLEGHNGWVTSLATSAGQPNL-LLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQ 69

Query: 121 EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSK 180
           +  +  +    +S   D  +R+WD+   + T+Q      + + S+++    SM+++ +  
Sbjct: 70  DCALTADGAYALSASWDKTLRLWDVATGE-TYQRFVGHKSDVMSVAIDRKASMIISGSRD 128

Query: 181 GNCYVWEMPNHTDASNLKPVTKFKAHSNYIT--RILLSSDVKH----LATCSADKTARTW 234
               VW +     A+ L        H+++++  RI+ + DV      + +   DK  + W
Sbjct: 129 KTVKVWTIKGQCLATML-------GHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVKAW 181

Query: 235 SLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTR 282
           +++  F++E+   GH  +V     S D + + +A  D  + LW+L+ +
Sbjct: 182 NVN-QFQIEADFIGHNNYVNTVTASPDGSLIASAGKDGEIMLWNLADK 228

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 203 FKAHSNYITRILLSSDVKHLA-TCSADKTARTWSL---DDNFKLE-STLDGHQRWVWDCA 257
            + H+ ++T +  S+   +L  + S DKT  +W L   D  + +   +  GH   V DCA
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCA 72

Query: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALN 301
            +AD AY ++AS D  +RLWD++T E  +++ GH    + VA++
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAID 116

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 115 HNAPVNEVVIHPNQGELI-SCDRDGNIRIWDL-GENQCTHQLTPEDNTPLQSL------- 165
           HN  V  +     Q  L+ S  RD  +  W L G++Q       +   P++S        
Sbjct: 16  HNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQ-------QYGVPVRSFKGHSHIV 68

Query: 166 ---SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL 222
              ++ +DG+  ++A+      +W      D +  +   +F  H + +  + +      +
Sbjct: 69  QDCALTADGAYALSASWDKTLRLW------DVATGETYQRFVGHKSDVMSVAIDRKASMI 122

Query: 223 ATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAF------SADSAYLVTASSDHYVRL 276
            + S DKT + W++    +  +T+ GH  WV           + D+  +++A  D  V+ 
Sbjct: 123 ISGSRDKTVKVWTIKG--QCLATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVKA 180

Query: 277 WDLSTREIVRQYGGHH 292
           W+++  +I   + GH+
Sbjct: 181 WNVNQFQIEADFIGHN 196

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 109/252 (43%), Gaps = 17/252 (6%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T+P P+       +G + +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +    + P    ++   R+GN++++DL  +     +       + SL V +DG  LV  +
Sbjct: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488

Query: 179 SKGNCYVWEMPNHTD-----ASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCSAD 228
           +  +   W+     +     +    P       S       I  I +S D K LA    D
Sbjct: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548

Query: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
            T + + LD + K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 549 NTVKVFFLD-SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607

Query: 289 GGHHKGAICVAL 300
             H    +CV  
Sbjct: 608 FAHQDSIMCVKF 619

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 119/292 (40%), Gaps = 28/292 (9%)

Query: 28  IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDN 87
           +Q S + V  ++I++D  LL  A +  ++++++ T   + + TFE   G   +  F    
Sbjct: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438

Query: 88  RWMVTSSEDGTIKVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498

Query: 146 GENQ---------------CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPN 190
              Q                 H  T E    + S+ ++ D   L  +       V+ +  
Sbjct: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-- 556

Query: 191 HTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQ 250
                ++K       H   +  + +S D K + T SADK  + W LD       +L  HQ
Sbjct: 557 ----DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611

Query: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVALND 302
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 120/293 (40%), Gaps = 31/293 (10%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   +  ++ W   T  C RT +   +   +  +     ++      N++L+D+ ++ 
Sbjct: 401 LLATASNGELKIWNLNTKSCIRTFECGYALTCKF-LPGGLLVVVGTREGNLQLFDLASSV 459

Query: 65  PNPVATFEG-HKGNVTSLSFQQDNRWMVTSSEDGTIKVWD--VRSPSVPRNYKHNAPVNE 121
              + T E  H+G + SL    D + +VT S D +IK WD  V+   +        P   
Sbjct: 460 L--LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517

Query: 122 VVIHPNQGEL--------ISCD--------RDGNIRIWDLGENQCTHQLTPEDNTPLQSL 165
           +V H +  EL        IS D         D  ++++ L   +    L      P+ SL
Sbjct: 518 IV-HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSL 575

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
            ++ D  +++ +++  N  +W + +  D           AH + I  +       +  + 
Sbjct: 576 DISDDTKVIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMCVKFLPGSHNFFSA 629

Query: 226 SADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
           S D   + W   D F+    L  HQ  VW  A S +   +V+ S DH +R+W+
Sbjct: 630 SKDGFVKYWD-GDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 101/227 (44%), Gaps = 15/227 (6%)

Query: 33  SQVNRLEITNDKKLLGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWM 90
           ++V+ L+  ++  L+ AAG+ +  ++L+D+   +   + +F GHK  +T L F +    +
Sbjct: 78  AEVSYLQFHSETGLI-AAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134

Query: 91  VTSSEDGTIKVWDVRSP-SVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193

Query: 150 CTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTD-ASNLKPVTKFKAHSN 208
           C             +L + +D   +V +++     +W+M    +  S L     F+  S 
Sbjct: 194 CIETHIAH-TGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSK 250

Query: 209 Y----ITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQR 251
                I     S  V      +ADKT   + L  + ++   +   ++
Sbjct: 251 QRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREK 297

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/254 (18%), Positives = 107/254 (42%), Gaps = 24/254 (9%)

Query: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLGAAGHQNVRLYDI 60
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498

Query: 61  RTTNPNPVATFEGH--------------KGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRS 106
           +        T + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558

Query: 107 PSVPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSL 165
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    ++ +  +
Sbjct: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS-IMCV 617

Query: 166 SVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATC 225
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671

Query: 226 SADKTARTWSLDDN 239
           S D + R W   D+
Sbjct: 672 SHDHSIRIWEETDD 685

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 82/196 (41%), Gaps = 21/196 (10%)

Query: 53  QNVRLYDIRTTN----------PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVW 102
           +N+ ++D++T+           P  V         V+ L F  +   +     DG IK+W
Sbjct: 45  ENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLW 104

Query: 103 DVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTP 161
           D+ S +V  ++  H + +  +       +LIS   D NI +WDL      ++L     T 
Sbjct: 105 DLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGT- 163

Query: 162 LQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKH 221
           +  L   SD + L++ +  G   VW++         + +    AH+     + + +D   
Sbjct: 164 ITGLWCDSD-NWLISTSKDGLIKVWDLKTQ------QCIETHIAHTGECWALGIMTD--F 214

Query: 222 LATCSADKTARTWSLD 237
           + T SAD   + W +D
Sbjct: 215 VVTSSADSQLKIWQMD 230

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 99  IKVWDVRS-----------PSVPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106

Query: 146 GENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKA 205
                         + +  L     G+ L++ +   N  VW++ +         + K ++
Sbjct: 107 VSKTVLLSFNGH-KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159

Query: 206 HSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDC-AFSADSAY 264
           H   IT +   SD   L + S D   + W L    K +  ++ H     +C A    + +
Sbjct: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVWDL----KTQQCIETHIAHTGECWALGIMTDF 214

Query: 265 LVTASSDHYVRLWDL 279
           +VT+S+D  +++W +
Sbjct: 215 VVTSSADSQLKIWQM 229

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 55/142 (38%), Gaps = 47/142 (33%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L+S   D  I  W+ ++                                 V LY +R+  
Sbjct: 134 LISGSEDSNIIVWDLVS--------------------------------EVGLYKLRS-- 159

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNEVV 123
                    HKG +T L    DN W++++S+DG IKVWD+++   +  +  H      + 
Sbjct: 160 ---------HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALG 209

Query: 124 IHPNQGELISCDRDGNIRIWDL 145
           I  +   +++   D  ++IW +
Sbjct: 210 IMTDF--VVTSSADSQLKIWQM 229

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 107/231 (46%), Gaps = 17/231 (7%)

Query: 63  TNPNPVAT----FEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP 118
           T P P+        G + ++ S S   DN+ + T+S +G++K+W++++    R+++    
Sbjct: 372 TQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATAS-NGSLKIWNIKTKRCIRSFECGYA 430

Query: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAAN 178
           +    + P    ++   R+G ++++D+  +          +  + SL + SDG  LV  +
Sbjct: 431 LTCKFL-PGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGS 489

Query: 179 SKGNCYVW-----EMPNHTDASNLKPVTKFKAHSNY-----ITRILLSSDVKHLATCSAD 228
           +      W     E+P   +++   P+ +    +       I  +++S D K +A    D
Sbjct: 490 ADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLD 549

Query: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
            T + + LD + K   +L GH+  V     S DS  +VT S+D  +++W L
Sbjct: 550 NTVKVFFLD-SMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 118/292 (40%), Gaps = 29/292 (9%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L++   + +++ W   T  C R+ +   +   +        ++G    + ++L+DI ++ 
Sbjct: 402 LLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGE-LQLFDIASST 460

Query: 65  PNPVATFEG-HKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAP----- 118
              +   EG H   + SL    D R +VT S D T++ W      VP + + N       
Sbjct: 461 M--LDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQ 518

Query: 119 ------------VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLS 166
                       +  VVI P+   +     D  ++++ L   +    L      P+ S+ 
Sbjct: 519 LFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSMD 577

Query: 167 VASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCS 226
           ++ D  ++V  ++  N  +W + +  D           AH + I  +    +  +  +CS
Sbjct: 578 ISYDSKLIVTCSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMNVKFLPESYNFFSCS 631

Query: 227 ADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278
            D T + W     F+    L  HQ  VW  + S D  ++++   DH +R+W+
Sbjct: 632 KDATVKYWD-GQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 115/270 (42%), Gaps = 28/270 (10%)

Query: 40  ITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTI 99
           I++D KLL  A + ++++++I+T     + +FE   G   +  F      +V  + +G +
Sbjct: 396 ISDDNKLLATASNGSLKIWNIKT--KRCIRSFEC--GYALTCKFLPGGALVVVGTRNGEL 451

Query: 100 KVWDVRSPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN--------- 148
           +++D+ S ++  N +  H+A +  + +  +  +L++   D  +R W    +         
Sbjct: 452 QLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESN 511

Query: 149 ------QCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTK 202
                 Q  H  T E +  + S+ ++ D   +  +       V+ +       ++K    
Sbjct: 512 KTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFL------DSMKFFLS 565

Query: 203 FKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADS 262
              H   +  + +S D K + TCSADK  + W LD       +L  HQ  + +  F  +S
Sbjct: 566 LYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFG-DCHKSLFAHQDSIMNVKFLPES 624

Query: 263 AYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
               + S D  V+ WD    E +++   H 
Sbjct: 625 YNFFSCSKDATVKYWDGQKFECIQKLAAHQ 654

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 96/220 (43%), Gaps = 8/220 (3%)

Query: 47  LGAAGHQN--VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
           L AAG+ +  ++++D+   +   + +F GHK  +T L+F      ++++S+D  I VWD+
Sbjct: 93  LLAAGYADGVIKIWDL--ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL 150

Query: 105 RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQS 164
              S     + +      +   ++  LIS  +DG ++IWDL   QC             S
Sbjct: 151 VGESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG-ECWS 209

Query: 165 LSVASDGSMLVAANSKGNCYVWEM--PNHTDASNLKPVTKFKAHSNYITRILLSSD-VKH 221
           L +  D ++  +A+S+   +  ++   N +  +    + K            ++ D VK 
Sbjct: 210 LGIIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKF 269

Query: 222 LATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSAD 261
               +ADKT   + L    ++   L   ++ + D   S +
Sbjct: 270 FYIQNADKTIEIYRLRKEEEISRALKKREKRLQDKGMSEE 309

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHSDSQVNRLEI-TNDKKLLGAAGHQNVRLYDIRT 62
           L++AGY D  I+ W+ ++     +     S +  L   T   +L+ A+   ++ ++D+  
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDL-- 150

Query: 63  TNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPS-VPRNYKHNAPVNE 121
              + +     HK  +T L + +D  W++++S+DG +K+WD++S   V  +  H      
Sbjct: 151 VGESGLYKLRSHKDAITGL-WCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWS 209

Query: 122 VVIHPNQGELISCDRDGNIRIWDL 145
           + I  +    ++C  D  +++W L
Sbjct: 210 LGIIEDMA--VTCSADSQVKLWKL 231

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 24/194 (12%)

Query: 99  IKVWDVRS-----------PSVPRNYKHNAPVNEVVI--HPNQGELISCDRDGNIRIWDL 145
           I VWD+++           P    + K + P     +  HP    L +   DG I+IWDL
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 146 GENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKA 205
                         + +  L+  + G+ L++A+   +  VW++   +       + K ++
Sbjct: 109 ISKTVLISFNGH-KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESG------LYKLRS 161

Query: 206 HSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYL 265
           H + IT  L   D   L + S D   + W L     +E+ L  H    W      D A  
Sbjct: 162 HKDAITG-LWCEDENWLISTSKDGLVKIWDLKSQQCVETHL-AHTGECWSLGIIEDMA-- 217

Query: 266 VTASSDHYVRLWDL 279
           VT S+D  V+LW L
Sbjct: 218 VTCSADSQVKLWKL 231

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 80/200 (40%), Gaps = 21/200 (10%)

Query: 49  AAGHQNVRLYDIRTTN----------PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGT 98
             G +N+ ++DI+T            P             T L +  +   +     DG 
Sbjct: 43  VGGLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGV 102

Query: 99  IKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPE 157
           IK+WD+ S +V  ++  H + +  +        LIS  +D +I +WDL      ++L   
Sbjct: 103 IKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSH 162

Query: 158 DNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS 217
            +  +  L    D + L++ +  G   +W++ +       + V    AH+     + +  
Sbjct: 163 KDA-ITGLW-CEDENWLISTSKDGLVKIWDLKSQ------QCVETHLAHTGECWSLGIIE 214

Query: 218 DVKHLATCSADKTARTWSLD 237
           D+    TCSAD   + W LD
Sbjct: 215 DMA--VTCSADSQVKLWKLD 232

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 60/118 (50%), Gaps = 4/118 (3%)

Query: 35  VNRLEITNDKKLL-GAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTS 93
           V  ++I+ D KL+   +  +N++++ +   + +   +   H+ ++ ++ F  ++    + 
Sbjct: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK--SLFAHQDSIMNVKFLPESYNFFSC 630

Query: 94  SEDGTIKVWD-VRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150
           S+D T+K WD  +   + +   H + V  + +  +   +IS   D +IR+W+  E+Q 
Sbjct: 631 SKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQV 688

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 52/125 (41%), Gaps = 9/125 (7%)

Query: 160 TPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDV 219
           T ++S S++ D  +L  A S G+  +W +         + +  F+       + L    +
Sbjct: 389 TDIRSTSISDDNKLLATA-SNGSLKIWNIKTK------RCIRSFECGYALTCKFLPGGAL 441

Query: 220 KHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
             + T + +   + + +  +  L++    H   +W    ++D   LVT S+D  VR W  
Sbjct: 442 VVVGTRNGE--LQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTF 499

Query: 280 STREI 284
              E+
Sbjct: 500 EVSEV 504

>KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}
           Anc_2.663 YKL021C
          Length = 389

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 118/265 (44%), Gaps = 35/265 (13%)

Query: 46  LLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSF---QQDNRWMVTSSEDGTIKVW 102
           L+  +  +++R+YD++      + T   H+G++T+L F   + + +WM++SSED  I +W
Sbjct: 55  LVSGSNDEHIRIYDLQ--KRKELGTLLAHQGSITALKFSSGESNGKWMLSSSEDNKIIIW 112

Query: 103 DVRSPSVPRNYK----HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPED 158
            V+      NY     H   VN++ IHP+    +S   D +IR+W+L        +T + 
Sbjct: 113 RVKDW---ENYGVLKGHLKRVNDIAIHPSSRVAVSVSDDHSIRLWNL--------MTMKK 161

Query: 159 NTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSS- 217
              L+      +G  +   ++  +  V  M      S       F+   +  T + L + 
Sbjct: 162 AAVLKLRKYDQNGQFVRWTDNGDHFAVALMTKLLIFSTANAKVHFEVDISKKTIMHLETV 221

Query: 218 -----DVKHLATCSADKTARTWSLDDNFKLEST-------LDGHQRWVWDCAFSAD--SA 263
                D ++L    +D   + + +D+  K E T       L GH   + D  F  +    
Sbjct: 222 KLGDEDREYLVVGLSDGNVQFYPVDELIKEEPTITEPEFSLLGHSNRIKDFKFYPNDFGT 281

Query: 264 YLVTASSDHYVRLWDLSTREIVRQY 288
           YL+T  SD  + +WD+ T++ V  Y
Sbjct: 282 YLITIGSDGRIVVWDMKTKDQVAVY 306

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 132/300 (44%), Gaps = 51/300 (17%)

Query: 30  HSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRW 89
           H+ S V  L+  +D  + GA   Q +R+YD R+     +    GH+G V +L +  D   
Sbjct: 354 HATSVVTCLQFEDDYVITGADDRQ-LRIYDARSKKF--LKELSGHEGGVWALKYDADG-I 409

Query: 90  MVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVN--EVVIHPNQGELISCDRDGNIRIWDL- 145
           +V+ S D ++++WD++       +K H + V   E+V + N   +++  RD  + +W L 
Sbjct: 410 IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLI 469

Query: 146 GENQCTHQL-----TPEDNTPLQSL---------SVASDGSMLVAANSKGNCYVWEMPNH 191
            E +   +L     TPE+N     +         +++  G+++++ +   N  VW     
Sbjct: 470 KEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGNIVISGSYDNNLMVW----- 524

Query: 192 TDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDD-----NFKLES-- 244
            D + +K +     H++ I   +     +   + S D T + W LD+     N  + +  
Sbjct: 525 -DIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNS 583

Query: 245 ------------TLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHH 292
                       TL GH   V     S    YLV+A++D  +R WD  + +  R++  HH
Sbjct: 584 ATPCTKITGSMLTLQGHTALVGLLRLS--DKYLVSAAADGSLRGWD--SNDYSRKFSYHH 639

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 92/223 (41%), Gaps = 17/223 (7%)

Query: 70  TFEGHKGNV-TSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPNQ 128
           T  GH  +V T L F+ D  +++T ++D  ++++D RS    +    +      + +   
Sbjct: 350 TLTGHATSVVTCLQFEDD--YVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDAD 407

Query: 129 GELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQSLSVASDGSM--LVAANSKGNCYVW 186
           G ++S   D ++RIWD+    CTH      +T ++ L + +  +M  +V  +     +VW
Sbjct: 408 GIIVSGSTDRSVRIWDIKRGCCTHVFKGHTST-VRCLEIVTYKNMKYIVTGSRDNTLHVW 466

Query: 187 EMPNHTDASNLKPVTKFKAHSN-YITRIL---------LSSDVKHLATCSADKTARTWSL 236
           ++          P+       N Y   +L         +S     + + S D     W +
Sbjct: 467 KLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGNIVISGSYDNNLMVWDI 526

Query: 237 DDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279
               K    L GH   ++   +       ++AS D  +++WDL
Sbjct: 527 -AQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDL 568

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 94/250 (37%), Gaps = 46/250 (18%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK--KLLGAAGHQNV------ 55
           I+VS   D ++R W+   G C+   +   S V  LEI   K  K +      N       
Sbjct: 409 IIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKL 468

Query: 56  -----------RLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
                       +Y+    NP  V    GH  +V ++S   +   +++ S D  + VWD+
Sbjct: 469 IKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGN--IVISGSYDNNLMVWDI 526

Query: 105 -RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDL----GENQCT-------- 151
            +   +     H   +   +    +   IS   D  I++WDL        CT        
Sbjct: 527 AQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATP 586

Query: 152 ------HQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVWEMPNHTDA-----SNLKPV 200
                   LT + +T L  L   SD   LV+A + G+   W+  +++       +NL  +
Sbjct: 587 CTKITGSMLTLQGHTALVGLLRLSD-KYLVSAAADGSLRGWDSNDYSRKFSYHHNNLSAI 645

Query: 201 TKFKAHSNYI 210
           T F  + N +
Sbjct: 646 TTFYMNDNIL 655

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 94/220 (42%), Gaps = 25/220 (11%)

Query: 4   ILVSAGYDHTIRFWEALTGVCSRT-IQHSDSQVNRLEITNDKKLLGAAGHQNVRLYD--- 59
           I++S  YD+ +  W+     C    I H+D   + +     ++ + A+    ++++D   
Sbjct: 511 IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDN 570

Query: 60  --------IRTTNPNP-------VATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDV 104
                   I T +  P       + T +GH   V  L     ++++V+++ DG+++ WD 
Sbjct: 571 IWNNGNCTIITNSATPCTKITGSMLTLQGHTALVGLLRLS--DKYLVSAAADGSLRGWDS 628

Query: 105 RSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDNTPLQS 164
              S   +Y HN        + N   L+S   +G   +++L   +  H     D    Q 
Sbjct: 629 NDYSRKFSYHHNNLSAITTFYMNDNILVS-GSEGQFNVYNLRTGKLVHSDLLRDAD--QI 685

Query: 165 LSVASDGSMLVAANSKGNCYVWEMPNHTDASNLKPVTKFK 204
            SV   GS+LVAA  K      EM + +  S  KP+++ +
Sbjct: 686 WSVDFKGSLLVAAVEKDGESFIEMLDFSIPSP-KPISEVE 724

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 3/100 (3%)

Query: 201 TKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAFSA 260
           T    H+  +   L   D  ++ T + D+  R +      K    L GH+  VW   + A
Sbjct: 349 TTLTGHATSVVTCLQFED-DYVITGADDRQLRIYDARSK-KFLKELSGHEGGVWALKYDA 406

Query: 261 DSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAICVAL 300
           D   +V+ S+D  VR+WD+        + GH     C+ +
Sbjct: 407 D-GIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEI 445

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 240 FKLE-STLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295
           FK E +TL GH   V  C    D  Y++T + D  +R++D  +++ +++  GH  G 
Sbjct: 344 FKPERTTLTGHATSVVTCLQFEDD-YVITGADDRQLRIYDARSKKFLKELSGHEGGV 399

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 130/298 (43%), Gaps = 24/298 (8%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN-VRLYDIRTT 63
           +V+   D+T R W+  T     T++   + V  +    D +L+      N +RL+D    
Sbjct: 158 MVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKG 217

Query: 64  NPNPVATFEGHKGNVTSLSFQQ-------DNRWMVTSSEDGTIKVWDV-RSPSVPRNYKH 115
                A   GH   +TSL+++        D   + ++S+DGTIK+WD  R   V     H
Sbjct: 218 ESYGEA-LRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGH 276

Query: 116 NAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN-QCTHQLTPEDNTPLQSLSVASDGSML 174
              V+  V    +G L S   D  IR WD+    +C + L    +  +  LS+ +D ++ 
Sbjct: 277 TNSVS-CVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHW-INHLSLNTDYALR 334

Query: 175 VAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHL-ATCSADKTART 233
           V A      +  E P+  + +      + KA  NY      +  ++ L  T S D T   
Sbjct: 335 VGAFD----HTGEKPSSPEEA------RAKALKNYEKIAKKNGQLEELMVTASDDFTMYL 384

Query: 234 WSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291
           W      K  + + GHQ+ V   AFS D  Y+V+AS D+ ++LWD      +  + GH
Sbjct: 385 WDPLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGH 442

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 114/278 (41%), Gaps = 20/278 (7%)

Query: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQNVRLYDIRTTN 64
           L SA  D TI+ W+    VC  T+    + V+ ++      L   +  + +R +D+    
Sbjct: 250 LASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDM-AAG 308

Query: 65  PNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVI 124
              +   + H   +  LS   D    V + +    K      PS P   +  A  N   I
Sbjct: 309 GKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEK------PSSPEEARAKALKNYEKI 362

Query: 125 HPNQGEL----ISCDRDGNIRIWD-LGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANS 179
               G+L    ++   D  + +WD L  ++   ++T      +  ++ + DG  +V+A+ 
Sbjct: 363 AKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKL-VNHVAFSPDGRYIVSASF 421

Query: 180 KGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDN 239
             +  +W      D  N   +  F+ H   + ++  SSD + L +CS D T + W +   
Sbjct: 422 DNSIKLW------DGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTK 475

Query: 240 FKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLW 277
            KL   L GH   V+   +S D   + +A  D  VR+W
Sbjct: 476 -KLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/304 (20%), Positives = 127/304 (41%), Gaps = 32/304 (10%)

Query: 4   ILVSAGYDHTIRFW---------EALTGVCSRTIQHSDSQVNRLEITNDKKLLGAAGHQN 54
           ++ +   D+TIR W         EAL G        +   ++ ++  +  +L  A+    
Sbjct: 199 LIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGT 258

Query: 55  VRLYDIRTTNPNPVATFEGHKGNVTSLSFQQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK 114
           ++++D  TT    V T  GH  +V+ + +      + + S D TI+ WD+ +        
Sbjct: 259 IKIWD--TTRRVCVLTLSGHTNSVSCVKWGGRGI-LYSGSHDKTIRAWDMAA-------- 307

Query: 115 HNAPVNEVVIHPNQGELISCDRDGNIRIWDL---GENQCTHQLTPEDNTPLQSLSVASDG 171
               +N +  H +    +S + D  +R+      GE   + +                +G
Sbjct: 308 GGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNG 367

Query: 172 ---SMLVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSAD 228
               ++V A+     Y+W+    +     KP+T+   H   +  +  S D +++ + S D
Sbjct: 368 QLEELMVTASDDFTMYLWDPLKAS-----KPITRMTGHQKLVNHVAFSPDGRYIVSASFD 422

Query: 229 KTARTWSLDDNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288
            + + W    N    +T  GH   V+  A+S+D   LV+ S D  +++WD+ T+++    
Sbjct: 423 NSIKLWD-GRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDL 481

Query: 289 GGHH 292
            GH+
Sbjct: 482 PGHN 485

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 96/224 (42%), Gaps = 42/224 (18%)

Query: 4   ILVSAGYDHTIRFWE-ALTGVCSRTIQHSDSQVNRLEITNDKKL-LGAAGH--------- 52
           IL S  +D TIR W+ A  G C   ++     +N L +  D  L +GA  H         
Sbjct: 290 ILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPE 349

Query: 53  ---------------QNVRLYDIRTTNPN--------------PVATFEGHKGNVTSLSF 83
                          +N +L ++  T  +              P+    GH+  V  ++F
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 84  QQDNRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRI 142
             D R++V++S D +IK+WD R+ +    ++ H A V +V    +   L+SC +D  +++
Sbjct: 410 SPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKV 469

Query: 143 WDLGENQCTHQLTPEDNTPLQSLSVASDGSMLVAANSKGNCYVW 186
           WD+   + +  L P  N  + ++  + DG  + +A       +W
Sbjct: 470 WDVRTKKLSVDL-PGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 54/132 (40%), Gaps = 13/132 (9%)

Query: 174 LVAANSKGNCYVWEMPNHTDASNLKPVTKFKAHSNYITRILLSSDVKHLATCSADKTART 233
           +V  +      +W+   +T      P+   K H N++  +    D + +AT S D T R 
Sbjct: 158 MVTGSGDNTARIWDCNTNT------PMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRL 211