Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H00230singletonON59659631700.0
KAFR0H002405.698ON59159223440.0
KNAG0C065705.698ON59055621300.0
NCAS0A032205.698ON61157320620.0
YKR093W (PTR2)5.698ON60159820480.0
Suva_11.3295.698ON60159820420.0
Smik_11.3565.698ON60259820330.0
ZYRO0G06688g5.698ON61356420320.0
NDAI0E050205.698ON61956720050.0
TBLA0A091205.698ON63360320020.0
TDEL0B022305.698ON57456319900.0
Kpol_529.285.698ON61060619660.0
TPHA0N01960singletonON59159319630.0
CAGL0G02453g5.698ON59758019590.0
TPHA0O02000singletonON62059819610.0
SAKL0E14828g5.698ON59257319540.0
TBLA0B04710singletonON61555819310.0
TBLA0E01140singletonON61158318900.0
KLLA0E12915g5.698ON65455918940.0
Skud_11.3315.698ON39939414250.0
Kwal_47.16930na 1ON6115476584e-77
Ecym_2823na 2ON6135606061e-69
KLTH0D16544gna 1ON6265335904e-67
AFR228WsingletonON5765645612e-63
AGL365Cna 2ON5995455596e-63
NDAI0C041005.316ON56071870.070
ADL156Cna 3ON483207820.26
NCAS0A11500singletonON614119820.28
TBLA0A10540singletonON493131810.35
NDAI0F01930singletonON564113810.36
TBLA0F01600singletonON567101800.48
AFL204C5.396ON535113790.62
SAKL0A05676gna 4ON613196790.64
TBLA0C01160singletonON60072771.1
NDAI0C023705.225ON63997771.1
Kwal_47.16934singletonOFF26731751.4
NDAI0F01940singletonON55185751.9
KLTH0A01166g3.53ON476105742.4
Skud_12.4414.191ON197109722.5
NDAI0D00820singletonON562109742.5
TDEL0B07220na 5ON57358742.5
SAKL0G13618g5.174ON106170742.8
NCAS0H018905.396ON59168733.3
TBLA0B058702.267ON73069733.5
KNAG0B043705.394ON557122715.7
ZYRO0G18700g1.173ON591166715.7
ACL172C3.245ON63169715.8
YNR054C (ESF2)6.381ON31671706.2
CAGL0F06831g2.662ON109254716.3
TPHA0B013707.463ON137944716.4
Ecym_44887.140ON426110706.9
ZYRO0E06006g2.560ON513115707.3
TPHA0N007805.221ON59072707.6
TDEL0A017006.138ON29747697.9
KLTH0F14322g3.473ON90035708.1
NDAI0G044602.651ON113838708.3
SAKL0A04004g6.233ON118060708.3
KNAG0A060202.409ON125258708.4
KAFR0I026205.14ON179449708.6
KLLA0A06710g1.175ON42353699.1
Kwal_55.211723.480ON25173689.5
KAFR0D015508.783ON517182699.6
TBLA0F018107.5ON58756699.9
Kpol_416.5singletonON607806910.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KAFR0H00230
         (1791 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}     1225   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   907   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   825   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   798   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   793   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   791   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   787   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   787   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   776   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   775   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   771   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   761   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   760   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   759   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   759   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   757   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            748   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   732   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   734   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   553   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   258   4e-77
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   238   1e-69
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   231   4e-67
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   220   2e-63
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   219   6e-63
NDAI0C04100 Chr3 (933968..935650) [1683 bp, 560 aa] {ON} Anc_5.3...    38   0.070
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    36   0.26 
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    36   0.28 
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             36   0.35 
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               36   0.36 
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    35   0.48 
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    35   0.62 
SAKL0A05676g Chr1 (515333..517174) [1842 bp, 613 aa] {ON} simila...    35   0.64 
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    34   1.1  
NDAI0C02370 Chr3 complement(541713..543632) [1920 bp, 639 aa] {O...    34   1.1  
Kwal_47.16934 s47 complement(177802..178605) [804 bp, 267 aa] {O...    33   1.4  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               33   1.9  
KLTH0A01166g Chr1 complement(108732..110162) [1431 bp, 476 aa] {...    33   2.4  
Skud_12.441 Chr12 (780487..781080) [594 bp, 197 aa] {ON} YLR356W...    32   2.5  
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    33   2.5  
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...    33   2.5  
SAKL0G13618g Chr7 complement(1165467..1168652) [3186 bp, 1061 aa...    33   2.8  
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    33   3.3  
TBLA0B05870 Chr2 complement(1379979..1382171) [2193 bp, 730 aa] ...    33   3.5  
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               32   5.7  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    32   5.7  
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    32   5.8  
YNR054C Chr14 complement(723356..724306) [951 bp, 316 aa] {ON}  ...    32   6.2  
CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} simil...    32   6.3  
TPHA0B01370 Chr2 complement(304248..308387) [4140 bp, 1379 aa] {...    32   6.4  
Ecym_4488 Chr4 (987058..988338) [1281 bp, 426 aa] {ON} similar t...    32   6.9  
ZYRO0E06006g Chr5 complement(463341..464882) [1542 bp, 513 aa] {...    32   7.3  
TPHA0N00780 Chr14 (173788..175560) [1773 bp, 590 aa] {ON} Anc_5....    32   7.6  
TDEL0A01700 Chr1 (305211..306104) [894 bp, 297 aa] {ON} Anc_6.13...    31   7.9  
KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} simi...    32   8.1  
NDAI0G04460 Chr7 complement(1066524..1069940) [3417 bp, 1138 aa]...    32   8.3  
SAKL0A04004g Chr1 (373666..377208) [3543 bp, 1180 aa] {ON} simil...    32   8.3  
KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {...    32   8.4  
KAFR0I02620 Chr9 (530945..536329) [5385 bp, 1794 aa] {ON} Anc_5....    32   8.6  
KLLA0A06710g Chr1 (608103..609374) [1272 bp, 423 aa] {ON} simila...    31   9.1  
Kwal_55.21172 s55 (715533..716288) [756 bp, 251 aa] {ON} YPR143W...    31   9.5  
KAFR0D01550 Chr4 complement(307032..308585) [1554 bp, 517 aa] {O...    31   9.6  
TBLA0F01810 Chr6 (448644..450407) [1764 bp, 587 aa] {ON} Anc_7.5...    31   9.9  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    31   10.0 

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score = 1225 bits (3170), Expect = 0.0
 Identities = 596/596 (100%), Positives = 596/596 (100%)
 Frame = +1

Query: 1    MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 180
            MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE
Sbjct: 1    MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 60

Query: 181  GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 360
            GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV
Sbjct: 61   GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 120

Query: 361  LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 540
            LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK
Sbjct: 121  LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 180

Query: 541  SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 720
            SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI
Sbjct: 181  SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 240

Query: 721  TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 900
            TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK
Sbjct: 241  TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 300

Query: 901  PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 1080
            PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY
Sbjct: 301  PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 360

Query: 1081 PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 1260
            PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF
Sbjct: 361  PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 420

Query: 1261 RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS 1440
            RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS
Sbjct: 421  RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS 480

Query: 1441 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 1620
            EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV
Sbjct: 481  EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540

Query: 1621 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 1788
            TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL
Sbjct: 541  TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 596

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
            Anc_5.698 YKR093W
          Length = 591

 Score =  907 bits (2344), Expect = 0.0
 Identities = 440/592 (74%), Positives = 499/592 (84%), Gaps = 3/592 (0%)
 Frame = +1

Query: 1    MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSED-QILDTESYKLQNDNEFDPEHPDYQE 177
            MS+H  + +       + EKN I+LK T VSS D +  DTE+Y LQ D   +P+H DYQE
Sbjct: 1    MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQ-DGSIEPDHEDYQE 59

Query: 178  EGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPG 357
            EGYE+PT++E++TLR V GRIPFRCFL+A+VEL+ERFSYYGLSAPFQNYM N P+DSPPG
Sbjct: 60   EGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPG 119

Query: 358  VLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF 537
            VLQLNS GATGLSYFFQFWCYITP+ GGYLADT WGRYNTI VGT IYI+GIF+LFITSF
Sbjct: 120  VLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSF 179

Query: 538  KSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHD 717
            K++AG++GAL GFI+ALILIG  TG IK+NLSVLIADQIPAKRPRVKTLKSGERVIEDHD
Sbjct: 180  KTVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHD 239

Query: 718  ITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTL 897
            +TIQNVFMFFYLMINIGSLSVIATTELE +VGFWAAYLLPFCFFWIAVIV+V G+R Y +
Sbjct: 240  VTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYII 299

Query: 898  KPTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLF 1077
            KPT DRVI KSFK CW L KNKF+ ++  P+ +PE  F W+DKFV+EI+ ALAACKVFLF
Sbjct: 300  KPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLF 359

Query: 1078 YPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTP 1257
            YPIYWTCYGQM NNF+TMGSM+QLHGLPNDIFQAI+SI+LI+FIPICEKF YPFIRRFTP
Sbjct: 360  YPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTP 419

Query: 1258 FRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAF 1437
             RP+T+I  GF  A+ +MVW+CVLQ+FIY TGPNY  PL  G N++HV WQVPAYV IAF
Sbjct: 420  LRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAF 479

Query: 1438 SEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLA 1617
            SEIFASITGLEYAYSKAPA+MKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY  LA
Sbjct: 480  SEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLA 539

Query: 1618 VTAFITGCAFWFCFRHYNDIEDEMNALNYED--EDIITENNQDIEMVHPLSA 1767
            V  F++G  FW CFR YN IEDEMNAL++ D  ED I     + E V  L A
Sbjct: 540  VACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA 591

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5.698
            YKR093W
          Length = 590

 Score =  825 bits (2130), Expect = 0.0
 Identities = 396/556 (71%), Positives = 456/556 (82%), Gaps = 4/556 (0%)
 Frame = +1

Query: 52   DEKNNIDLKKT---TVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLR 222
            D+KN++ L K    T+  + +I+D          +   ++ D   EGYE+PTEEELRTL+
Sbjct: 16   DKKNDLVLTKENSHTIEEDSRIVD----------DLASQYEDDIPEGYEVPTEEELRTLK 65

Query: 223  HVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYF 402
            HV G IP RC+LIAVVELSERFSYYGLSAPFQNYMAN P D PPG+LQLNSDGATGLSYF
Sbjct: 66   HVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYF 125

Query: 403  FQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIV 582
            FQFWCY+TP+ GGY+ADT+WG+YNTIAVGTGIYI GIF+LF+TS  SI  KN  LGGFIV
Sbjct: 126  FQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIV 185

Query: 583  ALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMIN 762
            A+ILIGI TG IK+NLSVLIADQ+P ++P VKT K+GERVIED ++T+QNVFMFFYLMIN
Sbjct: 186  AIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMIN 245

Query: 763  IGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFC 942
            IGSLSVIAT+ELE H GFWAAYLLPFCFFWIAV+VLVLG+  Y   P  D+VI K FK  
Sbjct: 246  IGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVL 305

Query: 943  WALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNF 1122
            W LTKN+FN+ A  P+ NP   + W DKFV+EI+ AL ACKVFLFYPIYWTCYGQM + F
Sbjct: 306  WILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGF 365

Query: 1123 VTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLAS 1302
            VT GSM++LHGLPND FQ IDSIA+IVFIP+CE   YPFIR++TPFRPITKI +GF  AS
Sbjct: 366  VTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFAS 425

Query: 1303 ASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAY 1479
              M+WA VLQ +IYK GP+YK PL  DGPN +HVA QVPAYVL+AFSEIFASITGLEYAY
Sbjct: 426  GCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAY 485

Query: 1480 SKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCF 1659
            SKAPASMKSFIM++FL  NAFGSAIGCALSPVSKDPD+TWLY GLAV  FI+GC FW CF
Sbjct: 486  SKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCF 545

Query: 1660 RHYNDIEDEMNALNYE 1707
            R YNDIE+EMNA++YE
Sbjct: 546  RKYNDIEEEMNAMDYE 561

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
            Anc_5.698
          Length = 611

 Score =  798 bits (2062), Expect = 0.0
 Identities = 382/573 (66%), Positives = 457/573 (79%), Gaps = 1/573 (0%)
 Frame = +1

Query: 13   TNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEM 192
            T  E  +      ++   I LK+TT SSE+   + E+Y + +D E +P        GYE+
Sbjct: 16   TEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEP--------GYEI 67

Query: 193  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLN 372
            PTEE++ TLRHVSG+IP RC+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVL+LN
Sbjct: 68   PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELN 127

Query: 373  SDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAG 552
            S GATGLSYFFQFWCY+TPV GG++ADT WG+YNTI VGTGIY+ GIF+LFITS  SIA 
Sbjct: 128  SSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIAS 187

Query: 553  KNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQN 732
            K+ +LGGFI A+ILIGI TG IKANLSVLIADQ+P ++PRVKTLKSGERV+ED +IT+QN
Sbjct: 188  KDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQN 247

Query: 733  VFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSD 912
            VFM+FYLM+N+GSLSVIATTELE+H  FWAA+LLPFCFFWIAV+VLV GR  Y  +   +
Sbjct: 248  VFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKRE 307

Query: 913  RVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYW 1092
            + I+KSFK  W ++KNKF+ ++  P+ +PE  + W DKFV+E   AL+ACKVFLFYPIYW
Sbjct: 308  KSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYW 367

Query: 1093 TCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPIT 1272
              YG M + FVT GSM++LHGLPNDIFQAIDS ALI+FIPICE+F YPFIRRFTPF+PIT
Sbjct: 368  VIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPIT 427

Query: 1273 KITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEIF 1449
            KI +GF  A+ +MVW+CVLQ FIYK GP Y HPL   GPN +HV WQVPAYVLIAFSEI 
Sbjct: 428  KIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEIL 487

Query: 1450 ASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAF 1629
            ASITGLEYAYSKAP SMKSFIM+LFLF NA GS +G ALSPVS DP +TWL+ GL V  F
Sbjct: 488  ASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACF 547

Query: 1630 ITGCAFWFCFRHYNDIEDEMNALNYEDEDIITE 1728
            I GC FW  FR YND E+EMNA++YEDE+ + E
Sbjct: 548  IGGCIFWIIFRKYNDTEEEMNAMDYEDEEDLRE 580

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
            membrane peptide transporter, mediates transport of di-
            and tri-peptides; conserved protein that contains 12
            transmembrane domains; PTR2 expression is regulated by
            the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  793 bits (2048), Expect = 0.0
 Identities = 380/598 (63%), Positives = 457/598 (76%), Gaps = 7/598 (1%)
 Frame = +1

Query: 4    SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 183
            S     E+     VI +EK      K +  S+D    TE Y L          P  ++E 
Sbjct: 9    SDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLS---------PSPEDED 59

Query: 184  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 363
            +E PTEEE++TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 60   FEGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119

Query: 364  QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 543
             LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120  SLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 544  IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 723
            +  ++ A+GGFI A+ILIGI TG IKANLSVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 180  VGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNIT 239

Query: 724  IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 903
            +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 240  LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299

Query: 904  TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 1083
              D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300  IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYP 359

Query: 1084 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 1263
            IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TP +
Sbjct: 360  IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLK 419

Query: 1264 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 1440
            PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 420  PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFS 479

Query: 1441 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 1620
            EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480  EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 1621 TAFITGCAFWFCFRHYNDIEDEMNALNYEDED------IITENNQDIEMVHPLSAYTS 1776
              FI+GC FW CFR YND E+EMNA++YE+ED      I      DIE++ P+ +  S
Sbjct: 540  ACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 597

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
            (REAL)
          Length = 601

 Score =  791 bits (2042), Expect = 0.0
 Identities = 377/598 (63%), Positives = 460/598 (76%), Gaps = 7/598 (1%)
 Frame = +1

Query: 4    SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 183
            S     E+  +  V+ +EKN     K +  S+D    TE + L          P  ++  
Sbjct: 9    SDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLS---------PSPEDNE 59

Query: 184  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 363
            +E PT+EELR+LRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+D+P G+L
Sbjct: 60   FEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGML 119

Query: 364  QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 543
             LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120  SLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 544  IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 723
            +  ++ ALGGFI ++ILIGI TG IKANLSVLIADQ+P ++P +K LKSGERVIED +IT
Sbjct: 180  VGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNIT 239

Query: 724  IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 903
            +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFW+AV+ LV G++ Y  +P
Sbjct: 240  LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRP 299

Query: 904  TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 1083
              D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300  IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYP 359

Query: 1084 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 1263
            IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TPF+
Sbjct: 360  IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFK 419

Query: 1264 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 1440
            PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 420  PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFS 479

Query: 1441 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 1620
            EIFASITGLEYAYSKAPA+MKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480  EIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 1621 TAFITGCAFWFCFRHYNDIEDEMNALNYEDED------IITENNQDIEMVHPLSAYTS 1776
              FI+GC FW CFR YND E+EMNA++YE+ED      I      DIE++ P+ +  S
Sbjct: 540  ACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKS 597

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
            (REAL)
          Length = 602

 Score =  787 bits (2033), Expect = 0.0
 Identities = 376/598 (62%), Positives = 457/598 (76%), Gaps = 7/598 (1%)
 Frame = +1

Query: 4    SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 183
            S     E+     VI +EK +    K +  S+D    TE Y L +  E         +E 
Sbjct: 9    SDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPE---------DED 59

Query: 184  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 363
            +E PTEEE +TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 60   FEAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119

Query: 364  QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 543
             LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120  GLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 544  IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 723
            +  ++ A+GGFI A+ILIGI TG IKAN+SVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 180  VGNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNIT 239

Query: 724  IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 903
            +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 240  LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299

Query: 904  TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 1083
              D+V+ KSF+ CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300  IGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYP 359

Query: 1084 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 1263
            IYWT YG M ++F+T  SM++LHG+PND  QA DSIALIVFIPI EKF YPFIRR+TP +
Sbjct: 360  IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLK 419

Query: 1264 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 1440
            PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN++HV WQ+PAYVLI+FS
Sbjct: 420  PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFS 479

Query: 1441 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 1620
            EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480  EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 1621 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENN------QDIEMVHPLSAYTS 1776
              FI+GC FW CFR YND E+EMNA++YE++D    N+       DIE++ P  +  S
Sbjct: 540  ACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRS 597

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
            similar to uniprot|P32901 Saccharomyces cerevisiae
            YKR093W PTR2 Functions in transport of small peptides
            into the cell Peptide transporter
          Length = 613

 Score =  787 bits (2032), Expect = 0.0
 Identities = 379/564 (67%), Positives = 449/564 (79%), Gaps = 7/564 (1%)
 Frame = +1

Query: 76   KKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCF 255
            +K  V  ED+ L+      + + +FD    +Y+    + PTEEELR+LRHV G IPFRC+
Sbjct: 12   EKNKVIIEDKSLEVSGSHERGELDFD----EYEVPNDDEPTEEELRSLRHVGGHIPFRCW 67

Query: 256  LIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVL 435
            LIA+VELSERFSYYGLSAPFQNYM N   D+P GVL L S GATGL+YFFQFWCY+TPV 
Sbjct: 68   LIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVF 127

Query: 436  GGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGF 615
            GG+LADT WG+Y TI VGTG+Y+VGIF+LFITS  S+  KN ALGGFI A++LIGI TG 
Sbjct: 128  GGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGM 187

Query: 616  IKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTE 795
            IKANLSVLIADQ P ++PR+KT K GERVIED +ITIQNVFMFFYLMINIGSLSVIATTE
Sbjct: 188  IKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTE 247

Query: 796  LEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWS 975
            LE+H GFWAAYLLPFCFFWIAVIVL +GR+SY   P  D+VI KSF+    L K++F++ 
Sbjct: 248  LEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYE 307

Query: 976  AVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHG 1155
            AV P+ +PE  + W+D FVEEI+ AL ACKVF+FYPIYW  YGQMT+ FV++G  +QLHG
Sbjct: 308  AVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHG 367

Query: 1156 LPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQY 1335
            LPND FQAIDSIALIVFIPICE + YPFIRR+TPF+PITKI +GF   SASM+WA VLQ+
Sbjct: 368  LPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQH 427

Query: 1336 FIYKTGPNYKHPL--ADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSF 1509
            FIYKTGP Y HP+   +GPNN+H+ WQVPAYVLIAFSEIFASITGLEYAYSKAP SMKSF
Sbjct: 428  FIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSF 487

Query: 1510 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 1689
            IM++FL  NAFGSAIGCALSPV  DP Y W++ GLAV +FI+GC FW  F H ND E+EM
Sbjct: 488  IMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEM 547

Query: 1690 NALNYED-----EDIITENNQDIE 1746
            NA++YE+     +D + +   D+E
Sbjct: 548  NAMDYEENQEKIDDGLQKGTSDLE 571

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5.698
          Length = 619

 Score =  776 bits (2005), Expect = 0.0
 Identities = 371/567 (65%), Positives = 449/567 (79%), Gaps = 6/567 (1%)
 Frame = +1

Query: 31   EKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQND-----NEFDPEHPDYQEEGYEMP 195
            EK+  IT  K   +   TT S+E+++ D E+Y L N      N+FD    D  EEGYE P
Sbjct: 21   EKIEEITTTKK--ETNATTSSTEEKLHDVETYNLSNSANDSTNDFDD---DEMEEGYEEP 75

Query: 196  TEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNS 375
            T+EEL TL+ V G+IP RC+LI VVEL+ERFSYYGLSAPFQNYM N P+DSP GVL LNS
Sbjct: 76   TDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNS 135

Query: 376  DGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGK 555
             GATGLSYFFQFWCY+TPV GG++ADT WG+YN+I+VGTG YIVGIF+LFIT+  SIA +
Sbjct: 136  SGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQ 195

Query: 556  NGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNV 735
            N +LGGFIV++ILIGIGTGFIKANLSVLIADQ+P ++PRVK LKSGERVIED +IT+QNV
Sbjct: 196  NASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNV 255

Query: 736  FMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDR 915
            FM FYLMINIGS+SV+ATTELE H GFWAAYLLPFCFFWIAV++LV GR+ Y  +   D 
Sbjct: 256  FMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDN 315

Query: 916  VIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWT 1095
            V++KSFK CW + KNK +++A  P+ +PE  + W+D+FV+E++  +AACKVF+FYPIYW 
Sbjct: 316  VVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWV 375

Query: 1096 CYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITK 1275
             YG M + FVT GS ++LHG+PND  Q  DSIALI+FIPI E F YPFIRRFTP RPITK
Sbjct: 376  QYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITK 435

Query: 1276 ITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFA 1452
            IT GF++   +M WA VLQ+FIY TGP Y HPL+ D PN +HVAWQ+PAYVLIAFSEIFA
Sbjct: 436  ITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFA 495

Query: 1453 SITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFI 1632
            SITGLEYAYSKAP SMKSF+M++FL  NAFGS +G ALS V+ DP + WL+ GLAV+  +
Sbjct: 496  SITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGV 555

Query: 1633 TGCAFWFCFRHYNDIEDEMNALNYEDE 1713
            TG  FW CFR  N  E+EMNA++Y+ E
Sbjct: 556  TGILFWLCFRGLNATEEEMNAMDYDAE 582

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] {ON}
            Anc_5.698 YKR093W
          Length = 633

 Score =  775 bits (2002), Expect = 0.0
 Identities = 376/603 (62%), Positives = 458/603 (75%), Gaps = 12/603 (1%)
 Frame = +1

Query: 4    SSHTNSEEAEKLSVITDEKNNIDLKKTT--------VSSEDQILDTESYKLQNDNEFDPE 159
            S  T +E+   ++ I    NN ++ +          + ++D+  D +    Q D+    +
Sbjct: 12   SFETENEQVNDVTTIDVTDNNQNVVQMVNGGGDIDYIPTQDEKRDQKFETFQEDSSIIND 71

Query: 160  HPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTP 339
              +   E +E PTEEELRTL+HV G+IP RC+L+AV+EL+ERFSYYGLSAPFQNYM N P
Sbjct: 72   ENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGP 131

Query: 340  SDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFV 519
            +DSPPG L L+S GATGLSYFFQFWCY+TPV  GY+ADT WG++ TI +GTGIYIVGIF+
Sbjct: 132  NDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFI 191

Query: 520  LFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGER 699
            LFITS  SI   N A+GGFIV LIL+GI TG IKANLSV+IA+QIP ++ RV T K+G R
Sbjct: 192  LFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTR 251

Query: 700  VIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLG 879
            VIED DITIQNVFM FY MINIGSLSVIATTELE H GFWAAYLLPFCFFW+AVIVL++G
Sbjct: 252  VIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVG 311

Query: 880  RRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAA 1059
             ++Y   P  D+VI K FK    L +N+FN  +  PA NP+  + W DKFV+EI  AL A
Sbjct: 312  NKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQA 371

Query: 1060 CKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPF 1239
            CKVF+FYPIYW CYGQM NNFV+ G  ++LHGLPND FQAIDSIALIVFIPICE+F YPF
Sbjct: 372  CKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPF 431

Query: 1240 IRRFTPFRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHP--LADGPNNVHVAWQV 1413
            IR++TPF+PITKI +GF   + SM WACVLQ+FIYK  P Y HP    +GPN++HVA QV
Sbjct: 432  IRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQV 491

Query: 1414 PAYVLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDY 1593
            PAY L+A SEIFASITGLEYAYSKAPASMK+FIM++FL  NAFG+AIGCALSPVSKDP Y
Sbjct: 492  PAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKY 551

Query: 1594 TWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDED--IITENNQDIEMVHPLSA 1767
             WLY GLAV  F+ GC FW  F+ YND+E+E+N L++E+ D  + T++  DIEM+ P+S+
Sbjct: 552  VWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISS 611

Query: 1768 YTS 1776
              S
Sbjct: 612  RRS 614

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
            Anc_5.698 YKR093W
          Length = 574

 Score =  771 bits (1990), Expect = 0.0
 Identities = 370/563 (65%), Positives = 444/563 (78%), Gaps = 7/563 (1%)
 Frame = +1

Query: 73   LKKTTVSSEDQILDTESYK---LQNDN--EFDPEHPDYQEEGYE-MPTEEELRTLRHVSG 234
            +K+T  SS D +   E  K   + +D   E    H   + E Y+  PTEEE++TL+HV+G
Sbjct: 1    MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60

Query: 235  RIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFW 414
             IPFRC+LIAVVELSERF+YYGLS PFQNYM N P D+P G+L L S GATGLSYFFQFW
Sbjct: 61   TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120

Query: 415  CYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALIL 594
            CY+TP+ GG+L+DT  G+YNTI  GTG+Y++GI +LF+TS  SI  +N A GGFI A+IL
Sbjct: 121  CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIIL 180

Query: 595  IGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSL 774
            IGI TG IK+N+SVLIADQ P +R RV T K G RVIED +IT+QNVFM FYLMINIGSL
Sbjct: 181  IGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240

Query: 775  SVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALT 954
            SVIATTELE HVGFWAAYLLPFCFFWIAVIVL +G+ SY   P  D+VI K FK      
Sbjct: 241  SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300

Query: 955  KNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMG 1134
            KNKFN+ A  P+ +P+  F W DKFV+EI  +L+ACKVFLFYP+YW CYGQM N FV++G
Sbjct: 301  KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360

Query: 1135 SMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMV 1314
              ++LHGLPND FQAIDSIALIVFIPICE F YP+IR+FTPFRPITKI +GF   +A+MV
Sbjct: 361  GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420

Query: 1315 WACVLQYFIYKTGPNYKHPLADG-PNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAP 1491
            WA VLQ+FIYK+GP YK+P+A+  PN++H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP
Sbjct: 421  WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480

Query: 1492 ASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYN 1671
             +MKSFIMA+FL  NAFGSAIGCALSPV+KDPDY WLY GL V  F  G  FWFCF+HYN
Sbjct: 481  VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540

Query: 1672 DIEDEMNALNYEDEDIITENNQD 1740
            D E+ MNAL+Y+++  + ++++D
Sbjct: 541  DTEEAMNALDYDEDPTMLKHSKD 563

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
            complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  761 bits (1966), Expect = 0.0
 Identities = 372/606 (61%), Positives = 457/606 (75%), Gaps = 11/606 (1%)
 Frame = +1

Query: 4    SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 183
            +SH +S++  ++ +++          T++ + DQ+   E  K+ +D   D E+ D Q+  
Sbjct: 19   ASHIDSKQDHEVKIVSK------FDSTSLQNSDQL---EITKVGDD---DIEYDDNQD-- 64

Query: 184  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 363
            +  PTEEE++TL+HVSG+IP RC+LIAVVELSERFSYYGL+APFQNYMAN P+D+P GVL
Sbjct: 65   FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124

Query: 364  QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 543
             L++ GA+ LSYFFQFWCYITP+ GGY+ADT WG+YNTI  GTGIY+VGIF+LFITS  S
Sbjct: 125  MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184

Query: 544  IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 723
            I  +  ALGG++ A+ILIGI TG IKAN+SVLIA+QIP  +PRV T K G+RVIED +IT
Sbjct: 185  IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244

Query: 724  IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 903
             QNVFMFFY+MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+VLV+GR  Y + P
Sbjct: 245  TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304

Query: 904  TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 1083
              D++I KSFK  W L KNK N+ A  P+ NPE  + W+DKFVEEIR AL ACKVF+FYP
Sbjct: 305  VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364

Query: 1084 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 1263
            IYW  YGQM NNFVT    ++LH LPND  QA DSIA+IVFIPI E+F YPF+RRFTPFR
Sbjct: 365  IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424

Query: 1264 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYV 1425
            PITKI +GF   S +M+WA VLQ FIYK GP Y  P+      A+ PN VHVAWQVPAYV
Sbjct: 425  PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484

Query: 1426 LIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY 1605
            LIA SEI AS+TGLEYAYS APASMKSFIM++FL  NAFGSAIG A+SP ++DP YTW +
Sbjct: 485  LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544

Query: 1606 CGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDED-----IITENNQDIEMVHPLSAY 1770
             GLAV  FI GC FW CFR YN+ ED MN +++ D+D             IE++ P++++
Sbjct: 545  TGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTSIEVMEPITSF 604

Query: 1771 TSPKSL 1788
             S KSL
Sbjct: 605  RSIKSL 610

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  760 bits (1963), Expect = 0.0
 Identities = 366/593 (61%), Positives = 449/593 (75%), Gaps = 6/593 (1%)
 Frame = +1

Query: 1    MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 180
            + +H+NS+ +  LS   D K+ I++    VS+E+QI         + +  D E  + ++E
Sbjct: 6    LETHSNSDLS--LSSQLDNKDKIEVH--VVSTENQI---------DVHSLDDEDYEEEDE 52

Query: 181  GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 360
             Y  PTEEEL+TLRHVSG IP RC+LIA+VEL+ERFSYYGLSAPFQNYMAN P+D+P G+
Sbjct: 53   DYVAPTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGL 112

Query: 361  LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 540
            LQLNS GAT +SYFFQFWCY+TP+ GGY+ADT+WG+YNTI  GTGIY+ GIF+LF+TS +
Sbjct: 113  LQLNSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIE 172

Query: 541  SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 720
            SI  +N A GG+I A+ILIGI TG IK+N+SVLIA+Q+P ++ RV T   GERVIED  +
Sbjct: 173  SITTQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKL 232

Query: 721  TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 900
            T+QN+FMFFYLMINIGSLSVIATTELE H GFWAAYLLPFCFFWIAV+VL++G++ Y  K
Sbjct: 233  TVQNIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRK 292

Query: 901  PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 1080
            P  D+VI K F   W   KNK ++ +  P+ +PE  + W DKFVEE+R A+ ACKVFLFY
Sbjct: 293  PVGDKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFY 352

Query: 1081 PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 1260
            PIYW  YGQM NNFVT    ++LHGLPND  QAIDSIA+IVFIPICEKF YPFIR+FTPF
Sbjct: 353  PIYWCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPF 412

Query: 1261 RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAY 1422
            R ITKI +GF   SA+M+WA VLQ FIYK GP +  PL      A  PN VH+AWQVPAY
Sbjct: 413  RSITKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAY 472

Query: 1423 VLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWL 1602
            VLIAFSEIFASITGLEYAYS AP SMKSFIM++FL   AFGSA+G A+SP S DP +TW 
Sbjct: 473  VLIAFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWA 532

Query: 1603 YCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPL 1761
            + GLAV+ FI GC FW CFR YN+ ED M+ +++ DE +    N+    + P+
Sbjct: 533  FTGLAVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDMANKASSFISPV 585

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
            similar to uniprot|P32901 Saccharomyces cerevisiae
            YKR093w PTR2
          Length = 597

 Score =  759 bits (1959), Expect = 0.0
 Identities = 367/580 (63%), Positives = 440/580 (75%), Gaps = 9/580 (1%)
 Frame = +1

Query: 34   KLSVITDEKNNIDLKKTTVSSED-------QILDTESYKLQND-NEFDPEHPDYQEEGYE 189
            + S   DEKN ++++K   S +D       +I D E + L  D +  +      +++ +E
Sbjct: 4    RFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFE 63

Query: 190  MPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQL 369
             PTEEEL+TLRHV+G IP RC+LIA+VELSERFSYYGLSAPFQNYM N P+D+P G+L L
Sbjct: 64   APTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGL 123

Query: 370  NSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIA 549
             S GATGLSYFFQFWCY+TPV GG+++DT WG+YNTI VGT IY+ GIF+LFITS   + 
Sbjct: 124  KSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT 183

Query: 550  GKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQ 729
              +GALGGFI A+ILIGI TG IK+NLSVLIADQ+P K+PRV   K GERVIED ++T+Q
Sbjct: 184  NSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQ 243

Query: 730  NVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTS 909
            NVFMFFY  IN+GSLSV+ATTELE H GFWAAYLLPFCFFW+AV VLV GR  Y   P  
Sbjct: 244  NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVG 303

Query: 910  DRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIY 1089
            D+VI KSFK  + L+KNKFN  A  P+ NP+  F W DKFV+EI+ AL ACKVF+FYP+Y
Sbjct: 304  DKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVY 363

Query: 1090 WTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPI 1269
            W CYG M NNFVT G  ++LH LPND  QA DSIALI+FIPI E+F YPFIRR+TP RPI
Sbjct: 364  WVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPI 423

Query: 1270 TKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEI 1446
            TKI +GF + S +MVWA VLQ+FIY  GP Y HPL  D PN++HVAWQ+PAYVLIA SEI
Sbjct: 424  TKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEI 483

Query: 1447 FASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTA 1626
            FASITGLEYAYSKAP SMKSFIM++FL  NAFGSAIGCALSPVS DP + W Y GLA   
Sbjct: 484  FASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACAC 543

Query: 1627 FITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIE 1746
            FI G  FWF +   ND E+ MNAL+YE ++ + +++ D E
Sbjct: 544  FIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDE 583

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  759 bits (1961), Expect = 0.0
 Identities = 364/598 (60%), Positives = 454/598 (75%), Gaps = 15/598 (2%)
 Frame = +1

Query: 40   SVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE-GYEMPTEEELRT 216
            ++ + EK        T + +D++ +  + +  ++   D E   Y +E GY  PTEEE+ T
Sbjct: 24   AIYSGEKELDSSHDVTFNIDDKVENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMAT 83

Query: 217  LRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLS 396
            L+HV+G IP+RC+LIAVVELSERFSYYGLSAPFQNYMAN P+D+P G+LQLN++GATGLS
Sbjct: 84   LKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLS 143

Query: 397  YFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGF 576
            YFFQFWCYITP+ GGY+ADT W +YNTIAVGT IYI+GIF+LFIT+  SIA K  A GGF
Sbjct: 144  YFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGF 203

Query: 577  IVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLM 756
            + A+ILIGIGTG IKANLSVL+A+QIP ++ RV T K GERVIED DIT+QNVFMFFYLM
Sbjct: 204  VTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLM 263

Query: 757  INIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFK 936
            INIG+LSV+ATTELE H GFWAAYLLPFCFFWIAV++LV+GR SY +KP  D+VI K FK
Sbjct: 264  INIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFK 323

Query: 937  FCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTN 1116
              + + KNKFN+ +  P+ NPE+ + W DKFV+EI  ++ ACKVF+FYPIYW  YGQM N
Sbjct: 324  VTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMIN 383

Query: 1117 NFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWL 1296
            NF+T    ++LH +PND  Q  DSI +IVFIPI E+F YP IRRFTP +PITKI  GF  
Sbjct: 384  NFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMC 443

Query: 1297 ASASMVWACVLQYFIYKTGPNYKHPLADG------PNNVHVAWQVPAYVLIAFSEIFASI 1458
             S +MVWA VLQ FIYK GP Y HP+A G      PN VHVAWQ+PAYV+IA+SEIFAS+
Sbjct: 444  GSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASV 503

Query: 1459 TGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITG 1638
            TGLE+AYS AP SMK+FIM++FLF NA G+A+G A+SP S DP YTW++ GLAV+ F+ G
Sbjct: 504  TGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAG 563

Query: 1639 CAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIE--------MVHPLSAYTSPKSL 1788
            C FW CF HYNDI+ +M A+++ ++D+I  +  D+E         V P+ +  S KSL
Sbjct: 564  CLFWICFHHYNDIDADMKAIDFVEDDMINASG-DVEKTASSGFSTVEPIISMRSAKSL 620

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
            to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
            Functions in transport of small peptides into the cell
            Peptide transporter
          Length = 592

 Score =  757 bits (1954), Expect = 0.0
 Identities = 360/573 (62%), Positives = 446/573 (77%), Gaps = 7/573 (1%)
 Frame = +1

Query: 91   SSEDQILDTESY-KLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAV 267
            +S ++I   ES+  + + N++     D+  E    PT+EE++TLRHVS +IP RC+L+AV
Sbjct: 23   NSVEKIARPESFVDVLDKNQYINADSDHGRE----PTDEEMKTLRHVSEQIPVRCWLVAV 78

Query: 268  VELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYL 447
            VEL+ERFSYYGLSAPFQNYM N P+D+P G+L L + GAT LSYFFQFWCY++P+LGG++
Sbjct: 79   VELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFV 138

Query: 448  ADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKAN 627
            ADT WG+Y TI VGTGIY+VGIF+LFITS  SI   + +LGGFI +LILIG+ TG IKAN
Sbjct: 139  ADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKAN 198

Query: 628  LSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQH 807
            +SVLIADQIP  RP VK LKSGERVIED +IT+QN+FMFFYLMINIGSLSVIATTE+E H
Sbjct: 199  ISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAH 258

Query: 808  VGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTP 987
            +GFWAAYLLPFCFF++AV VL+LGR  Y   P  D+VI KSFK CW + +NKF + A  P
Sbjct: 259  IGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARP 318

Query: 988  AENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 1167
            + NPE+ + W DKF++EI+ A+AACKVF+FYPIYW CYGQM +NFV+   M++LHGLPND
Sbjct: 319  SLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPND 378

Query: 1168 IFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYK 1347
              QAIDSIALIVFIPICE+F YPFIRRFTPFRPITKI YGF   + +M WA VLQ+FIYK
Sbjct: 379  FLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYK 438

Query: 1348 TGPNYKHPLA------DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSF 1509
             GP Y +P+A      + PN +H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP SM+SF
Sbjct: 439  AGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSF 498

Query: 1510 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 1689
            IM++FL   AFGSA+G ALS VS +P + W + GLAV+ FI GC FW  F  YND E+ M
Sbjct: 499  IMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAM 558

Query: 1690 NALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 1788
            NA++YE++D++         + P+++  S K +
Sbjct: 559  NAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRI 591

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  748 bits (1931), Expect = 0.0
 Identities = 365/558 (65%), Positives = 432/558 (77%), Gaps = 4/558 (0%)
 Frame = +1

Query: 55   EKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEM-PTEEELRTLRHVS 231
            EKN+I       +S    ++ +   L ND+++D       ++G ++ PTEEEL+TL   +
Sbjct: 28   EKNHIKFDSIENTSTTSTINKQ---LTNDSDYDD-----MDDGDDIEPTEEELKTLPREA 79

Query: 232  GRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQF 411
            G IPF C+L+A++EL+ERFSYYGLSAPFQNYM N PSD+PPG L LNS GATGLSYFFQF
Sbjct: 80   GHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATGLSYFFQF 139

Query: 412  WCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALI 591
            WCY+TP+  G++ADT WG++NT+ +GT IYI+GIF+LFITS  +I   N ALGGFIVA+I
Sbjct: 140  WCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALGGFIVAII 199

Query: 592  LIGIGTGFIKANLSVLIADQIPAKRPRVKTLK-SGERVIEDHDITIQNVFMFFYLMINIG 768
            LIGI TG IKANLSV+IADQ+P K+ RV T K SG+RVIED  +TIQNVFM FY MIN+G
Sbjct: 200  LIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYFMINVG 259

Query: 769  SLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWA 948
            SLSVIATTELE HVGFWAAYLLPFCFFWIAV+VL  G R +  KP  DRVI K F     
Sbjct: 260  SLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCFTIIGI 319

Query: 949  LTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVT 1128
            L KN FN+    P  NPE  + W DKFV+EI+ +L ACKVFLFYPIYW CYGQM NNFVT
Sbjct: 320  LIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQMLNNFVT 379

Query: 1129 MGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASAS 1308
             GS +QLHGLPND FQAI+SIALIVFIPI EKF YPFIR+FTP +PITK+T GF   S +
Sbjct: 380  QGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFVFGSLA 439

Query: 1309 MVWACVLQYFIYKTGPNYKHPL--ADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYS 1482
            MVWA VLQ+FIY+ GP Y HP+   +GPN+VHVAWQVPAY LI+ SEIFASITGLE AYS
Sbjct: 440  MVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGLEIAYS 499

Query: 1483 KAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFR 1662
            KAP SMKSFIM++FL  NAFG+AIGCALS VS+DP Y WLY GLAVT F  G AFWF F+
Sbjct: 500  KAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAFWFTFK 559

Query: 1663 HYNDIEDEMNALNYEDED 1716
            HYND ED MN +++E ++
Sbjct: 560  HYNDEEDAMNNIDFESDN 577

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  732 bits (1890), Expect = 0.0
 Identities = 355/583 (60%), Positives = 432/583 (74%), Gaps = 5/583 (0%)
 Frame = +1

Query: 13   TNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEM 192
            T S+E     +++D K++ +    T    + I  T      N+  ++    D  +E +  
Sbjct: 11   TYSQEYNNNILMSDNKDDKNYNFITEDEPNSIASTIIEGNSNEENYNRSTDDDDDEDFIE 70

Query: 193  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLN 372
            PTEEE+RTL+ V G IP RC+L+AV+ELSERFSYYGLSAPFQNYM N P D+PPG L LN
Sbjct: 71   PTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLN 130

Query: 373  SDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAG 552
            + GATGLSYFFQFWCYITP+ GGY+ADT WG+YNTI VG   YI GIF+LF+TS   +  
Sbjct: 131  TQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTS 190

Query: 553  KNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQN 732
             + A+GGFIV++I+IG+GTG IKANLSV+IA+Q+P ++ R+ T K G RVIED DIT+QN
Sbjct: 191  YSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQN 250

Query: 733  VFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSD 912
            VFM FY MIN+GSLSV+ATTELE   GFWAAYLLPFCFFW+AV+VL++G + +   P  D
Sbjct: 251  VFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGD 310

Query: 913  RVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYW 1092
            + I KSFK    L KNKFN+ +  P+ +PE  + W DKFVEEIR A+ AC VF FYPIYW
Sbjct: 311  KTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYW 370

Query: 1093 TCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPIT 1272
             CYGQM NNFVT G  ++LH LPND  Q IDSIALIVFIPICE+  YPF+RRFTP RPIT
Sbjct: 371  VCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPIT 430

Query: 1273 KITYGFWLASASMVWACVLQYFIYKTGPNYKHP--LADGPNNVHVAWQVPAYVLIAFSEI 1446
            KIT GF+  S SMVWA VLQ+F+Y+  P Y HP    +GPN++HV WQVPAY LIA SEI
Sbjct: 431  KITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEI 490

Query: 1447 FASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTA 1626
            FASITGLEYAYSKAPASMKSFIM++FLF  A GSA+G ALSPVS DP +TW Y GLAV+ 
Sbjct: 491  FASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSC 550

Query: 1627 FITGCAFWFCFRHYNDIEDEMNALNYEDE--DIITEN-NQDIE 1746
            FI G AFW CF  YND EDE+N ++ + +   I +EN N D+E
Sbjct: 551  FIAGIAFWLCFSRYNDEEDELNNIDDQPDVIQISSENENDDLE 593

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa] {ON}
            similar to uniprot|P32901 Saccharomyces cerevisiae
            YKR093W PTR2 Functions in transport of small peptides
            into the cell Peptide transporter
          Length = 654

 Score =  734 bits (1894), Expect = 0.0
 Identities = 358/559 (64%), Positives = 423/559 (75%), Gaps = 6/559 (1%)
 Frame = +1

Query: 58   KNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGR 237
            KNN D+K     S+D      S K+      D +  D Q E    PTEEEL TLRHVS R
Sbjct: 58   KNNTDIK--VYISKDH--HASSDKIDFIGAVDED--DNQNENGREPTEEELSTLRHVSER 111

Query: 238  IPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWC 417
            IPF C+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVLQL S GAT LSYFFQFWC
Sbjct: 112  IPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWC 171

Query: 418  YITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILI 597
            Y+TP+LGGYLADT WG+YNTI VG   Y+VGI +LF+T+  SI  KN +LGGFIV+LI+I
Sbjct: 172  YVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIII 231

Query: 598  GIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLS 777
            GIGTGFIKANLSVLIADQIP  RPR+K LK+GE+VIED ++T+QNVFMFFYLMINIGSLS
Sbjct: 232  GIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLS 291

Query: 778  VIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTK 957
            V+ATT LE   GFWAAYLL FCFFW+ ++VLV GR+ Y  +P  D VI + FK CW    
Sbjct: 292  VMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLC 351

Query: 958  NKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGS 1137
            N FN +   P+ NPE  + W+D F++EIR A  ACKVF FYPIYW  YGQM NNFVT   
Sbjct: 352  NGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAG 411

Query: 1138 MLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVW 1317
             ++LHGLPND  QAI+SIALIVFIPI E+F YPFIRRFTPFRP+TKI  GF   S++MV+
Sbjct: 412  TMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVY 471

Query: 1318 ACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAY 1479
            A VLQ+FIYK GP Y  P+      A+ PN VH+ WQVPAYVLI+ SEIFASITGLEYAY
Sbjct: 472  AAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAY 531

Query: 1480 SKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCF 1659
            SKAPA+MK+FIM++FL  NA GSA+G ALSP +++P Y W + GLAV  FI GC FW CF
Sbjct: 532  SKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCF 591

Query: 1660 RHYNDIEDEMNALNYEDED 1716
             HYN  E+ +NAL+Y+ E+
Sbjct: 592  HHYNKDEEALNALDYKTEE 610

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
            (REAL)
          Length = 399

 Score =  553 bits (1425), Expect = 0.0
 Identities = 260/394 (65%), Positives = 315/394 (79%), Gaps = 7/394 (1%)
 Frame = +1

Query: 616  IKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTE 795
            IKANLSVLIADQ+P ++P +K LKSGERV+ D +IT+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 2    IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61

Query: 796  LEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWS 975
            LE H GFWAAYLLPFCFFWIAV+ L+LG++ Y  +P  D+VI KSF+ CW L KNKF+++
Sbjct: 62   LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121

Query: 976  AVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHG 1155
            A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYPIYWT YG M ++F+T  SM++LHG
Sbjct: 122  AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181

Query: 1156 LPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQY 1335
            +PND  QA DSIALI+FIPI EKF YPFIRR+TPF+PITKI +GF   S +M WA VLQ 
Sbjct: 182  IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241

Query: 1336 FIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFI 1512
            FIYK GP Y  PL  + PN VHV WQ+PAYVLI+FSEIFASITGLEYAYSKAPASMKSFI
Sbjct: 242  FIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 301

Query: 1513 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMN 1692
            M++FL   AFGSAIGCALSPV+ DP +TWL+ GLAV  FI+GC FWFCFR YND E+EMN
Sbjct: 302  MSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMN 361

Query: 1693 ALNYEDED------IITENNQDIEMVHPLSAYTS 1776
            A++YE+ED      I      DIE++ P+ +  S
Sbjct: 362  AMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 395

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
            (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  258 bits (658), Expect = 4e-77
 Identities = 174/547 (31%), Positives = 265/547 (48%), Gaps = 38/547 (6%)
 Frame = +1

Query: 145  EFDPEHPDYQE---EGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPF 315
            E D    D+ E   + +  PTE E   LR V G   +  + I ++E SER SYYG     
Sbjct: 13   EIDGHSEDFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGTGDRL 72

Query: 316  QNYM----------ANTP---SDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADT 456
             N++          A  P   S++  G L +    AT L+    F  Y  P++ GY+AD 
Sbjct: 73   NNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGYVADR 132

Query: 457  NWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGK-NGALGGFIVALILIGIGTGFIKANLS 633
             WGR   + +G  + IV   V  I S   + G  + AL   I+ +I + I T F+K  L 
Sbjct: 133  YWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVKPILL 192

Query: 634  VLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVG 813
              +  Q P     VKTL SGERVI D D ++Q + M FY  IN+GS   +AT+   + VG
Sbjct: 193  PTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVG 252

Query: 814  FWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVI----EKSFKFC-----WALTKNKF 966
            +W A+L+P   F I   VL++ RR    +P S R +     K  K C     W+  +   
Sbjct: 253  YWLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGT 312

Query: 967  NWSAVTPAE---------NPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNN 1119
             W    P+                 + +  V++ RV ++AC +FL+Y IY    G + + 
Sbjct: 313  FWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVTISACTIFLYYVIYNINDGGIGSI 372

Query: 1120 FVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFT-PFRPITKITYGFWL 1296
              +  + L   G+PND+    + + +IVF+PI ++  YP +R+    FRP+ +I  GF +
Sbjct: 373  MNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMV 432

Query: 1297 ASASMVWACVLQYFIYKTGP--NYKHPLADGPNNVHVAWQVPAYVLIAFSEIFASITGLE 1470
            A+ +     ++Q+ IY+T P  NY      G + + +      Y L  FSE  A  TG E
Sbjct: 433  AALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYALTGFSECLAMTTGYE 492

Query: 1471 YAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFW 1650
             A+ ++P  MK+F+MALFLFM+A  +A+G  ++P   DP     +  LA        AF 
Sbjct: 493  IAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVLA--GLGAAVAFA 550

Query: 1651 FCFRHYN 1671
            F +R++N
Sbjct: 551  FLWRYWN 557

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
            Ashbya gossypii AGL365C
          Length = 613

 Score =  238 bits (606), Expect = 1e-69
 Identities = 173/560 (30%), Positives = 267/560 (47%), Gaps = 40/560 (7%)
 Frame = +1

Query: 190  MPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANT----------- 336
            +PTEEE RTLR +     +  +LI  +EL+ER SYYG      NY               
Sbjct: 43   LPTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGAT 102

Query: 337  --PSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVG--TGIYI 504
               S++  G L      AT L    +F  Y  P++ GYL D   G   T+  G  TG   
Sbjct: 103  AHGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTG--- 159

Query: 505  VGIFVLFITSFKSIAGKN--GALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVK 678
            V   ++FI S   +  K+   A+   ++ LI + + T F+K  L  L+  Q P +   VK
Sbjct: 160  VASHIIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVK 219

Query: 679  TLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIA 858
            TL++GERVI D D ++Q + M FY  INIG+   +AT+   + VGFW A+L+P   +   
Sbjct: 220  TLETGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAM 279

Query: 859  VIVLVL--------GRRSYTLKPTSDRVIEKSFKFCW-ALTKNKFNWSAVTPAENPEV-T 1008
             +V  L            Y+L     +V+  +F   W A  K    W    P+   ++  
Sbjct: 280  PVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGK 339

Query: 1009 FSWDDK-------FVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 1167
              W  K        V++ ++ L+AC +F +Y IY     Q+T    +    +  +G+PND
Sbjct: 340  VGWRKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPND 399

Query: 1168 IFQAIDSIALIVFIPICEKFFYPFIRRF-TPFRPITKITYGFWLASASMVWACVLQYFIY 1344
            +    + +++IV IPI +   YP +RR    F+P+ +I  GF LA AS V   ++Q+ IY
Sbjct: 400  VISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIY 459

Query: 1345 KTGPNYKHPLADGPNNVHV----AWQVPA-YVLIAFSEIFASITGLEYAYSKAPASMKSF 1509
            +T     H        + V    +W V   Y L   SE  A  T  E AY ++P  MKSF
Sbjct: 460  ETSSCGYHATTCSEKGLGVSPLSSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSF 519

Query: 1510 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 1689
            ++ALFLF +A  +AI   ++P+ KDP     +   A   FI+GC F + FR+     D+ 
Sbjct: 520  VLALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFRNL----DKE 575

Query: 1690 NALNYEDEDIITENNQDIEM 1749
                  + +++ E+++  E+
Sbjct: 576  MLQEKRERELLQESSESDEL 595

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa] {ON}
            similar to uniprot|P32901 Saccharomyces cerevisiae
            YKR093W PTR2 Functions in transport of small peptides
            into the cell Peptide transporter
          Length = 626

 Score =  231 bits (590), Expect = 4e-67
 Identities = 158/533 (29%), Positives = 258/533 (48%), Gaps = 40/533 (7%)
 Frame = +1

Query: 193  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYM----------ANTPS 342
            PTE E  TLR V     +  + I ++E SER SYYG      N++          A  P+
Sbjct: 37   PTEHERTTLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPA 96

Query: 343  ------DSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYI 504
                   +  G L +    AT L+    F  Y  P++ GY+AD  W R   + +G  + I
Sbjct: 97   HGAAGDSATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGI 156

Query: 505  VGIFVLFITSFKSIAGKN-GALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKT 681
            +   +  I +   + G    AL   ++ +I + I T F+K  L   +  Q P +   V+T
Sbjct: 157  ISHVIFIIGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRT 216

Query: 682  LKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWI-A 858
            L SGERV+ D D ++Q + M FY  INIGS   +AT+   + +G+W A+L+P   + I  
Sbjct: 217  LASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMP 276

Query: 859  VIVLVLGRRSYTLKPTSDRVIE---KSFKFC-----WALTKNKFNWSAVTPAENPEVTFS 1014
             ++LVLGR      P+   ++    K  + C     W   ++   W+   P+   +   +
Sbjct: 277  AVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRA 336

Query: 1015 ----------WDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPN 1164
                      + +  V++ RV L+A  +FL+Y IY    G + +   +  + L  +G+PN
Sbjct: 337  GWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPN 396

Query: 1165 DIFQAIDSIALIVFIPICEKFFYPFIRRFT-PFRPITKITYGFWLASASMVWACVLQYFI 1341
            D+    + + +IVF+P+ +   YP +R+    F+P+ +I  GF +A+ +     ++Q  I
Sbjct: 397  DLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVI 456

Query: 1342 YKTGP--NYKHPLADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFIM 1515
            Y T P   Y      G + V +      Y L   SE  A  TG E A+ ++PA MKSF+M
Sbjct: 457  YNTSPCGRYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVM 516

Query: 1516 ALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLA-VTAFITGCAFWFCFRHYN 1671
            ALFLF +A  +A+G  ++P   DP     +  LA + AF+   AF F +R+++
Sbjct: 517  ALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFM---AFVFLWRYWS 566

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
            homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  220 bits (561), Expect = 2e-63
 Identities = 158/564 (28%), Positives = 259/564 (45%), Gaps = 38/564 (6%)
 Frame = +1

Query: 112  DTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFS 291
            + E+ K+    + + E    + E  ++PTE E  TLR +        + I ++E +ER S
Sbjct: 4    EKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGS 63

Query: 292  YYGLSAPFQNYM------------ANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVL 435
            +YG      N+             A  P +  PG L      AT +    +F  Y   ++
Sbjct: 64   FYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSII 123

Query: 436  GGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSI-AGKNGALGGFIVALILIGIGTG 612
             GY++D   G+   + +G  + +    +  I +  S+ A  N A    +VAL+ + + T 
Sbjct: 124  TGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCTS 183

Query: 613  FIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATT 792
            F+K  L  L+  Q P K   VKTL SGERVI D D ++Q + M FY  IN+G+   +AT 
Sbjct: 184  FVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLATA 243

Query: 793  ELEQHVGFWAAYLLPFCFFWIAVIVL-VLGRRSYTLKPTSDRVIEKSFK-----FCWALT 954
               Q VG+W A+ +P   + +  IVL  L     T +P+ + V+ +S K     + W   
Sbjct: 244  YSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWI 303

Query: 955  KNKFN---WSAVTPAE---------NPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTC 1098
            K  ++   W    P             +    +D+K+V + ++ ++AC +FL+Y IY   
Sbjct: 304  KRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-QM 362

Query: 1099 YGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRF-TPFRPITK 1275
            +  +     +    ++  G+PND+F   + I++IV +PI +   YP +RR+   F+P+ +
Sbjct: 363  HSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYR 422

Query: 1276 ITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVH-----VAWQVP-AYVLIAF 1437
            I  GF +         ++Q+ +Y T P         P   H       W V   Y L   
Sbjct: 423  IFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVAIEYALGGT 482

Query: 1438 SEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLA 1617
            SE  A  TG E A+ ++P  MK F++ALF+F  A  SAI   ++P  KDP   +L    A
Sbjct: 483  SECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDP---YLIQPFA 539

Query: 1618 VTAFITGCAFWFCFRHYNDIEDEM 1689
            V A +           Y D++ +M
Sbjct: 540  VCAGVGALTAIIFLWRYWDLDKQM 563

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
            NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  219 bits (559), Expect = 6e-63
 Identities = 160/545 (29%), Positives = 253/545 (46%), Gaps = 35/545 (6%)
 Frame = +1

Query: 142  NEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQN 321
            NE       Y EE  E PTEEE + LRHV     +  ++I ++EL+ER SYYG      N
Sbjct: 22   NEIVTVCTQYPEELLE-PTEEEEKRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYN 80

Query: 322  YMANT-----------PSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGR 468
            +               P D  PG L      AT L+   +F  Y  P++ GY+AD   G 
Sbjct: 81   FFQYPLPQGGNGAGAGPDDQNPGALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGE 140

Query: 469  YNTIAVGTGIYIVGIFVLFITSFKSIAGKNG-ALGGFIVALILIGIGTGFIKANLSVLIA 645
               + +G    +V   +  I +  ++   N   +   ++ L+ + + T F+K  L  ++ 
Sbjct: 141  LKMLWLGIWTGVVSHVIFVIAALPAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLL 200

Query: 646  DQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAA 825
             Q P +   VKTL +GERVI + D ++Q + M FY  IN+GS   +AT    Q VG+W +
Sbjct: 201  RQYPHETNVVKTLPTGERVILNRDASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLS 260

Query: 826  YLLPFCFFWIAVIVLVLGRRSYTLKPTSD-------RVIEKSFKFCW-ALTKNKFNWSAV 981
            +L+P   F I   +L+  +      P  +       +VI+  F+  W    ++   W   
Sbjct: 261  FLIPLVLFLIMPAILLTLKNVKVTPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYA 320

Query: 982  TPAENPEVTFS---------WDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMG 1134
             P+    +  +         + +  VE+ R+ LAAC +FL+Y IY     Q+++      
Sbjct: 321  KPSNLRALGRTGWRRSKEGFYKESLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQA 380

Query: 1135 SMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRF-TPFRPITKITYGFWLASASM 1311
              +   G+PND+    + +A+I+ +PI +    P +RR    F+P+ +I +GF LA  + 
Sbjct: 381  GSMTGEGVPNDVISNFNPLAIIITMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLAS 440

Query: 1312 VWACVLQYFIYKTGPNYKHPLADGPNNVHVA----WQVPA-YVLIAFSEIFASITGLEYA 1476
            V   ++Q  IY T P  KH          V+    W V   YVL   SE FA  TG E A
Sbjct: 441  VAGAIIQAAIYNTSPCGKHASTCSETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIA 500

Query: 1477 YSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFC 1656
            + ++P  MK+F+M+LFL   A  S +    + +  DP     +   AV    T  A  F 
Sbjct: 501  FERSPKDMKAFVMSLFLVTTALSSILTQIFNGIMTDPYLVIPFILFAVLG--TLFAILFL 558

Query: 1657 FRHYN 1671
            +R++N
Sbjct: 559  YRYWN 563

>NDAI0C04100 Chr3 (933968..935650) [1683 bp, 560 aa] {ON} Anc_5.316
           YDR299W
          Length = 560

 Score = 38.1 bits (87), Expect = 0.070
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = +1

Query: 16  NSEEA--EKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYE 189
           N+EE   ++LS   DE+N+ D       SED+I+D       NDN  D E  + +EE   
Sbjct: 101 NNEEPSRDELSEQDDEENSSDALSFKTDSEDEIMDV------NDNGNDSESSNNEEEEER 154

Query: 190 MPTEEELRTLR 222
              +EEL+ LR
Sbjct: 155 EDNDEELQRLR 165

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 36.2 bits (82), Expect = 0.26
 Identities = 50/207 (24%), Positives = 74/207 (35%), Gaps = 4/207 (1%)
 Frame = +1

Query: 364 QLNSDGATGLSYFFQFW---CYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITS 534
           QL S GA  +S+ F      C++  V  G   D N G+   I VG+ +Y+ GIF++    
Sbjct: 110 QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFGIFMM---- 164

Query: 535 FKSIAGKNGALGGFIVALIL-IGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIED 711
                 +   L  FI+A  L  G+G G +   L   +A     +R    +L +    I  
Sbjct: 165 -----SECTKLWHFILAFSLSSGVGAGILTTPLISCVATWFHRRRAVATSLATCGGSI-- 217

Query: 712 HDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSY 891
             I I  +    Y+ I                   WA  +L   F         L R   
Sbjct: 218 GGIVIPLILRRMYVTIGYK----------------WALKVLALVFLVSLTFAAFLARERV 261

Query: 892 TLKPTSDRVIEKSFKFCWALTKNKFNW 972
           T +P   R    + +F        FNW
Sbjct: 262 TPRPKPFRSHRDTIRF---YLSTSFNW 285

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 36.2 bits (82), Expect = 0.28
 Identities = 29/119 (24%), Positives = 48/119 (40%)
 Frame = +1

Query: 265 VVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGY 444
           ++ L + F+YY  +      +      S           AT +  F+ F   +T    G+
Sbjct: 361 IINLFQEFAYYMQNTYMLTVLLVAVGQS--------KKSATRIIKFYSFVGVLTAFFLGF 412

Query: 445 LADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIK 621
           +          IA+G GI+ V   +L     +   G  GA  G I A+ ++G G GF+K
Sbjct: 413 VVAKVRRTKEFIALGIGIWFVAFGLL-----EHYEGGLGARAGIIAAICILGFGNGFLK 466

>TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON} 
          Length = 493

 Score = 35.8 bits (81), Expect = 0.35
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 18/131 (13%)
 Frame = +1

Query: 307 APFQNYMANTPSDSPPGVL-------QLNSDGATGLSYFFQ---FWCYITPVLGGYLADT 456
           A F   +A+  +   PGV+       QLN   +  + + F    F C+IT +LGG L D 
Sbjct: 85  ASFIGMVASYGTMYAPGVIENYIKENQLNDTSSFEIGWIFSLYIFICFITFILGGTLFD- 143

Query: 457 NWGRYNTIAVGTGIYIVGIFVL--------FITSFKSIAGKNGALGGFIVALILIGIGTG 612
           N+G    I +GT I++  +F L        FI  +  +    G  G  I+   LI I + 
Sbjct: 144 NFGFKKPILIGTIIHVGSLFSLANCRELWQFILGYSIL----GGFGNGILIPCLISIPSQ 199

Query: 613 FIKANLSVLIA 645
           +     ++ I+
Sbjct: 200 YFNRKRALAIS 210

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 32/113 (28%), Positives = 47/113 (41%)
 Frame = +1

Query: 319 NYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGI 498
           +Y+    S  P G   ++      L   F   C I  V  G L D+  GR   I VG  I
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 499 YIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIP 657
           YIVGI +   +  K           + +  I+ G+G+G I     +LI++  P
Sbjct: 147 YIVGIVIQIASIDKWFQ--------YFIGRIIGGLGSGAIAVLSPMLISEVSP 191

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 35.4 bits (80), Expect = 0.48
 Identities = 29/101 (28%), Positives = 44/101 (43%)
 Frame = +1

Query: 355 GVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITS 534
           GVL L++     L   F   C I  V  G L D  +GR   +  GT I++VG+ +   + 
Sbjct: 114 GVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDL-YGRRWGLIFGTSIFVVGVIIQIASV 172

Query: 535 FKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIP 657
            K           + +  I+ GIG G I     +LI++  P
Sbjct: 173 SKWFQ--------YFIGRIIAGIGMGVIAVLSPMLISEVAP 205

>AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YHR096C (HXT5) and YDR342C (HXT7)
          Length = 535

 Score = 35.0 bits (79), Expect = 0.62
 Identities = 27/113 (23%), Positives = 48/113 (42%)
 Frame = +1

Query: 319 NYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGI 498
           +++A     SP G  +L+ D    +   F   C +  +    + D  +GR   +A  T +
Sbjct: 76  DFIARFGQLSPSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIGDA-YGRKIGLATVTAV 134

Query: 499 YIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIP 657
           Y++GI +    S K           + V  I+ G+G G I     +LI++  P
Sbjct: 135 YVIGIVIQISASDKWYQ--------YFVGRIISGLGVGGIAVLSPMLISETSP 179

>SAKL0A05676g Chr1 (515333..517174) [1842 bp, 613 aa] {ON} similar to
            uniprot|P53048 Saccharomyces cerevisiae YGR289C MAL11
            Maltose permease inducible high-affinity maltose
            transporter (alpha-glucoside transporter) encoded in the
            MAL1 complex locus member of the 12 transmembrane domain
            superfamily of sugar transporters
          Length = 613

 Score = 35.0 bits (79), Expect = 0.64
 Identities = 37/196 (18%), Positives = 81/196 (41%), Gaps = 2/196 (1%)
 Frame = +1

Query: 460  WGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILI-GIGTGFIKANLSV 636
            +GR+     G G+  + +FV+    F      + A+G  ++  + +  +G G     ++ 
Sbjct: 418  YGRFTIFTTGLGLQTLLLFVIGGLGFSDSKNASWAIGSLLLVFVFVYDVGVG----PVTY 473

Query: 637  LIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGF 816
             I  ++P+ + R KT+           I  +N +    ++ +I +  ++ +TE       
Sbjct: 474  CIVPEVPSTKLRTKTV-----------IVARNFYNIMGIINSIWTPYMLNSTEWN----- 517

Query: 817  WAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVI-EKSFKFCWALTKNKFNWSAVTPAE 993
            W A       FW  + +++L      L  T+ R   E    F   +   KF+ + V P  
Sbjct: 518  WGA---KTGLFWGGISLVMLVWAVLDLPETAGRTFGEIDELFAQKIPARKFSSTEVDPYN 574

Query: 994  NPEVTFSWDDKFVEEI 1041
            + ++    +D+ +E +
Sbjct: 575  SSKLMSEMNDQQIENL 590

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +1

Query: 1501 KSFIMALFLFMNAFGSAIG---CALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYN 1671
            K+ I  +   M+  G+ +G     LS      ++ W +   A+ AF+ G   WFC    N
Sbjct: 251  KNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIP--N 308

Query: 1672 DIEDEMNALNYE 1707
            DIE     L  +
Sbjct: 309  DIEKNPQGLKMD 320

>NDAI0C02370 Chr3 complement(541713..543632) [1920 bp, 639 aa] {ON}
           Anc_5.225 YJR004C
          Length = 639

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 21/97 (21%)
 Frame = +3

Query: 378 WCYWFILFLSILVLYYTCSWWLLSRHQLG*-----IQHYRSRYWYLHCWYFRSFHYFFQI 542
           W  WF  +  +L  YY   W+    H  G       +H R  ++Y H ++   F Y++ +
Sbjct: 345 WLDWFFYYY-LLYRYYIHYWYRQYFHSRGHHPCRNTKHQRCHHYY-HYYWLDWFFYYYLL 402

Query: 543 YRR--*KWCFRWFH--------------CGSYFNRYW 605
           YR     W  ++FH              C  Y++ YW
Sbjct: 403 YRHYIHYWYRQYFHSRGHHPCRNTKHQRCHHYYHYYW 439

>Kwal_47.16934 s47 complement(177802..178605) [804 bp, 267 aa] {OFF}
            [contig 219] FULL
          Length = 267

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = -1

Query: 1590 IWILRDWR*GTTDGRTEGVHE*EKSHDERLH 1498
            +W+ + W    T G  +G HE E+SH+E LH
Sbjct: 29   MWVDQRWSYNLTQGSRQGTHEKEQSHNEGLH 59

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 29/85 (34%), Positives = 39/85 (45%)
 Frame = +1

Query: 403 FQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIV 582
           F   C I  V  G L DT  GR   I V   IY+VGI V+ I S K           +++
Sbjct: 103 FNIGCAIGSVFLGRLGDTI-GRRKGIVVAVSIYMVGI-VIQIASVKK-------WFQYLI 153

Query: 583 ALILIGIGTGFIKANLSVLIADQIP 657
             I+ G+G G I     +LI++  P
Sbjct: 154 GRIISGLGAGCIAVLSPMLISEVSP 178

>KLTH0A01166g Chr1 complement(108732..110162) [1431 bp, 476 aa] {ON}
           similar to uniprot|Q08268 Saccharomyces cerevisiae
           YOL119C MCH4 Protein with similarity to mammalian
           monocarboxylate permeases which are involved in
           transport of monocarboxylic acids across the plasma
           membrane mutant is not deficient in monocarboxylate
           transport
          Length = 476

 Score = 33.1 bits (74), Expect = 2.4
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 4/105 (3%)
 Frame = +1

Query: 364 QLNSDGATGLSYFFQFWCYITP---VLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITS 534
           QL SD ++ +S+ F  +  I     VL G   D N G +  I VGT        VLF+TS
Sbjct: 103 QLASDSSSSVSWIFALYLAIVSASCVLTGAYFDRNGG-FGAIVVGT--------VLFVTS 153

Query: 535 FKSIAGKNGALGGFIVAL-ILIGIGTGFIKANLSVLIADQIPAKR 666
             + A  +  +  FI+A  +L G+  G +   L   +A     KR
Sbjct: 154 LVATANCH-TIWQFILAFSVLGGLANGILTTPLVSCVATWFSRKR 197

>Skud_12.441 Chr12 (780487..781080) [594 bp, 197 aa] {ON} YLR356W
            (REAL)
          Length = 197

 Score = 32.3 bits (72), Expect = 2.5
 Identities = 24/109 (22%), Positives = 46/109 (42%), Gaps = 3/109 (2%)
 Frame = +1

Query: 1426 LIAFSEIFASITGLEYA---YSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYT 1596
            L+A + +  S T LE      +    ++K+   AL  F + F         P  + P   
Sbjct: 22   LLASATLITSTTPLEVVTGPLTPTLLTLKNAATALGAFASTFFCMSFFGAPPSLRHPYLL 81

Query: 1597 WLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDI 1743
            +      +++F+ GCA  +  R YN +  E + L  + + ++ E +  I
Sbjct: 82   YGMLAAPLSSFVLGCASHYKSRKYNKVSKESSLLPEDSKPVVPELSDSI 130

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 8/109 (7%)
 Frame = +1

Query: 370 NSDGATGLSY--------FFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLF 525
           +SDG+  LS          F   C I  V+ G L DT  GR   I +   IYIVGI +  
Sbjct: 95  HSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV-GRRKGIVIAVFIYIVGIVIQI 153

Query: 526 ITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPR 672
            +  K           + +  I+ G+G+G I A LS ++  +I  K  R
Sbjct: 154 ASIDKWYQ--------YFIGRIIAGLGSGTI-AVLSPMLISEISPKHLR 193

>TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa]
           {ON}  YDR536W
          Length = 573

 Score = 33.1 bits (74), Expect = 2.5
 Identities = 21/58 (36%), Positives = 32/58 (55%)
 Frame = +1

Query: 463 GRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSV 636
           GR   I +G+ I IVG  V+  T+F+       ALG F+V  ++ G+GTG   + + V
Sbjct: 103 GRKPLIVIGSVITIVGA-VISTTAFRDY----WALGQFVVGRVITGVGTGLNTSTIPV 155

>SAKL0G13618g Chr7 complement(1165467..1168652) [3186 bp, 1061 aa]
           {ON} similar to uniprot|P53037 Saccharomyces cerevisiae
           YGR170W PSD2 Phosphatidylserine decarboxylase of the
           Golgi and vacuolar membranes converts phosphatidylserine
           to phosphatidylethanolamine
          Length = 1061

 Score = 33.1 bits (74), Expect = 2.8
 Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSED-QILDTESYKLQNDNEFDPEHPDYQE 177
           +  H++S     +  +  +++N+ ++  T SS+D    D     + ++NE + + PD+  
Sbjct: 209 LKEHSSSGNVPTVKTLALQQDNLSMQSCTASSDDTDFEDIVEKSIMSENEDEADSPDFMT 268

Query: 178 EGYEMPTEEE 207
             Y    EEE
Sbjct: 269 LKYLYENEEE 278

>NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 32.7 bits (73), Expect = 3.3
 Identities = 23/68 (33%), Positives = 32/68 (47%)
 Frame = +1

Query: 460 WGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVL 639
           WGR   +    GIYIVGI +  ITSF            + +  I+ G+G G I     +L
Sbjct: 161 WGRRLGLITVIGIYIVGILIQ-ITSFNK-------WYQYFIGRIISGLGVGGITVLAPML 212

Query: 640 IADQIPAK 663
           I++  P K
Sbjct: 213 ISEVAPKK 220

>TBLA0B05870 Chr2 complement(1379979..1382171) [2193 bp, 730 aa]
           {ON} Anc_2.267 YNL047C
          Length = 730

 Score = 32.7 bits (73), Expect = 3.5
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = +1

Query: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 180
           +S+ +NS  +  +++      +I+L +TT  +      T ++ L N++      PDYQ+E
Sbjct: 649 LSNSSNSISSYSIAISRSNSRSINLSETTTKNSS----TSNFNLNNNSNSHLPTPDYQDE 704

Query: 181 GYEMPTEEE 207
             +   +E+
Sbjct: 705 NQDEDEDED 713

>KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 8/122 (6%)
 Frame = +1

Query: 364 QLNSDGATGLSY--------FFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFV 519
           Q N+DG   LS          F   C I  ++   L DT+ GR   +A+   IYIVGI +
Sbjct: 91  QKNADGTHYLSKVRTGLVVSIFNIGCAIGGLVLAKLGDTH-GRKLALAIVVSIYIVGIVI 149

Query: 520 LFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGER 699
              +  K           + +  I+ G+G G I   LS ++  ++  K+ R   + S + 
Sbjct: 150 QIASINKWYQ--------YFIGRIISGLGVGGISV-LSPMLISEVSPKQLRGTLVSSYQL 200

Query: 700 VI 705
           +I
Sbjct: 201 MI 202

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 32.0 bits (71), Expect = 5.7
 Identities = 35/166 (21%), Positives = 68/166 (40%)
 Frame = +1

Query: 400 FFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFI 579
           +++ W Y+ P      +++   +Y+ +   +  YI+G+  LF          N A   FI
Sbjct: 383 YYRLWTYVDPQ-----SESRVPKYSILLSMSISYILGLLPLF---------SNAAFNAFI 428

Query: 580 VALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMI 759
              +L       I   L VL+         R + LK+    I+     I N+    +L++
Sbjct: 429 GCAVLCLCSATLIPL-LLVLVT--------RRRVLKNAPVKIKYKLGWIANIGSVCWLLL 479

Query: 760 NIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTL 897
           ++ S+ +     +      +A  +  FCFF I ++    GR+ + L
Sbjct: 480 SMFSVCLPPQIPVTAKTMNYALLVFLFCFFIICILYYKWGRKHFQL 525

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 4/69 (5%)
 Frame = +1

Query: 421 ITPVLGGYLADTNWGRYN-TIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVA---L 588
           I P +G  + D    R+  +++VGT +  +GIF ++   + S+A KNG    ++++   L
Sbjct: 115 IYPAIGTIMQDFGTSRFLVSVSVGTYLAALGIFPIW---WSSLADKNGRRTVYVLSFALL 171

Query: 589 ILIGIGTGF 615
           ++  +GT F
Sbjct: 172 VVFSVGTAF 180

>YNR054C Chr14 complement(723356..724306) [951 bp, 316 aa] {ON}
           ESF2Essential nucleolar protein involved in pre-18S rRNA
           processing; binds to RNA and stimulates ATPase activity
           of Dbp8; involved in assembly of the small subunit (SSU)
           processome
          Length = 316

 Score = 31.6 bits (70), Expect = 6.2
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +1

Query: 1   MSSHTNSE-EAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQE 177
           MS   NS+ E       TD+ N +   K  +SS+D I   +   ++++NE D E    QE
Sbjct: 1   MSEKVNSDFEDFSSDEETDQHNVLIQTKKKISSKDDIFSKKVEDIESENESDIEEEQKQE 60

Query: 178 --EGYEMPTEE 204
             E  E P +E
Sbjct: 61  EKEDVEQPDKE 71

>CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} similar to
            uniprot|P40578 Saccharomyces cerevisiae YIR033w MGA2 or
            uniprot|P35210 Saccharomyces cerevisiae YKL020c SPT23
          Length = 1092

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 10/54 (18%)
 Frame = +1

Query: 76   KKTTVSSEDQILDTESYKLQN----DNEFDPEHP------DYQEEGYEMPTEEE 207
            K +T S    I D+ES + +N    DNE D E+P      DY++  YE   +E+
Sbjct: 839  KLSTSSFNSSIFDSESLQSENANSHDNEIDNEYPVYSDGSDYEDSDYEEEEDED 892

>TPHA0B01370 Chr2 complement(304248..308387) [4140 bp, 1379 aa] {ON}
           Anc_7.463 YJR092W
          Length = 1379

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 16/44 (36%), Positives = 27/44 (61%)
 Frame = -2

Query: 980 TADQLNLFFVRAQQNLKDFSMTLSEVGLRV*DLLPKTKTMTAIQ 849
           T D+L+   V  + N+ +FSM L+E+G    D+L K  T++ I+
Sbjct: 24  TIDELSFSTVNNELNMHEFSMPLNEIGDDTMDMLVKHNTLSNIK 67

>Ecym_4488 Chr4 (987058..988338) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADL003C
          Length = 426

 Score = 31.6 bits (70), Expect = 6.9
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 2/110 (1%)
 Frame = +1

Query: 52  DEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVS 231
           D    + L  +  + + Q   T  +KL + +       DY+  G    TE++++ +RH++
Sbjct: 317 DPYYRLTLNASRQTKDIQYYTTGEFKLPDHHGVFTFLTDYRRSGLSYVTEKDVKAIRHLA 376

Query: 232 GRIPFRCFLI--AVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNS 375
                R + I  A V LS  FS   L + F     N P     GV + N+
Sbjct: 377 NDEYPRSYKITNAWVYLSSIFSVIFLFSMFLLVYMNAPITENVGVEKKNN 426

>ZYRO0E06006g Chr5 complement(463341..464882) [1542 bp, 513 aa] {ON}
           similar to uniprot|P20048 Saccharomyces cerevisiae
           YMR013C SEC59 Membrane protein that catalyzes the CTP-
           mediated phosphorylation of dolichol the terminal step
           in dolichyl monophosphate (Dol-P) biosynthesis required
           for viability normal rates of lipid intermediate
           synthesis and protein N-glycosylation
          Length = 513

 Score = 31.6 bits (70), Expect = 7.3
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 10/115 (8%)
 Frame = +1

Query: 340 SDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVG--- 510
           SDSP G++ L    +            +  ++GG    T+W        GTG +I G   
Sbjct: 412 SDSPVGLIGLGVGDS------------LASIVGGKWGKTSWPGTGKTIEGTGAFIAGTSF 459

Query: 511 ---IFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSV----LIADQI 654
              IF  ++  FK I+  N  L   I  L  +  G  F+  N+ +    L+A+Q+
Sbjct: 460 VSLIFKQYLGYFKGISSLNLIL---ICGLSGVLEGNSFLNDNILIPAFMLVAEQV 511

>TPHA0N00780 Chr14 (173788..175560) [1773 bp, 590 aa] {ON} Anc_5.221
           YJR002W
          Length = 590

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 20/72 (27%), Positives = 34/72 (47%)
 Frame = +1

Query: 25  EAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEE 204
           E + +  I + K+ I+LK   +SS +  L+       ND++ D +  + +EE  E   EE
Sbjct: 74  EGDLMERIQELKDIINLKDDPISSSEDDLEQSIQDEDNDDDDDDDDDEKEEEEEEEEEEE 133

Query: 205 ELRTLRHVSGRI 240
           E      V G +
Sbjct: 134 EKEEDVKVKGAV 145

>TDEL0A01700 Chr1 (305211..306104) [894 bp, 297 aa] {ON} Anc_6.138
           YBR231C
          Length = 297

 Score = 31.2 bits (69), Expect = 7.9
 Identities = 13/47 (27%), Positives = 22/47 (46%)
 Frame = +1

Query: 97  EDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGR 237
           E+ + D E Y  + D +F+PE     E+  E    +   + +H  GR
Sbjct: 11  EEDVFDEEQYNEEEDEDFNPEQGKQSEDEDEEDESKPTESSKHKDGR 57

>KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} similar
           to uniprot|Q01454 Saccharomyces cerevisiae YPR135W CTF4
           Chromatin-associated protein required for sister
           chromatid cohesion interacts with DNA polymerase alpha
           (Pol1p) and may link DNA synthesis to sister chromatid
           cohesion
          Length = 900

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 550 GKNGALGGFIVALILIGIGTGFIKANLSVLIADQI 654
           GK  A+GG  + LIL+G+  G  K   +V + DQ+
Sbjct: 106 GKTAAVGGDDLELILVGLADGSAKTRTTVTLEDQV 140

>NDAI0G04460 Chr7 complement(1066524..1069940) [3417 bp, 1138 aa]
           {ON} Anc_2.651
          Length = 1138

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 18/38 (47%), Positives = 22/38 (57%)
 Frame = -1

Query: 603 NTD*NKSHNETT*STIFTCDRFERSNEKNENTNNVDTS 490
           NTD NK+ N TT +T  T +    +N  N NTNN  TS
Sbjct: 145 NTD-NKAANTTTTTTTTTNNNNNNNNNNNTNTNNNSTS 181

>SAKL0A04004g Chr1 (373666..377208) [3543 bp, 1180 aa] {ON} similar
           to uniprot|P53125 Saccharomyces cerevisiae YGL133W ITC1
           Component of the ATP-dependent Isw2p-Itc1p chromatin
           remodeling complex required for repression of a-
           specific genes repression of early meiotic genes during
           mitotic growth and repression of INO1
          Length = 1180

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = +1

Query: 37  LSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRT 216
           +S + DE+ NI+   T V  +D  LD    +   DNE D E    +++  +MP E ++ T
Sbjct: 414 MSSVQDEEENIENNNTIV--KDIKLDDSDQEQGEDNEEDNEEVKNEKKEDDMPLERDVTT 471

>KNAG0A06020 Chr1 complement(905792..909550) [3759 bp, 1252 aa] {ON}
           Anc_2.409 YMR128W
          Length = 1252

 Score = 31.6 bits (70), Expect = 8.4
 Identities = 15/58 (25%), Positives = 27/58 (46%)
 Frame = +1

Query: 31  EKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEE 204
           +++  +     N DL+   +    Q++D E +    +NE D +     EEG+E   EE
Sbjct: 657 DEIPTVKINSKNADLEAEDIDFSVQVIDEEKFNADFNNEVDEDVEFEGEEGFEEALEE 714

>KAFR0I02620 Chr9 (530945..536329) [5385 bp, 1794 aa] {ON} Anc_5.14
           YMR306W
          Length = 1794

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 6/49 (12%)
 Frame = +3

Query: 495 YLHCWYFRSFHYFFQIYRR*KWCFRWFHCGSYFNRYW------HWFYQS 623
           YLH    +    F++ YR  +    W HC + FNR+W       WF+ S
Sbjct: 306 YLHLRDVKWSKVFYKTYRETR---SWMHCFTNFNRFWIIHFAPFWFFTS 351

>KLLA0A06710g Chr1 (608103..609374) [1272 bp, 423 aa] {ON} similar
           to uniprot|P36049 Saccharomyces cerevisiae YKL172W EBP2
           Essential protein required for the maturation of 25S
           rRNA and 60S ribosomal subunit assembly localizes to the
           nucleolus
          Length = 423

 Score = 31.2 bits (69), Expect = 9.1
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 22  EEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 180
           EE E+    +DE++ +DL+K   S  D   D E  + + + E + E  + +EE
Sbjct: 117 EEEEESDNESDEEDRLDLEKLANSDSDSDSDEEEEEEEEEEEEEEEEKEEEEE 169

>Kwal_55.21172 s55 (715533..716288) [756 bp, 251 aa] {ON} YPR143W -
           Protein required for cell viability [contig 295] PARTIAL
          Length = 251

 Score = 30.8 bits (68), Expect = 9.5
 Identities = 18/73 (24%), Positives = 37/73 (50%)
 Frame = +1

Query: 52  DEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVS 231
           D  +N +L+  + + EDQ  +  S +  N +  + +  D +EEG E P +++ +  +H  
Sbjct: 41  DGGSNDELEGRSSAEEDQSSEDGSEEEDNLDSEEDDSEDEEEEGDEFPLKKKSKLSKHDD 100

Query: 232 GRIPFRCFLIAVV 270
           G   F   + A++
Sbjct: 101 GSSGFSTAVNAIL 113

>KAFR0D01550 Chr4 complement(307032..308585) [1554 bp, 517 aa] {ON}
           Anc_8.783 YOR306C
          Length = 517

 Score = 31.2 bits (69), Expect = 9.6
 Identities = 39/182 (21%), Positives = 72/182 (39%), Gaps = 9/182 (4%)
 Frame = +1

Query: 4   SSHTNSEEAEKL------SVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHP 165
           S H +S+E++ L       +I+         K+  S++   L   + +L  D+ F  E  
Sbjct: 21  SLHQDSDESDSLHASSSSEMISSSMEETKSHKSVASNDSNNLINRNTRLDGDHSFMEEQS 80

Query: 166 DYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSD 345
           +  +E      EE+       +  + F CF      L   F    +++  +  +      
Sbjct: 81  E--DEKSLTFDEEDFPEGGLRAWLVTFGCFC----GLIPIFGIVNITSVIEESIQEN--- 131

Query: 346 SPPGVLQLNSDGATGLSYFFQ---FWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIF 516
                 QL+S  ++ + + F    F C+   +  G   D N G    +AVGT I++ GIF
Sbjct: 132 ------QLSSYSSSSIGWIFSLFIFICFSFGIFSGTYFDRN-GFKKVVAVGTVIHVGGIF 184

Query: 517 VL 522
            +
Sbjct: 185 AM 186

>TBLA0F01810 Chr6 (448644..450407) [1764 bp, 587 aa] {ON} Anc_7.5
           YAL058W
          Length = 587

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 15/56 (26%), Positives = 32/56 (57%)
 Frame = +1

Query: 550 GKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHD 717
           G NG++   I++ IL+G+G  ++  N+S   A Q+  + PR + ++  +   ++ D
Sbjct: 495 GGNGSIFLIIISSILLGLGIHYLANNMSKPTARQVEREVPRQREMQKPQPKPKEED 550

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 31.2 bits (69), Expect = 10.0
 Identities = 23/80 (28%), Positives = 36/80 (45%)
 Frame = +1

Query: 382 ATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNG 561
           AT ++  F F   IT  L G++          I  G G++    F+ F    +   G + 
Sbjct: 380 ATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGVW----FISFGLMIRYTGGLDS 435

Query: 562 ALGGFIVALILIGIGTGFIK 621
            +G  IVA  ++G G GF+K
Sbjct: 436 HVG-IIVARCILGFGNGFLK 454

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 154,448,209
Number of extensions: 3447015
Number of successful extensions: 13256
Number of sequences better than 10.0: 64
Number of HSP's gapped: 13030
Number of HSP's successfully gapped: 64
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)