Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H022708.322ON26826814210.0
YLR128W (DCN1)8.322ON2692616406e-83
NDAI0G025908.322ON2862866131e-78
TDEL0F044808.322ON2602615893e-75
KNAG0G024408.322ON2652645884e-75
TPHA0C008208.322ON2662705678e-72
CAGL0M04257g8.322ON2732775548e-70
Kpol_1036.688.322ON2562575223e-65
Kwal_56.239148.322ON2652584964e-61
SAKL0H15576g8.322ON2822614862e-59
ZYRO0F10362g8.322ON2512654642e-56
NCAS0C032708.322ON1841854538e-56
TBLA0A039308.322ON2662654461e-53
Skud_12.1978.322ON1791804285e-52
KLTH0G12320g8.322ON2542534339e-52
KLLA0D16346g8.322ON3012724351e-51
Ecym_42538.322ON2582624312e-51
Suva_10.2218.322ON1781804093e-49
AGL194C8.322ON2562654042e-47
Smik_12.1918.322ON1251232889e-32
KNAG0A019908.537ON59051711.9
YGR019W (UGA1)4.155ON47164693.1
Smik_7.3064.155ON47164693.1
Kwal_55.200115.402ON3725131693.7
Ecym_46987.377ON39451683.9
Suva_2.5845.506ON129186684.9
KLLA0C02189g1.76ON1380123675.6
ABR211C7.377ON38954666.3
Kpol_1056.32.571ON53050667.5
TPHA0I005908.799ON1591156659.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H02270
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   551   0.0  
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   251   6e-83
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   240   1e-78
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   231   3e-75
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   231   4e-75
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   223   8e-72
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   218   8e-70
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   205   3e-65
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   195   4e-61
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   191   2e-59
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   183   2e-56
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   179   8e-56
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   176   1e-53
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   169   5e-52
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   171   9e-52
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   172   1e-51
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   170   2e-51
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   162   3e-49
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   160   2e-47
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...   115   9e-32
KNAG0A01990 Chr1 (159879..161651) [1773 bp, 590 aa] {ON} Anc_8.5...    32   1.9  
YGR019W Chr7 (525229..526644) [1416 bp, 471 aa] {ON}  UGA1Gamma-...    31   3.1  
Smik_7.306 Chr7 (516574..517989) [1416 bp, 471 aa] {ON} YGR019W ...    31   3.1  
Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa]...    31   3.7  
Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar...    31   3.9  
Suva_2.584 Chr2 complement(1035617..1039492) [3876 bp, 1291 aa] ...    31   4.9  
KLLA0C02189g Chr3 (178544..182686) [4143 bp, 1380 aa] {ON} simil...    30   5.6  
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    30   6.3  
Kpol_1056.3 s1056 (4599..6191) [1593 bp, 530 aa] {ON} (4599..619...    30   7.5  
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    30   9.8  

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/268 (100%), Positives = 268/268 (100%)

Query: 1   MVKSMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRR 60
           MVKSMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRR
Sbjct: 1   MVKSMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRR 60

Query: 61  AVYPKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYR 120
           AVYPKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYR
Sbjct: 61  AVYPKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYR 120

Query: 121 DDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMD 180
           DDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMD
Sbjct: 121 DDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMD 180

Query: 181 IAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLES 240
           IAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLES
Sbjct: 181 IAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLES 240

Query: 241 LKESYDENDPWPFVIDEFYEYLQDTGKL 268
           LKESYDENDPWPFVIDEFYEYLQDTGKL
Sbjct: 241 LKESYDENDPWPFVIDEFYEYLQDTGKL 268

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  251 bits (640), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 124/261 (47%), Positives = 175/261 (67%), Gaps = 5/261 (1%)

Query: 4   SMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVY 63
           S E+EAI  F   T+C+P ++RKYL +N WNINYALND+YD E+G FT E        VY
Sbjct: 12  SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVY 71

Query: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
           PKEL Q+F  Y + + + D   ++K I++ G  +EDLAT+CLAH+L ++ L++ + R+DF
Sbjct: 72  PKELTQVFEHYINNNLF-DIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDF 130

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
           L   F QGC T++D++  +K L+ KL+ D  YFT IYN++F LILD + ++  ID D  I
Sbjct: 131 LSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKD--IDTDEGI 188

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243
           +YWKLFF  E    V +  +LL  WF+FL DE K  +SKD W+M+L FF+++  ++ +  
Sbjct: 189 QYWKLFFQPEY--PVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIIS 246

Query: 244 SYDENDPWPFVIDEFYEYLQD 264
            YDE   WPF+IDEFYE LQD
Sbjct: 247 DYDETAAWPFIIDEFYECLQD 267

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  240 bits (613), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 128/286 (44%), Positives = 180/286 (62%), Gaps = 40/286 (13%)

Query: 23  MARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAV-------YPKELVQLFRDYC 75
           MA+KYLS+N W +NYALN++YD E+G F  + +  +           YP+EL+ LF+ Y 
Sbjct: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYS 60

Query: 76  SEDT-----YIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQ 130
           S++      +ID  G+I  I D    +EDL TICLA +LH ENL+D I +  FL   + Q
Sbjct: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120

Query: 131 GCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILD----DDTRNQS---------- 176
           GC T+  ++ VL DL+ KL+ D +YFT IYN++F LI+D    D TRN +          
Sbjct: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180

Query: 177 --------------IDMDIAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSK 222
                         +D++ AI YWK+FF       V+++ ELLSLWFQFL +ERKK+++K
Sbjct: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKEITK 240

Query: 223 DIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTGKL 268
           D WQM+LEFF+KF +LE +K++YDE   WP++IDEFYEYLQDTG++
Sbjct: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  231 bits (589), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 169/261 (64%), Gaps = 8/261 (3%)

Query: 6   EEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPK 65
           +++ +  F+  TQCE   A+ +L +N+W + YALND+YD   GGF +E    +    YP+
Sbjct: 4   KDDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEE---PHTPVTYPE 60

Query: 66  ELVQLFRDYCSED-TYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFL 124
           EL+ L+  Y  ED   ID  GMI+LI+D    +EDL TICLA +LH   L D I +D FL
Sbjct: 61  ELLALYDKYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFL 120

Query: 125 QYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIE 184
              + QGC T+  ++ VL DL+ KL+TD  Y T IYN++F L LD + R+  +D D A E
Sbjct: 121 HNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRD--LDTDTAAE 178

Query: 185 YWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKES 244
           YW+LFF  +   +V ++  LL+ W  FL  E+K  V++D W+M+LEFF++F  L ++K S
Sbjct: 179 YWRLFF--QPGTAVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVKTS 236

Query: 245 YDENDPWPFVIDEFYEYLQDT 265
           Y+E D WP++IDE+YEYL+D+
Sbjct: 237 YNEADAWPYIIDEYYEYLEDS 257

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  231 bits (588), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 166/264 (62%), Gaps = 6/264 (2%)

Query: 5   MEEEAIVHFIGFTQC-EPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNR-RAV 62
           MEE+AI  FI  TQC +   A +YL ++ WN+NYALNDFYD E+G F   ++   +   V
Sbjct: 1   MEEDAIHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVV 60

Query: 63  YPKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDD 122
           YP EL+ +F  Y SE   I F+GMI  I D  L+I+DL TICLA +L WENL   I R+ 
Sbjct: 61  YPPELIHVFDQY-SEAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQ 119

Query: 123 FLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIA 182
           FL   F QGC T+N++K VL DLN KL  D  YF  IY ++F L+++ D     +D    
Sbjct: 120 FLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPD--QNKLDAAST 177

Query: 183 IEYWKLFFLNESIQSVEISNELLSLWFQFLADERKK-QVSKDIWQMILEFFRKFKDLESL 241
           IEYWKLFF  E    + I  ELL  WF +L ++ +   V++DIW+M+ +FF +F+ L  +
Sbjct: 178 IEYWKLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDV 237

Query: 242 KESYDENDPWPFVIDEFYEYLQDT 265
           K+ YDE   WP +IDEF EYLQDT
Sbjct: 238 KQGYDEMAAWPILIDEFIEYLQDT 261

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  223 bits (567), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 166/270 (61%), Gaps = 20/270 (7%)

Query: 10  IVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKELVQ 69
           +  F   T     +ARKYLS N WN+NYALN+FYD ELGGF  +  R      YP EL++
Sbjct: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPRE-----YPAELIE 59

Query: 70  LFRDYCS-----------EDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKI 118
           LF  Y +           ED  ID  G+I+ I+D G  +EDL T+CLA+++   NL D I
Sbjct: 60  LFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCI 119

Query: 119 YRDDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSID 178
            R+ FL+  + + C  + DIK  L+ + E L +D  YFT IYN+SFGLI +++ +  SI 
Sbjct: 120 TRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMK--SIQ 177

Query: 179 MDIAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDL 238
           +D A EYWKLFF + +   + I  E L  W +FL    KK ++KD W+MILEFF+KF  +
Sbjct: 178 IDTAKEYWKLFFGDGT--PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTV 235

Query: 239 ESLKESYDENDPWPFVIDEFYEYLQDTGKL 268
              K+ YD  DPWP+++DE++EYL++ GKL
Sbjct: 236 TEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  218 bits (554), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 168/277 (60%), Gaps = 13/277 (4%)

Query: 1   MVKSMEEEAIVHFIGFTQC-EPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNR 59
           MV   E+E +  F   T C +   A++YLS N WNINYALN++YD E+GGFT++H     
Sbjct: 1   MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDH-MIRH 59

Query: 60  RAVYPKELVQLFRDYCS---EDTY--IDFQGMIKLIKDCGLAIEDLATICLAHILHWENL 114
           +  YP ELV LF  Y +   ED    I   G+I  I+D G  +EDL TI LAH L  +NL
Sbjct: 60  QFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNL 119

Query: 115 QDKIYRDDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRN 174
           ++ I    FL + + +GC T+  ++  L+D   KL  D  YFTTIYN+SF L   + ++ 
Sbjct: 120 ENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDL---NASKQ 176

Query: 175 QSIDMDIAIEYWKLFFLNESIQ---SVEISNELLSLWFQFLADERKKQVSKDIWQMILEF 231
             ++ DIAIEYWKLFF     +    +++    L LW +FL DE KK + KD WQM+L F
Sbjct: 177 GVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLIHKDTWQMLLLF 236

Query: 232 FRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTGKL 268
           F+KF  L+++K  Y+E D WP+ IDEFYEYL++   L
Sbjct: 237 FKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL 273

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  205 bits (522), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 165/257 (64%), Gaps = 9/257 (3%)

Query: 13  FIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKELVQLFR 72
           FIG T C+  +A KYL +N WN+NYALN++YD E+G F  E E           L+Q+F+
Sbjct: 8   FIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEE----LIQIFK 63

Query: 73  DYCSEDT-YIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQG 131
            Y +++   ID  G I+LI D    +ED+ TICLA ++H ++L   I +D FL   +EQG
Sbjct: 64  KYSNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQG 123

Query: 132 CCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFL 191
           C  +  +K++L DL+ KL  D  Y+T IY +SF LI   D+  + I+ D+AIEYWKLFF 
Sbjct: 124 CSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLI--RDSNEKCIEKDMAIEYWKLFF- 180

Query: 192 NESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPW 251
             S   + I+   L+ W +F+     + +++D+W+ +LE+F+K+  LE L ++Y+E DPW
Sbjct: 181 -SSKCPITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPW 239

Query: 252 PFVIDEFYEYLQDTGKL 268
           P+++DE+YE+L+DT ++
Sbjct: 240 PYIMDEYYEFLEDTKRI 256

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  195 bits (496), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 100/258 (38%), Positives = 159/258 (61%), Gaps = 10/258 (3%)

Query: 10  IVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKELVQ 69
           +  F+  T+C   +A+++LS N W ++YALND+YD+  GGFT +         Y  EL++
Sbjct: 15  VEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRP------YSPELLK 68

Query: 70  LFRDYCSED-TYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLF 128
           +F+ Y SED   I   G+ + I+D GL +ED  T+CLA ++   +LQ+ I  D F+Q   
Sbjct: 69  VFQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWH 128

Query: 129 EQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKL 188
           ++ C   ND+K+ +K+L +KL TD +YF +IYN++F L L  + + + + ++ +I YW+L
Sbjct: 129 DRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLAL--EPQQKQLGLETSIAYWEL 186

Query: 189 FFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDEN 248
            F      ++++  E L  W Q+L+ E  K V +D+W+M L+F   F D E+LK+ Y E+
Sbjct: 187 LFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSED 245

Query: 249 DPWPFVIDEFYEYLQDTG 266
           D WP VIDE+YEYL   G
Sbjct: 246 DAWPLVIDEYYEYLVARG 263

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  191 bits (486), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 152/261 (58%), Gaps = 11/261 (4%)

Query: 7   EEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAV-YPK 65
           +E I  F+  T C    A KYLS+N W ++YALN++YD + GGF       N++ V Y  
Sbjct: 27  KETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFV------NKKPVKYSH 80

Query: 66  ELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQ 125
           ELV+ F  Y      I  + ++K I+D G  +EDLATICLA +L  E +   I    FL 
Sbjct: 81  ELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLS 140

Query: 126 YLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEY 185
              E GC  +  +K  L+DL E+L+ D  YF+ IYN+++ LI+++  R+  +++D A EY
Sbjct: 141 SWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERH--LNIDTAAEY 198

Query: 186 WKLFFLNESIQSVEISNELLSLWFQFLADER-KKQVSKDIWQMILEFFRKFKDLESLKES 244
           W+LFF N S  +V IS+  L  W +F   +  +  V+KD W M L+F  KF D ESL   
Sbjct: 199 WELFFHN-SHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRG 257

Query: 245 YDENDPWPFVIDEFYEYLQDT 265
           YDE D WP V DE+YEY+ + 
Sbjct: 258 YDEMDAWPLVFDEYYEYMDEA 278

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  183 bits (464), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 152/265 (57%), Gaps = 18/265 (6%)

Query: 7   EEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKE 66
           E  +  F    QC    AR YL+ + W++N ALND+YDSE       H++      Y  E
Sbjct: 2   ENLVATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSE-------HDQDQS---YSPE 51

Query: 67  LVQLFRDYCSEDTY---IDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
           L QLFR Y     +   +D  G+I+ I D G  I++LATICLA +LH + L D I    F
Sbjct: 52  LPQLFRKYAVVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQF 111

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
                + GC +++ +  +++ L+ KL TD  Y   IYN++F L LD   +  +++   A+
Sbjct: 112 SYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAK--TLETHTAV 169

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243
           +YW LFF       V +  +   LW  F+  ++++ +S+D W+M+  FF +F +L+S+++
Sbjct: 170 QYWTLFFATGQY-PVIVEQQFFQLWISFV--QQEQSISRDTWRMLFPFFNRFSNLQSVRD 226

Query: 244 SYDENDPWPFVIDEFYEYLQDTGKL 268
           +Y+E D WP++IDEFYEYL D G++
Sbjct: 227 NYNEADAWPYIIDEFYEYLADKGEI 251

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  179 bits (453), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 125/185 (67%), Gaps = 4/185 (2%)

Query: 85  GMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKD 144
           G++  + D GL +EDL TICL H+LH +N++D I RD FL   F QGC  +  +K VL D
Sbjct: 3   GLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLVD 62

Query: 145 LNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFF-LNESIQSVEISNE 203
           LN+KL++D  YF  IYN++FGLI D D   + ++++ A+ YWKLF    E    V +   
Sbjct: 63  LNDKLHSDKQYFIDIYNYTFGLITDPD---KDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119

Query: 204 LLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQ 263
           LL+LWFQFL +E KK +++D W M++ FF+KF +L  +KE YDE   WP++IDE+YEYLQ
Sbjct: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179

Query: 264 DTGKL 268
           DT  +
Sbjct: 180 DTNHI 184

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  176 bits (446), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 157/265 (59%), Gaps = 6/265 (2%)

Query: 7   EEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGF-TKEHERSNR--RAVY 63
           ++ +  F+     + + A+KYL +N+W + YALNDFYD+E+G F  ++  R N+     Y
Sbjct: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64

Query: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
            + L +L+  Y  +   +  +G++KL+ D G  ++ L T+CLA ++   +    I   +F
Sbjct: 65  VRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNF 124

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
           +  L    C ++ DIK +L + + KL T+  Y+T IY+  F L+L++  +  +ID + A 
Sbjct: 125 IDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKK--TIDSETAQ 182

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243
           EYW LFF  ++   +++ ++    WF++L++   K+++KD W M+L FF+KF  L  L+ 
Sbjct: 183 EYWDLFFACQNY-PIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQR 241

Query: 244 SYDENDPWPFVIDEFYEYLQDTGKL 268
            Y E+  WP++ DE+YEYL+D  K+
Sbjct: 242 KYSEDSAWPYIFDEYYEYLEDNNKI 266

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  169 bits (428), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 124/180 (68%), Gaps = 4/180 (2%)

Query: 85  GMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKD 144
            ++K I+D G ++EDLAT+CL  +L ++NL++ + R+ FL   F QGC T+ D++  +K 
Sbjct: 3   SLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIKR 62

Query: 145 LNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFLNESIQSVEISNEL 204
           L+ KL+ D  Y+T +Y+++F LILD + +N  ID+D AI+YW LFF  + +  V I + L
Sbjct: 63  LDVKLHEDLQYYTQVYDYAFRLILDSNRKN--IDIDDAIQYWTLFF--QPVYPVHIESNL 118

Query: 205 LSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQD 264
           L  WF FL DE K  +SKD W M+L FF+++  ++S+ + YDE   WPF+IDEFYEYLQD
Sbjct: 119 LESWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQD 178

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  171 bits (433), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 141/253 (55%), Gaps = 12/253 (4%)

Query: 5   MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYP 64
           M  + I  FI  T+   + AR YLS N W + YALNDFYD+  GGFT            P
Sbjct: 1   MRNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP--------P 52

Query: 65  KELVQLFRDYC-SEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
            +L+ LF +Y   E+  I   G+I+ I D GL +ED  T+C+A  +H  +L   + ++ F
Sbjct: 53  PQLLTLFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMF 112

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
           +Q   +  C  +  IK  +K+L+EKL  D  YF  IY+F++ L L+ + +   +D++ AI
Sbjct: 113 VQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQ--LDLETAI 170

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243
            YW L F  +   +++I  + L  W  FL      ++  DIW+M L+F R F D ++LK+
Sbjct: 171 AYWHLLFPTDGAYAIQIPQKRLCSWTAFLT-RNVSRIHHDIWKMFLKFARMFPDNKTLKQ 229

Query: 244 SYDENDPWPFVID 256
            Y+E+D WP +ID
Sbjct: 230 GYNEDDAWPVLID 242

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  172 bits (435), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 161/272 (59%), Gaps = 24/272 (8%)

Query: 5   MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDS--ELGGFTKEHERSNRRAV 62
           ME+E    F+  T C  ++A++YL KN   + YALND+YD+   +GG          R  
Sbjct: 46  MEKE----FMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGM---------RQS 92

Query: 63  YPKELVQLFRDYCS--EDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYR 120
           Y   LV +F  Y +    T  D  G+I+ I+D G++IED  T+CL+ +L  ++L   + R
Sbjct: 93  YNPSLVAIFEKYSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSR 152

Query: 121 DDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMD 180
           + FL    +  C T+  +K  L  L E+L TD  YF +IY+++F L  D+ +R+  +  D
Sbjct: 153 EQFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRH--LPKD 210

Query: 181 IAIEYWKLFFLNESIQSVEISNELLSLWFQFL----ADERKKQVSKDIWQMILEFFRKFK 236
           +AIEYW +FF  ++  +++IS E L+ W +F+    +D RK+ +S DIW M  +F  ++ 
Sbjct: 211 VAIEYWNIFF-KDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYP 269

Query: 237 DLESLKESYDENDPWPFVIDEFYEYLQDTGKL 268
           + ESLK++YDE   WP +IDE+YE+L++  KL
Sbjct: 270 NDESLKQNYDEMAAWPLLIDEYYEFLEENDKL 301

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 143/262 (54%), Gaps = 11/262 (4%)

Query: 4   SMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVY 63
           + + + I  F+  T    A A K+L+ NRW+++YAL+D Y       T+     N    Y
Sbjct: 5   ARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-------TRGTSYLNTERTY 57

Query: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
             EL   F++Y SE+  +D   +IK + D G  +ED  TICLA +L  ENL   I  + F
Sbjct: 58  DAELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQF 117

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
           L    + GC  +ND+   +  L+ KL+ DP YF TIY+++F + +D   R  SI  D AI
Sbjct: 118 LSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSI--DTAI 175

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQ-VSKDIWQMILEFFRKFKDLESLK 242
            YW L FL+ S  + +I    L  WF+FL ++     V++D W M+ +F  KF D ++L 
Sbjct: 176 SYWTLLFLDHSF-ATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLL 234

Query: 243 ESYDENDPWPFVIDEFYEYLQD 264
             Y E   WP ++DE+Y ++++
Sbjct: 235 SEYSEMGAWPLIMDEYYGWIKE 256

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  162 bits (409), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 120/180 (66%), Gaps = 4/180 (2%)

Query: 85  GMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKD 144
            +IK I+D G  +EDLAT+CL H+L ++ L++ + R+ FL   F QGC T+ ++K  +K 
Sbjct: 3   SLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVKG 62

Query: 145 LNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFLNESIQSVEISNEL 204
           L+ KL+ D  YFT IY+++F LIL  DT  + ID + AI+YW L F  E    + +   L
Sbjct: 63  LDAKLHEDLQYFTEIYDYTFHLIL--DTNRKDIDTEEAIQYWTLLFQPEY--PIHMEPGL 118

Query: 205 LSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQD 264
           L  WF+FL DE K+ ++KD W M+L+FF+++  + S+ + YDE   WPF+IDEFYE+L+D
Sbjct: 119 LEAWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD 178

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  160 bits (404), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 138/265 (52%), Gaps = 13/265 (4%)

Query: 4   SMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVY 63
           + + E I  F+  T    A A  YL +N W++++AL+DFY    GG   E         Y
Sbjct: 5   ARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQ--------Y 56

Query: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123
             ELV  F  Y +    +D + +++ + D G  +ED+AT+CLA +L  E L   I R  F
Sbjct: 57  SAELVATFERYAAGGA-MDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQF 115

Query: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183
           L      GC ++ D++  +  L  +L TD  YF  +Y ++FGL LD   R  S+  + AI
Sbjct: 116 LSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSV--ETAI 173

Query: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243
            YW LFFL+ +  +V +    L  WF+FL       VS+D W M   F ++F D   L E
Sbjct: 174 AYWSLFFLDHTY-AVTVPAPRLRSWFEFL-RAGDHSVSRDTWDMFPRFAQRFPDDTELLE 231

Query: 244 SYDENDPWPFVIDEFYEYLQDTGKL 268
            Y+E   WP VIDE+YE+++   +L
Sbjct: 232 HYNELASWPLVIDEYYEWVKGRNQL 256

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score =  115 bits (288), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 82/123 (66%), Gaps = 4/123 (3%)

Query: 142 LKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFLNESIQSVEIS 201
           +K L+ KL  +  YFT IYN++F L+LD  +  + ID++  I+YWKLFF  E    V I 
Sbjct: 5   MKRLDIKLRQNLQYFTLIYNYTFHLLLD--SYRKDIDINECIQYWKLFFRPEY--PVSIE 60

Query: 202 NELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEY 261
             LL  WF+FL DE K  ++KD WQM+L FF+K+  +  + + YDE+  WPF+IDEFYEY
Sbjct: 61  QNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYEY 120

Query: 262 LQD 264
           LQD
Sbjct: 121 LQD 123

>KNAG0A01990 Chr1 (159879..161651) [1773 bp, 590 aa] {ON} Anc_8.537
           YPL070W
          Length = 590

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 35/51 (68%), Gaps = 4/51 (7%)

Query: 170 DDTRNQSIDMDIAIEYWKLFFLNESIQSVE-ISNELLSLWFQFLADERKKQ 219
           D  R++S+  D+A+   ++   NE++QS+E + NELLS+  +F+AD ++ +
Sbjct: 57  DAFRSRSLSGDVALTPEEI---NETLQSIEELPNELLSMVEKFIADLKQPK 104

>YGR019W Chr7 (525229..526644) [1416 bp, 471 aa] {ON}
           UGA1Gamma-aminobutyrate (GABA) transaminase
           (4-aminobutyrate aminotransferase) involved in the
           4-aminobutyrate and glutamate degradation pathways;
           required for normal oxidative stress tolerance and
           nitrogen utilization
          Length = 471

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%)

Query: 142 LKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFLNESIQSVEIS 201
           LK+L E  +T P YF   Y  S G  + D   N  +D+   I    L + N ++     S
Sbjct: 31  LKELGEVFDTRPAYFLADYEKSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQS 90

Query: 202 NELL 205
            E++
Sbjct: 91  PEMI 94

>Smik_7.306 Chr7 (516574..517989) [1416 bp, 471 aa] {ON} YGR019W
           (REAL)
          Length = 471

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%)

Query: 142 LKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFFLNESIQSVEIS 201
           LK+L E  +T P YF   Y  S G  + D   N  +D+   I    L + N ++     S
Sbjct: 31  LKELGEVFDTRPAYFLADYEKSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQS 90

Query: 202 NELL 205
            E++
Sbjct: 91  PEMI 94

>Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa] {ON}
            YHR099W (TRA1) - ATM/Mec1/TOR1+2-related [contig 157]
            FULL
          Length = 3725

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 20/131 (15%)

Query: 99   DLATICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTT 158
            ++  +C++ +     L +   ++ FL+ L EQ  C   ++  +   L+   NT+  YF T
Sbjct: 2934 NMPDVCISQLARIYTLPNIEIQEAFLK-LREQAKCHYQNMNELTTGLDVISNTNLVYFGT 2992

Query: 159  IYNFSF----GLILDD----DTRNQS------IDMDIAIEY--WKLF---FLNESIQSVE 199
            +    F    G+ L      D  NQ+      ID+++A  +  W LF    L+E  Q++ 
Sbjct: 2993 VQKAEFFTLKGMFLSKLRAHDEANQAFATAVQIDLNLAKAWAQWGLFNDRRLSEEPQNIS 3052

Query: 200  ISNELLSLWFQ 210
             +N  +S + Q
Sbjct: 3053 FANNAISCYLQ 3063

>Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar
          to Ashbya gossypii ABR211C
          Length = 394

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 5  MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHE 55
          M ++ I  F+  T C   +A ++++K+  ++  A+N +Y S L G  K+ E
Sbjct: 1  MSDQQIQQFMTLTNCSADVATQFINKSNGDLEDAINKYYASLLEGKEKKSE 51

>Suva_2.584 Chr2 complement(1035617..1039492) [3876 bp, 1291 aa]
           {ON} YDR407C (REAL)
          Length = 1291

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 176 SIDMDIAIEYWKLFFL-----NESIQSVEISNEL-LSLWFQFLADERKKQVSKDIWQMIL 229
           SI       YW  F L     N  + S  ISNE+ L      L + + KQ S+DI     
Sbjct: 641 SITNGSITRYWDPFLLREIVLNRILDSDPISNEIPLESDMSSLKNLKDKQNSEDIDPQ-- 698

Query: 230 EFFRKFKDLESLKESYDENDPWPFVI 255
           E F  FK +++     +END +P ++
Sbjct: 699 EVFNPFKQVQATSSILNENDKYPILV 724

>KLLA0C02189g Chr3 (178544..182686) [4143 bp, 1380 aa] {ON} similar to
            uniprot|P23255 Saccharomyces cerevisiae YCR042C TAF2
            TFIID subunit (150 kDa) involved in RNA polymerase II
            transcription initiation
          Length = 1380

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 54/123 (43%), Gaps = 22/123 (17%)

Query: 47   LGGFTKEHERSNRRAVYPKELVQLFRD-YCSEDTYI----DFQG-----MIKLIKDCGLA 96
            L  FT + E        P+ LVQ+FR+ +C ED+ I    DF       + K I     +
Sbjct: 900  LSKFTIKAEEQQEFKGGPRHLVQIFRELFCYEDSNIPKNNDFSDYPKYFLQKAIPKLLSS 959

Query: 97   IEDLATICLA-------HILHWENLQDKIYRDDF-----LQYLFEQGCCTVNDIKVVLKD 144
            +++   +C A        ++ + +  D IY D F     L+ L +     +ND K + + 
Sbjct: 960  VKNDEGVCPAFVKEFLLDVVRYNDNTDNIYSDTFYITELLESLVDCSISDINDTKYIDEV 1019

Query: 145  LNE 147
            +NE
Sbjct: 1020 MNE 1022

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 5  MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSN 58
          M +E I  F+  T     +ARKYL ++  ++  ALN FY ++    + E +R++
Sbjct: 1  MSDEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQRPGSVEGQRNS 54

>Kpol_1056.3 s1056 (4599..6191) [1593 bp, 530 aa] {ON} (4599..6191)
           [1593 nt, 531 aa]
          Length = 530

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 103 ICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTD 152
           I L  ++H +N++ K   DDF+  LF  G   VNDI  + K + E  N+D
Sbjct: 267 ISLISLIHKKNMKAKDEYDDFISPLFTIG---VNDIDFLNKVIKESGNSD 313

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (44%), Gaps = 30/156 (19%)

Query: 125  QYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIE 184
            + ++EQ   +V   +++L +L E+L   P++    ++ ++ L+ D  T  Q  D     E
Sbjct: 1056 EIIYEQSFSSV---RLILLNLFERLICVPSFKDVNFSVAYRLLADSLTMCQLDDTSFLFE 1112

Query: 185  --------YWKL------FFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILE 230
                    Y K+      F  NE    +EIS+ ++ L+F     E   Q+SK  + M+ +
Sbjct: 1113 LRFSCMSLYQKIDNLDINFSNNE--YGLEISDSIIELFFINFPQEENNQISKGFYYMLNK 1170

Query: 231  FFRKFKDLESLKESYDENDPWPFVIDEFYEYLQDTG 266
               KF D++ L E +          D F+E+   TG
Sbjct: 1171 AVSKF-DVKLLLECF----------DRFFEFYTTTG 1195

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.140    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,516,905
Number of extensions: 1478297
Number of successful extensions: 4810
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4899
Number of HSP's successfully gapped: 49
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)