Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H002405.698ON59159128740.0
KAFR0H00230singletonON59659221270.0
KNAG0C065705.698ON59058618880.0
NCAS0A032205.698ON61155218680.0
YKR093W (PTR2)5.698ON60155118410.0
Suva_11.3295.698ON60157618340.0
Smik_11.3565.698ON60256518320.0
NDAI0E050205.698ON61955317830.0
TDEL0B022305.698ON57456617610.0
ZYRO0G06688g5.698ON61357717340.0
CAGL0G02453g5.698ON59758117300.0
TPHA0N01960singletonON59151817290.0
TBLA0A091205.698ON63355417250.0
TBLA0B04710singletonON61551417170.0
TPHA0O02000singletonON62057917100.0
Kpol_529.285.698ON61060016960.0
KLLA0E12915g5.698ON65453116990.0
TBLA0E01140singletonON61152316500.0
SAKL0E14828g5.698ON59252616450.0
Skud_11.3315.698ON39937013800.0
Kwal_47.16930na 1ON6115885622e-63
KLTH0D16544gna 1ON6265524966e-54
Ecym_2823na 2ON6135884684e-50
AGL365Cna 2ON5995774525e-48
AFR228WsingletonON5765834349e-46
KNAG0A01870singletonON77688761.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00240
         (591 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...  1111   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      823   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   731   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   724   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   713   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   711   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   710   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   691   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   682   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   672   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   671   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   670   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   669   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            665   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   663   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   657   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   659   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   640   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   638   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   536   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   221   2e-63
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   195   6e-54
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   184   4e-50
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   178   5e-48
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   171   9e-46
KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON}               34   1.4  

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/591 (91%), Positives = 540/591 (91%)

Query: 1   MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEE 60
           MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEE
Sbjct: 1   MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEE 60

Query: 61  GYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGV 120
           GYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGV
Sbjct: 61  GYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGV 120

Query: 121 LQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFK 180
           LQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYN                   SFK
Sbjct: 121 LQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFK 180

Query: 181 TVAGRDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDV 240
           TVAGRD                    KSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDV
Sbjct: 181 TVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDV 240

Query: 241 TIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIK 300
           TIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIK
Sbjct: 241 TIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIK 300

Query: 301 PTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFY 360
           PTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFY
Sbjct: 301 PTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFY 360

Query: 361 PIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPL 420
           PIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQA            CEKFLYPFIRRFTPL
Sbjct: 361 PIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPL 420

Query: 421 RPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAFS 480
           RPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAFS
Sbjct: 421 RPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAFS 480

Query: 481 EIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAV 540
           EIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAV
Sbjct: 481 EIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAV 540

Query: 541 ACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA 591
           ACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA
Sbjct: 541 ACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA 591

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/592 (67%), Positives = 454/592 (76%), Gaps = 4/592 (0%)

Query: 1   MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQ-DGSIEPDHEDYQE 59
           MS+H  + +       + EKN I+LK T VSS D +  DTE+Y LQ D   +P+H DYQE
Sbjct: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSED-QILDTESYKLQNDNEFDPEHPDYQE 59

Query: 60  EGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPG 119
           EGYE+PT++E++TLR V GRIPFRCFL+A+VEL+ERFSYYGLSAPFQNYM N P+DSPPG
Sbjct: 60  EGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPG 119

Query: 120 VLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSF 179
           VLQLNS GATGLSYFFQFWCYITP+ GGYLADT WGRYN                   SF
Sbjct: 120 VLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF 179

Query: 180 KTVAGRDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHD 239
           K++AG++                    K+NLSVLIADQIPAKRPRVKTLKSGERVIEDHD
Sbjct: 180 KSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHD 239

Query: 240 VTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYII 299
           +TIQNVFMFFYLMINIGSLSVIATTELE +VGFWAAYLLPFCFFWIAVIV+V G+R Y +
Sbjct: 240 ITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTL 299

Query: 300 KPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLF 359
           KPT DRVI KSFK CW L KNKF+ ++  P+ +PE  F W+DKFV+EI+ ALAACKVFLF
Sbjct: 300 KPTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLF 359

Query: 360 YPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTP 419
           YPIYWTCYGQM NNF+TMGSM+QLHGLPNDIFQA            CEKF YPFIRRFTP
Sbjct: 360 YPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTP 419

Query: 420 LRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAF 479
            RP+T+I  GF  A+ +MVW+CVLQ+FIY TGPNY  PL  G N++HV WQVPAYV IAF
Sbjct: 420 FRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAF 479

Query: 480 SEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLA 539
           SEIFASITGLEYAYSKAPA+MKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY  LA
Sbjct: 480 SEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLA 539

Query: 540 VACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA 591
           V  F++G  FW CFR YN IEDEMNAL++ D  ED I     + E V  L A
Sbjct: 540 VTAFITGCAFWFCFRHYNDIEDEMNALNYED--EDIITENNQDIEMVHPLSA 589

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/586 (59%), Positives = 425/586 (72%), Gaps = 11/586 (1%)

Query: 14  INTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTL 73
           +NT  E + ++ KN  V + +  H   E   + D  +   +ED   EGYE+PT++E++TL
Sbjct: 6   VNTFSEDDSLDKKNDLVLTKENSHTIEEDSRIVD-DLASQYEDDIPEGYEVPTEEELRTL 64

Query: 74  RRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSY 133
           + VGG IP RC+L+A+VEL+ERFSYYGLSAPFQNYM NGP D PPG+LQLNS GATGLSY
Sbjct: 65  KHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSY 124

Query: 134 FFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXX 193
           FFQFWCY+TPIFGGY+ADT WG+YN                   S  ++  ++       
Sbjct: 125 FFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFI 184

Query: 194 XXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMI 253
                        KSNLSVLIADQ+P ++P VKT K+GERVIED ++T+QNVFMFFYLMI
Sbjct: 185 VAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMI 244

Query: 254 NIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKV 313
           NIGSLSVIAT+ELEL+ GFWAAYLLPFCFFWIAV+V+V GK QY+  P GD+VI+K FKV
Sbjct: 245 NIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKV 304

Query: 314 CWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNN 373
            WIL KN+F+  + KPS +P   +PW DKFVDEIQRAL ACKVFLFYPIYWTCYGQM++ 
Sbjct: 305 LWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSG 364

Query: 374 FITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFA 433
           F+T GSMM+LHGLPND FQ             CE  LYPFIR++TP RP+T+I+ GF+FA
Sbjct: 365 FVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFA 424

Query: 434 AMAMVWSCVLQHFIYSTGPNYNRPLEL-GANDIHVGWQVPAYVFIAFSEIFASITGLEYA 492
           +  M+W+ VLQ +IY  GP+Y  PLE  G N IHV  QVPAYV +AFSEIFASITGLEYA
Sbjct: 425 SGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484

Query: 493 YSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLC 552
           YSKAPA+MKSFIM++FL  NAFGSAIGCALSPVSKDPD+TWLY  LAVACF+SG +FW+C
Sbjct: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544

Query: 553 FRKYNKIEDEMNALDF---------TDSEEDEILIRRAEDEDVASL 589
           FRKYN IE+EMNA+D+            E D + + +   E V SL
Sbjct: 545 FRKYNDIEEEMNAMDYEVDATMLKKVPIETDTVALEKGSSESVVSL 590

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/552 (62%), Positives = 413/552 (74%), Gaps = 9/552 (1%)

Query: 23  IELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPF 82
           I LK T   SS+  H + E Y +        H++  E GYEIPT+++M+TLR V G+IP 
Sbjct: 34  ITLKET-TGSSEEVHDELETYHIH-------HDEECEPGYEIPTEEDMETLRHVSGKIPL 85

Query: 83  RCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYIT 142
           RC+L+ALVELAERFSYYGLSAPFQNYM+NGP D+P GVL+LNSSGATGLSYFFQFWCY+T
Sbjct: 86  RCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVT 145

Query: 143 PIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXX 202
           P+FGG++ADT WG+YN                   S  ++A +D                
Sbjct: 146 PVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIA 205

Query: 203 XXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIA 262
               K+NLSVLIADQ+P ++PRVKTLKSGERV+ED ++T+QNVFM+FYLM+N+GSLSVIA
Sbjct: 206 TGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIA 265

Query: 263 TTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKF 322
           TTELE +  FWAA+LLPFCFFWIAV+V+V G+ QY+ +   ++ I KSFK+ WI+ KNKF
Sbjct: 266 TTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKF 325

Query: 323 DITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQ 382
           D+TSAKPSYHPE  +PW DKFVDE  RAL+ACKVFLFYPIYW  YG M++ F+T GSMM+
Sbjct: 326 DLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMME 385

Query: 383 LHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCV 442
           LHGLPNDIFQA            CE+F+YPFIRRFTP +P+T+IF GF+FA  AMVWSCV
Sbjct: 386 LHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCV 445

Query: 443 LQHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMK 501
           LQ FIY  GP Y+ PL  G  N IHVGWQVPAYV IAFSEI ASITGLEYAYSKAP +MK
Sbjct: 446 LQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMK 505

Query: 502 SFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIED 561
           SFIM+LFLF NA GS +G ALSPVS DP +TWL+G L VACF+ G IFW+ FRKYN  E+
Sbjct: 506 SFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEE 565

Query: 562 EMNALDFTDSEE 573
           EMNA+D+ D E+
Sbjct: 566 EMNAMDYEDEED 577

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/551 (61%), Positives = 411/551 (74%), Gaps = 13/551 (2%)

Query: 36  EHKDTEAYTLQDGSIEPD----HEDY------QEEGYEIPTQDEMKTLRRVGGRIPFRCF 85
           E + T+A TL+D  +  D     E Y      ++E +E PT++EM+TLR VGG+IP RC+
Sbjct: 24  EEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFEGPTEEEMQTLRHVGGKIPMRCW 83

Query: 86  LVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIF 145
           L+A+VEL+ERFSYYGLSAPFQNYM+ GP DSP GVL LNS GATGLSYFFQFWCY+TP+F
Sbjct: 84  LIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVF 143

Query: 146 GGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXXXX 205
           GGY+ADT WG+YN                   S  +V  RD                   
Sbjct: 144 GGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGM 203

Query: 206 XKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTE 265
            K+NLSVLIADQ+P ++P +K LKSGERVI D ++T+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 204 IKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTE 263

Query: 266 LELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDIT 325
           LE + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+VIAKSFKVCWIL KNKFD  
Sbjct: 264 LEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFN 323

Query: 326 SAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHG 385
           +AKPS HPE  +PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LHG
Sbjct: 324 AAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 383

Query: 386 LPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQH 445
           +PND  QA             EKF+YPFIRR+TPL+P+T+IF GF+F + AM W+ VLQ 
Sbjct: 384 IPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQS 443

Query: 446 FIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFI 504
           F+Y  GP YN PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSFI
Sbjct: 444 FVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 503

Query: 505 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMN 564
           M++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN  E+EMN
Sbjct: 504 MSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMN 563

Query: 565 ALDFTDSEEDE 575
           A+D+   EEDE
Sbjct: 564 AMDY--EEEDE 572

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/576 (59%), Positives = 421/576 (73%), Gaps = 11/576 (1%)

Query: 24  ELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFR 83
           E KN  V+  D    D  A + +  ++ P  ED +   +E PT +E+++LR VGG+IP R
Sbjct: 25  EEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNE---FEAPTDEELRSLRHVGGKIPMR 81

Query: 84  CFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITP 143
           C+L+A+VEL+ERFSYYGLSAPFQNYM+ GP D+P G+L LNSSGATGLSYFFQFWCY+TP
Sbjct: 82  CWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTP 141

Query: 144 IFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXX 203
           +FGGY+ADT WG+YN                   S  +V  RD                 
Sbjct: 142 VFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIAT 201

Query: 204 XXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIAT 263
              K+NLSVLIADQ+P ++P +K LKSGERVIED ++T+QNVFMFFY MIN+GSLS++AT
Sbjct: 202 GMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMAT 261

Query: 264 TELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFD 323
           TELE + GFWAAYLLPFCFFW+AV+ +V GK+QYI +P GD+VIAKSFKVCWIL KNKFD
Sbjct: 262 TELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFD 321

Query: 324 ITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQL 383
             +AKPS HPE ++PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+L
Sbjct: 322 FNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMEL 381

Query: 384 HGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVL 443
           HG+PND  QA             EKF YPFIRR+TP +P+T+IF GF+F + AM W+ VL
Sbjct: 382 HGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVL 441

Query: 444 QHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKS 502
           Q F+Y  GP Y+ PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPANMKS
Sbjct: 442 QSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKS 501

Query: 503 FIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDE 562
           FIM++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN  E+E
Sbjct: 502 FIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEE 561

Query: 563 MNALDFTDSEE---DEILIRRAED----EDVASLKA 591
           MNA+D+ + +E   + I   +A D    E + SLK+
Sbjct: 562 MNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKS 597

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/565 (59%), Positives = 415/565 (73%), Gaps = 14/565 (2%)

Query: 36  EHKDTEAYTLQDGSIEPD----HEDY------QEEGYEIPTQDEMKTLRRVGGRIPFRCF 85
           E + T A TL+D  +  D     E Y      ++E +E PT++E KTLR VGG+IP RC+
Sbjct: 24  EEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDFEAPTEEETKTLRHVGGKIPMRCW 83

Query: 86  LVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIF 145
           L+A+VEL+ERFSYYGLSAPFQNYM+ GP DSP GVL LNS GATGLSYFFQFWCY+TP+F
Sbjct: 84  LIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPVF 143

Query: 146 GGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXXXX 205
           GGY+ADT WG+YN                   S  +V  RD                   
Sbjct: 144 GGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGM 203

Query: 206 XKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTE 265
            K+N+SVLIADQ+P ++P +K LKSGERVI D ++T+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 204 IKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTE 263

Query: 266 LELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDIT 325
           LE + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+V+AKSF+VCWIL KNKFD  
Sbjct: 264 LEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFN 323

Query: 326 SAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHG 385
           +AKPS HPE  +PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LHG
Sbjct: 324 AAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHG 383

Query: 386 LPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQH 445
           +PND  QA             EKF+YPFIRR+TPL+P+T+IF GF+F + AM W+ VLQ 
Sbjct: 384 IPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQS 443

Query: 446 FIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFI 504
           F+Y  GP YN PL     N IHV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSFI
Sbjct: 444 FVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 503

Query: 505 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMN 564
           M++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN  E+EMN
Sbjct: 504 MSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMN 563

Query: 565 ALDFTDSEE---DEILIRRAEDEDV 586
           A+D+ + +E   + I   +A D ++
Sbjct: 564 AMDYEEDDEFDLNSISAPKANDIEI 588

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/553 (58%), Positives = 403/553 (72%), Gaps = 5/553 (0%)

Query: 27  NTKVSSSDGEHKDTEAYTLQDGSIEPDHE---DYQEEGYEIPTQDEMKTLRRVGGRIPFR 83
           N   SS++ +  D E Y L + + +  ++   D  EEGYE PT +E+ TL+RVGG+IP R
Sbjct: 34  NATTSSTEEKLHDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLR 93

Query: 84  CFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITP 143
           C+L+ +VELAERFSYYGLSAPFQNYMQNGP DSP GVL LNSSGATGLSYFFQFWCY+TP
Sbjct: 94  CWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTP 153

Query: 144 IFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXX 203
           +FGG++ADT WG+YN                   +  ++A ++                 
Sbjct: 154 VFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGT 213

Query: 204 XXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIAT 263
              K+NLSVLIADQ+P ++PRVK LKSGERVIED ++T+QNVFM FYLMINIGS+SV+AT
Sbjct: 214 GFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMAT 273

Query: 264 TELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFD 323
           TELE + GFWAAYLLPFCFFWIAV+++V G++ Y+ +  GD V+ KSFKVCWI+ KNK D
Sbjct: 274 TELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLD 333

Query: 324 ITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQL 383
             +AKPSYHPE  +PW D+FVDE++R +AACKVF+FYPIYW  YG M++ F+T GS M+L
Sbjct: 334 YNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMEL 393

Query: 384 HGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVL 443
           HG+PND  Q              E F+YPFIRRFTP+RP+T+I  GF     AM W+ VL
Sbjct: 394 HGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVL 453

Query: 444 QHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKS 502
           QHFIY+TGP Y+ PL     N IHV WQ+PAYV IAFSEIFASITGLEYAYSKAP +MKS
Sbjct: 454 QHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKS 513

Query: 503 FIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDE 562
           F+M++FL  NAFGS +G ALS V+ DP + WL+G LAV+C ++G++FWLCFR  N  E+E
Sbjct: 514 FVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEE 573

Query: 563 MNALDFTDSEEDE 575
           MNA+D+ D+E DE
Sbjct: 574 MNAMDY-DAEIDE 585

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/566 (58%), Positives = 400/566 (70%), Gaps = 10/566 (1%)

Query: 25  LKNTKVSSSDGE---HKDTEAYTLQDGSIE--PDHEDYQEEGYEI-PTQDEMKTLRRVGG 78
           +K T+ SS+DG     K      + D  +E    H   + E Y+  PT++EMKTL+ V G
Sbjct: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60

Query: 79  RIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFW 138
            IPFRC+L+A+VEL+ERF+YYGLS PFQNYMQNGP D+P G+L L S GATGLSYFFQFW
Sbjct: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120

Query: 139 CYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXX 198
           CY+TPIFGG+L+DT  G+YN                   S  ++  ++            
Sbjct: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIIL 180

Query: 199 XXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSL 258
                   KSN+SVLIADQ P +R RV T K G RVIED ++T+QNVFM FYLMINIGSL
Sbjct: 181 IGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240

Query: 259 SVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILC 318
           SVIATTELE +VGFWAAYLLPFCFFWIAVIV+  GK  Y+  P GD+VI+K FKV  I  
Sbjct: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300

Query: 319 KNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMG 378
           KNKF+  +AKPS  P+  FPW DKFVDEI R+L+ACKVFLFYP+YW CYGQM+N F+++G
Sbjct: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360

Query: 379 SMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMV 438
             M+LHGLPND FQA            CE FLYP+IR+FTP RP+T+IF GF+F A AMV
Sbjct: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420

Query: 439 WSCVLQHFIYSTGPNYNRPL-ELGANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAP 497
           W+ VLQHFIY +GP Y  P+ E   N IH+ WQVPAYV IAFSEIFASITGLEYAYSKAP
Sbjct: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480

Query: 498 ANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYN 557
             MKSFIMA+FL  NAFGSAIGCALSPV+KDPDY WLY  L VACF +G +FW CF+ YN
Sbjct: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540

Query: 558 KIEDEMNALDFTDSEEDEILIRRAED 583
             E+ MNALD+   +ED  +++ ++D
Sbjct: 541 DTEEAMNALDY---DEDPTMLKHSKD 563

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/577 (56%), Positives = 407/577 (70%), Gaps = 17/577 (2%)

Query: 11  PSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEM 70
           PS       K  IE K+ +VS   G H+  E           D ++Y+    + PT++E+
Sbjct: 6   PSITGPEKNKVIIEDKSLEVS---GSHERGEL----------DFDEYEVPNDDEPTEEEL 52

Query: 71  KTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATG 130
           ++LR VGG IPFRC+L+A+VEL+ERFSYYGLSAPFQNYMQNG  D+P GVL L S GATG
Sbjct: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATG 112

Query: 131 LSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXX 190
           L+YFFQFWCY+TP+FGG+LADT WG+Y                    S  +V  ++    
Sbjct: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALG 172

Query: 191 XXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFY 250
                           K+NLSVLIADQ P ++PR+KT K GERVIED ++TIQNVFMFFY
Sbjct: 173 GFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFY 232

Query: 251 LMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKS 310
           LMINIGSLSVIATTELE + GFWAAYLLPFCFFWIAVIV+  G++ Y+  P GD+VIAKS
Sbjct: 233 LMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKS 292

Query: 311 FKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQM 370
           F+V   L K++FD  + KPS HPE ++PW D FV+EI+RAL ACKVF+FYPIYW  YGQM
Sbjct: 293 FRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQM 352

Query: 371 VNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGF 430
            + F+++G  MQLHGLPND FQA            CE +LYPFIRR+TP +P+T+IF GF
Sbjct: 353 TSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGF 412

Query: 431 IFAAMAMVWSCVLQHFIYSTGPNYNRPLEL--GANDIHVGWQVPAYVFIAFSEIFASITG 488
           ++ + +M+W+ VLQHFIY TGP Y+ P++   G N+IH+GWQVPAYV IAFSEIFASITG
Sbjct: 413 MWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITG 472

Query: 489 LEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLI 548
           LEYAYSKAP +MKSFIM++FL  NAFGSAIGCALSPV  DP Y W++  LAVA F+SG +
Sbjct: 473 LEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCL 532

Query: 549 FWLCFRKYNKIEDEMNALDFTDSEE--DEILIRRAED 583
           FWL F   N  E+EMNA+D+ +++E  D+ L +   D
Sbjct: 533 FWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSD 569

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/581 (56%), Positives = 402/581 (69%), Gaps = 16/581 (2%)

Query: 19  EKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDY----------QEEGYEIPTQD 68
           EKN +E++    S  D   K  E Y ++D  I     D           +++ +E PT++
Sbjct: 11  EKNAVEVQKDVSSIDDNSSK--EVYEIEDQEIHHLDRDKSNAESNFALGEDDDFEAPTEE 68

Query: 69  EMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGA 128
           E+KTLR V G IP RC+L+A+VEL+ERFSYYGLSAPFQNYMQNGP D+P G+L L S GA
Sbjct: 69  ELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGA 128

Query: 129 TGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXX 188
           TGLSYFFQFWCY+TP+FGG+++DT WG+YN                   S   V   D  
Sbjct: 129 TGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGA 188

Query: 189 XXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMF 248
                             KSNLSVLIADQ+P K+PRV   K GERVIED ++T+QNVFMF
Sbjct: 189 LGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMF 248

Query: 249 FYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIA 308
           FY  IN+GSLSV+ATTELE + GFWAAYLLPFCFFW+AV V+V G+ QYI  P GD+VI+
Sbjct: 249 FYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVIS 308

Query: 309 KSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYG 368
           KSFKV +IL KNKF+  +AKPS++P+  FPW DKFVDEI+RAL ACKVF+FYP+YW CYG
Sbjct: 309 KSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYG 368

Query: 369 QMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFC 428
            M+NNF+T G  M+LH LPND  QA             E+F+YPFIRR+TPLRP+T+IF 
Sbjct: 369 TMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFF 428

Query: 429 GFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASIT 487
           GF+  + AMVW+ VLQHFIY+ GP Y+ PL+    N IHV WQ+PAYV IA SEIFASIT
Sbjct: 429 GFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASIT 488

Query: 488 GLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGL 547
           GLEYAYSKAP +MKSFIM++FL  NAFGSAIGCALSPVS DP + W Y  LA ACF++G 
Sbjct: 489 GLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGW 548

Query: 548 IFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVAS 588
           +FW  +   N  E+ MNALD+   E DE + +   D++ A+
Sbjct: 549 VFWFIYSGLNDEEEAMNALDY---EHDEFMYKHHSDDEEAA 586

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/518 (59%), Positives = 379/518 (73%), Gaps = 6/518 (1%)

Query: 65  PTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLN 124
           PT++E+KTLR V G IP RC+L+A+VELAERFSYYGLSAPFQNYM NGP D+P G+LQLN
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 125 SSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAG 184
           SSGAT +SYFFQFWCY+TPIFGGY+ADT WG+YN                   S +++  
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 185 RDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQN 244
           ++                    KSN+SVLIA+Q+P ++ RV T   GERVIED  +T+QN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 245 VFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGD 304
           +FMFFYLMINIGSLSVIATTELE + GFWAAYLLPFCFFWIAV+V++ GK+QY+ KP GD
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 305 RVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYW 364
           +VI+K F + WI  KNK D  SAKPS HPE+ +PW DKFV+E++RA+ ACKVFLFYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 365 TCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVT 424
             YGQM+NNF+T    M+LHGLPND  QA            CEKFLYPFIR+FTP R +T
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 425 RIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGA------NDIHVGWQVPAYVFIA 478
           +IF GF+F + AM+W+ VLQ FIY  GP +++PL   A      N +H+ WQVPAYV IA
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 479 FSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSL 538
           FSEIFASITGLEYAYS AP +MKSFIM++FL   AFGSA+G A+SP S DP +TW +  L
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 539 AVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEI 576
           AV+CF++G +FW+CFRKYN  ED M+ +DF D +  ++
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDM 574

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/554 (57%), Positives = 401/554 (72%), Gaps = 4/554 (0%)

Query: 33  SDGEHKDTEAYTLQ-DGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVE 91
           +  E +D +  T Q D SI  D  +   E +E PT++E++TL+ VGG+IP RC+L+A++E
Sbjct: 50  TQDEKRDQKFETFQEDSSIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIE 109

Query: 92  LAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLAD 151
           LAERFSYYGLSAPFQNYMQNGP DSPPG L L+SSGATGLSYFFQFWCY+TP+F GY+AD
Sbjct: 110 LAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMAD 169

Query: 152 TKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXXXXXKSNLS 211
           T WG++                    S  ++   +                    K+NLS
Sbjct: 170 TYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLS 229

Query: 212 VLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVG 271
           V+IA+QIP ++ RV T K+G RVIED D+TIQNVFM FY MINIGSLSVIATTELE + G
Sbjct: 230 VMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKG 289

Query: 272 FWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSY 331
           FWAAYLLPFCFFW+AVIV++ G + YI  P GD+VI+K FKV  IL +N+F+  SAKP++
Sbjct: 290 FWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAF 349

Query: 332 HPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIF 391
           +P+  +PW DKFVDEI RAL ACKVF+FYPIYW CYGQM+NNF++ G  M+LHGLPND F
Sbjct: 350 NPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFF 409

Query: 392 QAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTG 451
           QA            CE+F+YPFIR++TP +P+T+IF GF F A++M W+CVLQHFIY   
Sbjct: 410 QAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAA 469

Query: 452 PNYNRPLEL--GANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFL 509
           P Y+ P +   G N IHV  QVPAY  +A SEIFASITGLEYAYSKAPA+MK+FIM++FL
Sbjct: 470 PCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFL 529

Query: 510 FMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFT 569
             NAFG+AIGCALSPVSKDP Y WLYG LAVACF+ G +FW+ F+KYN +E+E+N LDF 
Sbjct: 530 VTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFE 589

Query: 570 DSEEDEILIRRAED 583
           +  +D +  + A D
Sbjct: 590 EG-DDMLETKHAGD 602

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/514 (60%), Positives = 375/514 (72%), Gaps = 3/514 (0%)

Query: 65  PTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLN 124
           PT++E+KTL R  G IPF C+L+A++ELAERFSYYGLSAPFQNYMQN P+D+PPG L LN
Sbjct: 67  PTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLN 126

Query: 125 SSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAG 184
           S+GATGLSYFFQFWCY+TPIF G++ADT WG++N                   S   +  
Sbjct: 127 STGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITS 186

Query: 185 RDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLK-SGERVIEDHDVTIQ 243
            +                    K+NLSV+IADQ+P K+ RV T K SG+RVIED  +TIQ
Sbjct: 187 YNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQ 246

Query: 244 NVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTG 303
           NVFM FY MIN+GSLSVIATTELEL+VGFWAAYLLPFCFFWIAV+V+  G R+++ KP G
Sbjct: 247 NVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIG 306

Query: 304 DRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIY 363
           DRVI+K F +  IL KN F+   AKP+Y+PE  +PW DKFVDEIQR+L ACKVFLFYPIY
Sbjct: 307 DRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIY 366

Query: 364 WTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPV 423
           W CYGQM+NNF+T GS MQLHGLPND FQA             EKF+YPFIR+FTPL+P+
Sbjct: 367 WVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPI 426

Query: 424 TRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLEL--GANDIHVGWQVPAYVFIAFSE 481
           T++  GF+F ++AMVW+ VLQHFIY  GP Y+ P++   G N +HV WQVPAY  I+ SE
Sbjct: 427 TKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSE 486

Query: 482 IFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVA 541
           IFASITGLE AYSKAP +MKSFIM++FL  NAFG+AIGCALS VS+DP Y WLY  LAV 
Sbjct: 487 IFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVT 546

Query: 542 CFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDE 575
           CF +G+ FW  F+ YN  ED MN +DF    E+E
Sbjct: 547 CFCAGIAFWFTFKHYNDEEDAMNNIDFESDNENE 580

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/579 (54%), Positives = 405/579 (69%), Gaps = 10/579 (1%)

Query: 17  SMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHEDYQEE-GYEIPTQDEMKTLRR 75
           S EK      +   +  D    DT    L + +++ + + Y +E GY  PT++EM TL+ 
Sbjct: 27  SGEKELDSSHDVTFNIDDKVENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMATLKH 86

Query: 76  VGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFF 135
           V G IP+RC+L+A+VEL+ERFSYYGLSAPFQNYM NGP D+P G+LQLN++GATGLSYFF
Sbjct: 87  VAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFF 146

Query: 136 QFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXXXXX 195
           QFWCYITPIFGGY+ADT W +YN                   +  ++A ++         
Sbjct: 147 QFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTA 206

Query: 196 XXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINI 255
                      K+NLSVL+A+QIP ++ RV T K GERVIED D+T+QNVFMFFYLMINI
Sbjct: 207 IILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINI 266

Query: 256 GSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCW 315
           G+LSV+ATTELE + GFWAAYLLPFCFFWIAV+++V G+  YIIKP GD+VI+K FKV +
Sbjct: 267 GALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTF 326

Query: 316 ILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFI 375
           I+CKNKF+  SAKPS +PE ++PW DKFVDEI R++ ACKVF+FYPIYW  YGQM+NNFI
Sbjct: 327 IVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFI 386

Query: 376 TMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAM 435
           T    M+LH +PND  Q              E+F+YP IRRFTPL+P+T+IF GF+  + 
Sbjct: 387 TQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSC 446

Query: 436 AMVWSCVLQHFIYSTGPNYNRPLELG------ANDIHVGWQVPAYVFIAFSEIFASITGL 489
           AMVW+ VLQ FIY  GP Y+ P+  G       N +HV WQ+PAYV IA+SEIFAS+TGL
Sbjct: 447 AMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGL 506

Query: 490 EYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIF 549
           E+AYS AP +MK+FIM++FLF NA G+A+G A+SP S DP YTW++  LAV+CF++G +F
Sbjct: 507 EFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLF 566

Query: 550 WLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVAS 588
           W+CF  YN I+ +M A+DF    ED+++    + E  AS
Sbjct: 567 WICFHHYNDIDADMKAIDFV---EDDMINASGDVEKTAS 602

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/600 (53%), Positives = 411/600 (68%), Gaps = 30/600 (5%)

Query: 2   STHIATNDDP-----SSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQDGSIEPDHED 56
           ++HI +  D      S  +++  +N  +L+ TKV   D E+ D              ++D
Sbjct: 19  ASHIDSKQDHEVKIVSKFDSTSLQNSDQLEITKVGDDDIEYDD--------------NQD 64

Query: 57  YQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDS 116
           + E     PT++EMKTL+ V G+IP RC+L+A+VEL+ERFSYYGL+APFQNYM NGP D+
Sbjct: 65  FVE-----PTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDT 119

Query: 117 PPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXX 176
           P GVL L++ GA+ LSYFFQFWCYITPIFGGY+ADT WG+YN                  
Sbjct: 120 PKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFI 179

Query: 177 XSFKTVAGRDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIE 236
            S  ++  R+                    K+N+SVLIA+QIP  +PRV T K G+RVIE
Sbjct: 180 TSLPSIDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIE 239

Query: 237 DHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQ 296
           D ++T QNVFMFFY+MIN+GSLS++ATTELE + GFWAAYLLPFCFFWIAV+V+V G+ Q
Sbjct: 240 DPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQ 299

Query: 297 YIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKV 356
           YI+ P GD++I+KSFKV WIL KNK +  +AKPS +PE  +PW DKFV+EI+RAL ACKV
Sbjct: 300 YIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKV 359

Query: 357 FLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRR 416
           F+FYPIYW  YGQM+NNF+T    M+LH LPND  QA             E+F+YPF+RR
Sbjct: 360 FVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRR 419

Query: 417 FTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIHVGWQ 470
           FTP RP+T+IF GF+F + AM+W+ VLQ FIY  GP YN P++         N +HV WQ
Sbjct: 420 FTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQ 479

Query: 471 VPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPD 530
           VPAYV IA SEI AS+TGLEYAYS APA+MKSFIM++FL  NAFGSAIG A+SP ++DP 
Sbjct: 480 VPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPK 539

Query: 531 YTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLK 590
           YTW +  LAVACF++G +FW+CFR YN  ED MN +DF D ++D+I+    E   +  ++
Sbjct: 540 YTWTFTGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTSIEVME 599

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/531 (57%), Positives = 378/531 (71%), Gaps = 6/531 (1%)

Query: 53  DHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNG 112
           D +D Q E    PT++E+ TLR V  RIPF C+L+A+VELAERFSYYGLSAPFQNYMQNG
Sbjct: 85  DEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNG 144

Query: 113 PTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXX 172
           P D+P GVLQL S GAT LSYFFQFWCY+TP+ GGYLADT WG+YN              
Sbjct: 145 PNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGIL 204

Query: 173 XXXXXSFKTVAGRDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGE 232
                +  ++  ++                    K+NLSVLIADQIP  RPR+K LK+GE
Sbjct: 205 ILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGE 264

Query: 233 RVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVA 292
           +VIED +VT+QNVFMFFYLMINIGSLSV+ATT LE + GFWAAYLL FCFFW+ ++V+V 
Sbjct: 265 KVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVF 324

Query: 293 GKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALA 352
           G+++Y+ +P GD VIA+ FK+CWI   N F++  A PS +PE E+PW D F+DEI+RA  
Sbjct: 325 GRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFK 384

Query: 353 ACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYP 412
           ACKVF FYPIYW  YGQM+NNF+T    M+LHGLPND  QA             E+F+YP
Sbjct: 385 ACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYP 444

Query: 413 FIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIH 466
           FIRRFTP RPVT+IF GF F + AMV++ VLQHFIY  GP Y+ P+          N +H
Sbjct: 445 FIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVH 504

Query: 467 VGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVS 526
           +GWQVPAYV I+ SEIFASITGLEYAYSKAPA MK+FIM++FL  NA GSA+G ALSP +
Sbjct: 505 IGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTA 564

Query: 527 KDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEIL 577
           ++P Y W +  LAVACF++G +FWLCF  YNK E+ +NALD+   E++++L
Sbjct: 565 ENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQML 615

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/523 (58%), Positives = 369/523 (70%), Gaps = 5/523 (0%)

Query: 65  PTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLN 124
           PT++EM+TL+RVGG IP RC+L+A++EL+ERFSYYGLSAPFQNYMQNGP D+PPG L LN
Sbjct: 71  PTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLN 130

Query: 125 SSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAG 184
           + GATGLSYFFQFWCYITPIFGGY+ADT WG+YN                   S   +  
Sbjct: 131 TQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTS 190

Query: 185 RDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQN 244
                                 K+NLSV+IA+Q+P ++ R+ T K G RVIED D+T+QN
Sbjct: 191 YSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQN 250

Query: 245 VFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGD 304
           VFM FY MIN+GSLSV+ATTELE   GFWAAYLLPFCFFW+AV+V++ G +++I  P GD
Sbjct: 251 VFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGD 310

Query: 305 RVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYW 364
           + I+KSFKV  IL KNKF+  SAKPS HPE  +PW DKFV+EI+RA+ AC VF FYPIYW
Sbjct: 311 KTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYW 370

Query: 365 TCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVT 424
            CYGQM+NNF+T G  M+LH LPND  Q             CE+ +YPF+RRFTPLRP+T
Sbjct: 371 VCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPIT 430

Query: 425 RIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLEL--GANDIHVGWQVPAYVFIAFSEI 482
           +I  GF F + +MVW+ VLQ F+Y   P Y  P     G N IHV WQVPAY  IA SEI
Sbjct: 431 KITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEI 490

Query: 483 FASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVAC 542
           FASITGLEYAYSKAPA+MKSFIM++FLF  A GSA+G ALSPVS DP +TW Y  LAV+C
Sbjct: 491 FASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSC 550

Query: 543 FLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDED 585
           F++G+ FWLCF +YN  EDE+N +   D + D I I    + D
Sbjct: 551 FIAGIAFWLCFSRYNDEEDELNNI---DDQPDVIQISSENEND 590

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/526 (58%), Positives = 380/526 (72%), Gaps = 10/526 (1%)

Query: 58  QEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSP 117
            + G E PT +EMKTLR V  +IP RC+LVA+VELAERFSYYGLSAPFQNYMQNGP D+P
Sbjct: 48  SDHGRE-PTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTP 106

Query: 118 PGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXX 177
            G+L L + GAT LSYFFQFWCY++P+ GG++ADT WG+Y                    
Sbjct: 107 KGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFIT 166

Query: 178 SFKTVAGRDXXXXXXXXXXXXXXXXXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIED 237
           S  ++                        K+N+SVLIADQIP  RP VK LKSGERVIED
Sbjct: 167 SVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIED 226

Query: 238 HDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQY 297
            ++T+QN+FMFFYLMINIGSLSVIATTE+E ++GFWAAYLLPFCFF++AV V++ G+ QY
Sbjct: 227 PNITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQY 286

Query: 298 IIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVF 357
           +  P GD+VI+KSFKVCWI+ +NKF   +A+PS +PE  +PW DKF+DEI+RA+AACKVF
Sbjct: 287 VKLPVGDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVF 346

Query: 358 LFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRF 417
           +FYPIYW CYGQM++NF++   MM+LHGLPND  QA            CE+FLYPFIRRF
Sbjct: 347 VFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRF 406

Query: 418 TPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIHVGWQV 471
           TP RP+T+IF GFIF A+AM W+ VLQHFIY  GP Y  P+          N IH+ WQV
Sbjct: 407 TPFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQV 466

Query: 472 PAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDY 531
           PAYV IAFSEIFASITGLEYAYSKAP +M+SFIM++FL   AFGSA+G ALS VS +P +
Sbjct: 467 PAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKF 526

Query: 532 TWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEIL 577
            W +  LAV+CF++G +FW  F KYN  E+ MNA+D+   EED++L
Sbjct: 527 VWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDY---EEDDVL 569

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/370 (66%), Positives = 300/370 (81%), Gaps = 3/370 (0%)

Query: 207 KSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTEL 266
           K+NLSVLIADQ+P ++P +K LKSGERV+ D ++T+QNVFMFFY MIN+GSLS++ATTEL
Sbjct: 3   KANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTEL 62

Query: 267 ELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITS 326
           E + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+VIAKSF+VCWIL KNKFD  +
Sbjct: 63  EYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFNA 122

Query: 327 AKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGL 386
           AKPS HPE ++PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LHG+
Sbjct: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182

Query: 387 PNDIFQAXXXXXXXXXXXXCEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHF 446
           PND  QA             EKF+YPFIRR+TP +P+T+IF GF+F + AM W+ VLQ F
Sbjct: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 242

Query: 447 IYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIM 505
           IY  GP Y+ PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSFIM
Sbjct: 243 IYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 302

Query: 506 ALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNA 565
           ++FL   AFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FW CFRKYN  E+EMNA
Sbjct: 303 SIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMNA 362

Query: 566 LDFTDSEEDE 575
           +D+   EEDE
Sbjct: 363 MDY--EEEDE 370

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 169/588 (28%), Positives = 257/588 (43%), Gaps = 57/588 (9%)

Query: 36  EHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAER 95
           E K+  A    DG  E D ++   + +  PT+ E   LRRV G   +  + + L+E +ER
Sbjct: 4   EKKNQYAVAEIDGHSE-DFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSER 62

Query: 96  FSYYGLSAPFQNYMQN-------------GPTDSPPGVLQLNSSGATGLSYFFQFWCYIT 142
            SYYG      N++Q                +++  G L +    AT L+    F  Y  
Sbjct: 63  ASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCF 122

Query: 143 PIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXXXXXX-XXXXXXXXX 201
           P+  GY+AD  WGR                     S   V G                  
Sbjct: 123 PLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAI 182

Query: 202 XXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVI 261
                K  L   +  Q P     VKTL SGERVI D D ++Q + M FY  IN+GS   +
Sbjct: 183 ATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSV 242

Query: 262 ATTELELNVGFWAAYLLPFCFFWI--AVIVIVAGKRQYIIK--PTGDRVIA---KSFKVC 314
           AT+    +VG+W A+L+P   F I  AV++++   R+YI    P+G  +IA   K  KVC
Sbjct: 243 ATSYSARDVGYWLAFLIPLALFMIMPAVLLVL---RRYIKDEPPSGRSLIADCLKVLKVC 299

Query: 315 --------------WILCK-------NKFDITSAKPSYHPESEFPWEDKFVDEIQRALAA 353
                         W   K        +     +KP ++PES        V + +  ++A
Sbjct: 300 FERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFYPES-------LVQDARVTISA 352

Query: 354 CKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPF 413
           C +FL+Y IY    G + +   +  + +   G+PND+                ++ +YP 
Sbjct: 353 CTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPL 412

Query: 414 IRRFT-PLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGP--NYNRPLELGANDIHVGWQ 470
           +R+     RPV RIF GF+ AA+A     ++QH IY T P  NY    E G + I +   
Sbjct: 413 LRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVV 472

Query: 471 VPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPD 530
              Y    FSE  A  TG E A+ ++P +MK+F+MALFLFM+A  +A+G  ++P   DP 
Sbjct: 473 AIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPH 532

Query: 531 YTWLYGSLA-VACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEIL 577
               +G LA +   ++    W  +  ++ +E E    +    +E+  L
Sbjct: 533 LVIPFGVLAGLGAAVAFAFLWRYWNLHHVMEQERIEREALAKQEEPAL 580

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  195 bits (496), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 149/552 (26%), Positives = 237/552 (42%), Gaps = 40/552 (7%)

Query: 65  PTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQN------------- 111
           PT+ E  TLRRV     +  + + L+E +ER SYYG      N++Q              
Sbjct: 37  PTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPA 96

Query: 112 ---GPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXX 168
                  +  G L +    AT L+    F  Y  P+  GY+AD  W R            
Sbjct: 97  HGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGI 156

Query: 169 XXXXXXXXXSFKTVAGRDXXXXXXXXXXXXXXXXXXX-XKSNLSVLIADQIPAKRPRVKT 227
                    +   V G                       K  L   +  Q P +   V+T
Sbjct: 157 ISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRT 216

Query: 228 LKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIA- 286
           L SGERV+ D D ++Q + M FY  INIGS   +AT+    ++G+W A+L+P   + I  
Sbjct: 217 LASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMP 276

Query: 287 VIVIVAGKRQYIIKPTGDRVIA---KSFKVC-----WILCKNKFDITSAKPSYHPES-EF 337
            +++V G+      P+G  ++A   K  +VC     W   ++      A+PS   ++   
Sbjct: 277 AVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRA 336

Query: 338 PWEDK---------FVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPN 388
            W  K          V + +  L+A  +FL+Y IY    G + +   +  + +  +G+PN
Sbjct: 337 GWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPN 396

Query: 389 DIFQAXXXXXXXXXXXXCEKFLYPFIRRFT-PLRPVTRIFCGFIFAAMAMVWSCVLQHFI 447
           D+                +  LYP +R+     +PV RIFCGF+ AA+A     ++Q  I
Sbjct: 397 DLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVI 456

Query: 448 YSTGP--NYNRPLELGANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIM 505
           Y+T P   Y    + G + + +      Y     SE  A  TG E A+ ++PA+MKSF+M
Sbjct: 457 YNTSPCGRYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVM 516

Query: 506 ALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLA-VACFLSGLIFWLCFRKYNKIEDEMN 564
           ALFLF +A  +A+G  ++P   DP     +G LA +  F++ +  W  +     +E E  
Sbjct: 517 ALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERA 576

Query: 565 ALDFTDSEEDEI 576
                ++EE  +
Sbjct: 577 ERRALEAEEGAM 588

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  184 bits (468), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 163/588 (27%), Positives = 247/588 (42%), Gaps = 50/588 (8%)

Query: 40  TEAYTLQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYY 99
           + A T+Q+   E       E G  +PT++E +TLRR+     +  +L+  +ELAER SYY
Sbjct: 21  SNAATVQEAPQEVKERSDIEIG--LPTEEEERTLRRIVVHPSWYVYLICFIELAERASYY 78

Query: 100 GLSAPFQNYMQ-------NGP------TDSPPGVLQLNSSGATGLSYFFQFWCYITPIFG 146
           G      NY         NG       +++  G L    + AT L    +F  Y  P+  
Sbjct: 79  GTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSLGLLLKFTSYFFPLVT 138

Query: 147 GYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGR-DXXXXXXXXXXXXXXXXXXX 205
           GYL D   G                      +   V    D                   
Sbjct: 139 GYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMALSLIGLITLSVCTAF 198

Query: 206 XKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTE 265
            K  L  L+  Q P +   VKTL++GERVI D D ++Q + M FY  INIG+   +AT+ 
Sbjct: 199 VKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSY 258

Query: 266 LELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYII--KPTGDRVIAKSFKVCWI------- 316
               VGFW A+L+P   + +A+ V+ +  + +I    P+G  ++A   KV ++       
Sbjct: 259 AAKEVGFWLAFLIPLIIY-MAMPVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWN 317

Query: 317 ------------LCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYW 364
                       L  N+  +   K  +  +S F +++  V + +  L+AC +F +Y IY 
Sbjct: 318 ARRKEGVFWDYALPSNQRQM--GKVGWRKKSPF-YKESLVQDTKITLSACFIFCYYIIYN 374

Query: 365 TCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRF-TPLRPV 423
               Q+     +    M  +G+PND+                +  LYP +RR     +PV
Sbjct: 375 MNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPV 434

Query: 424 TRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHV----GWQVPA-YVFIA 478
            RIF GF+ A  + V   ++Q  IY T              + V     W V   Y    
Sbjct: 435 YRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPLSSWIVAVEYTLSG 494

Query: 479 FSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSL 538
            SE  A  T  E AY ++P +MKSF++ALFLF +A  +AI   ++P+ KDP     +   
Sbjct: 495 ASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIVPFALF 554

Query: 539 AVACFLSGLIFWLCFRKYNK---IEDEMNALDFTDSEEDEILIRRAED 583
           A   F+SG  F   FR  +K    E     L    SE DE+ +   +D
Sbjct: 555 AGIGFISGCHFLWKFRNLDKEMLQEKRERELLQESSESDELEVVEIKD 602

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  178 bits (452), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 152/577 (26%), Positives = 232/577 (40%), Gaps = 53/577 (9%)

Query: 30  VSSSDGEHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQ----------DEMKTLRRVGGR 79
           ++S++ E K+ E         +PD   +Q E   + TQ          +E K LR V   
Sbjct: 1   MNSAEPEPKNIEK--------KPDSSSFQNEIVTVCTQYPEELLEPTEEEEKRLRHVVAA 52

Query: 80  IPFRCFLVALVELAERFSYYGLSAPFQNYMQ-----------NGPTDSPPGVLQLNSSGA 128
             +  +++ L+ELAER SYYG      N+ Q            GP D  PG L      A
Sbjct: 53  PKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGALGRGLQVA 112

Query: 129 TGLSYFFQFWCYITPIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTVAGRDXX 188
           T L+   +F  Y  P+  GY+AD   G                      +   V   +  
Sbjct: 113 TSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAALPAVIKHNNL 172

Query: 189 XXXXXXXXXXXXXX-XXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFM 247
                              K  L  ++  Q P +   VKTL +GERVI + D ++Q + M
Sbjct: 173 CMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDASLQRMSM 232

Query: 248 FFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVI 307
            FY  IN+GS   +AT      VG+W ++L+P   F I   +++  K   +  P G+ + 
Sbjct: 233 TFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTPPLGESLF 292

Query: 308 A---KSFKVC--------------WILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRA 350
           A   K  KVC              W   K        +  +    E  +++  V++ +  
Sbjct: 293 AECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKESLVEDTRIT 352

Query: 351 LAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFL 410
           LAAC +FL+Y IY     Q+ +        M   G+PND+                +  L
Sbjct: 353 LAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIIITMPIIDYGL 412

Query: 411 YPFIRRF-TPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVG- 468
            P +RR     +PV RIF GF+ A +A V   ++Q  IY+T P              V  
Sbjct: 413 NPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTCSETIRQVSP 472

Query: 469 ---WQVPA-YVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSP 524
              W V   YV    SE FA  TG E A+ ++P +MK+F+M+LFL   A  S +    + 
Sbjct: 473 LSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALSSILTQIFNG 532

Query: 525 VSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIED 561
           +  DP     +   AV   L  ++F   +   +K+ +
Sbjct: 533 IMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKVME 569

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  171 bits (434), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 161/583 (27%), Positives = 248/583 (42%), Gaps = 67/583 (11%)

Query: 36  EHKDTEAYT-LQDGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAE 94
           E K+T     +QD  +E +    + E  +IPT+ E  TLRR+        + + L+E AE
Sbjct: 3   EEKETAKVNFVQD--LEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAE 60

Query: 95  RFSYYGLSAPFQNYMQ------------NGPTDSPPGVLQLNSSGATGLSYFFQFWCYIT 142
           R S+YG      N+ Q             GP +  PG L    + AT +    +F  Y  
Sbjct: 61  RGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTF 120

Query: 143 PIFGGYLADTKWGRYNXXXXXXXXXXXXXXXXXXXSFKTV-AGRDXXXXXXXXXXXXXXX 201
            I  GY++D   G+                     +  +V A  +               
Sbjct: 121 SIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSL 180

Query: 202 XXXXXKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVI 261
                K  L  L+  Q P K   VKTL SGERVI D D ++Q + M FY  IN+G+   +
Sbjct: 181 CTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSL 240

Query: 262 ATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIK---PTGDRVIAKSFKVC---- 314
           AT      VG+W A+ +P   + +  IV+   K Q  IK   P+ + V+A+S KV     
Sbjct: 241 ATAYSAQRVGYWLAFTVPLIIYLLMPIVL--WKLQEDIKTNEPSRESVLAESLKVLKVCY 298

Query: 315 -------------WILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYP 361
                        W   K    I   +  +  +    +++K+V + +  ++AC +FL+Y 
Sbjct: 299 EWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYV 358

Query: 362 IYWTCYGQMVNNF----ITMGSMMQLHGLPNDIFQAXXXXXXXXXXXXCEKFLYPFIRRF 417
           IY     QM +N      +    M+  G+PND+F               +  LYP +RR+
Sbjct: 359 IY-----QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRY 413

Query: 418 -TPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGP-NYNRPLELGAN---DIH------ 466
               +PV RIFCGF+   +      ++Q  +Y+T P  Y     +GA    ++H      
Sbjct: 414 RINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGY-----MGATTCPELHHKKSPL 468

Query: 467 VGWQVP-AYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPV 525
             W V   Y     SE  A  TG E A+ ++P  MK F++ALF+F  A  SAI   ++P 
Sbjct: 469 SRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPF 528

Query: 526 SKDPDYTWLYGSLAVACFLSGLIF---WLCFRKYNKIEDEMNA 565
            KDP     +   A    L+ +IF   +    K  K+E E+++
Sbjct: 529 FKDPYLIQPFAVCAGVGALTAIIFLWRYWDLDKQMKLERELSS 571

>KNAG0A01870 Chr1 (132203..134533) [2331 bp, 776 aa] {ON} 
          Length = 776

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 4/88 (4%)

Query: 65  PTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSA----PFQNYMQNGPTDSPPGV 120
           PTQD  +T+     + P   FL+     + R  Y   +     P++  ++   T  P   
Sbjct: 687 PTQDNSETITTAATQTPLDPFLIPTTTDSSRVVYIPHTTPTVDPYETDIEPEETKDPMNE 746

Query: 121 LQLNSSGATGLSYFFQFWCYITPIFGGY 148
           L  N +  + L    Q WC+ +  +G Y
Sbjct: 747 LDTNDTQGSPLLSRHQRWCHRSLGWGLY 774

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,623,642
Number of extensions: 2492584
Number of successful extensions: 9675
Number of sequences better than 10.0: 33
Number of HSP's gapped: 9862
Number of HSP's successfully gapped: 38
Length of query: 591
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 476
Effective length of database: 40,294,809
Effective search space: 19180329084
Effective search space used: 19180329084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)