Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H00230singletonON59659632020.0
KAFR0H002405.698ON59159223790.0
KNAG0C065705.698ON59055621460.0
Suva_11.3295.698ON60159820530.0
ZYRO0G06688g5.698ON61358020520.0
NCAS0A032205.698ON61157320370.0
NDAI0E050205.698ON61956720220.0
YKR093W (PTR2)5.698ON60159820160.0
Smik_11.3565.698ON60259819970.0
TBLA0A091205.698ON63360819850.0
Kpol_529.285.698ON61060619730.0
TPHA0O02000singletonON62060019680.0
TDEL0B022305.698ON57456319560.0
CAGL0G02453g5.698ON59759419260.0
SAKL0E14828g5.698ON59257319190.0
TPHA0N01960singletonON59159319160.0
TBLA0E01140singletonON61158318820.0
TBLA0B04710singletonON61551918580.0
KLLA0E12915g5.698ON65456318620.0
Skud_11.3315.698ON39939414320.0
Kwal_47.16930na 1ON6115756645e-78
Ecym_2823na 2ON6135606061e-69
KLTH0D16544gna 1ON6266175885e-67
AGL365Cna 2ON5995345323e-59
AFR228WsingletonON5765675235e-58
NDAI0F01930singletonON564213860.080
Skud_7.628na 3ON616183860.094
ADL156Cna 4ON483335790.48
TBLA0F01600singletonON567118771.1
TBLA0A10540singletonON49382742.3
KLTH0F14322g3.473ON90035742.4
NCAS0A11500singletonON614119732.9
NDAI0F01940singletonON55194733.0
NDAI0D00820singletonON562109714.6
TDEL0B07220na 5ON57358715.9
AFL204C5.396ON535113706.6
TBLA0C01160singletonON60072698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00230
         (596 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}     1238   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   920   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   831   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   795   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   795   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   789   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   783   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   781   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   773   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   769   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   764   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   762   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   758   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   746   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   743   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   742   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   729   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            720   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   721   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   556   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   260   5e-78
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   238   1e-69
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   231   5e-67
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   209   3e-59
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   206   5e-58
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               38   0.080
Skud_7.628 Chr7 complement(1052224..1054074) [1851 bp, 616 aa] {...    38   0.094
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    35   0.48 
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    34   1.1  
TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON}             33   2.3  
KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} simi...    33   2.4  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...    33   2.9  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               33   3.0  
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    32   4.6  
TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa] ...    32   5.9  
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    32   6.6  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    31   8.2  

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/596 (100%), Positives = 596/596 (100%)

Query: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 60
           MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE
Sbjct: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 60

Query: 61  GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 120
           GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV
Sbjct: 61  GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 120

Query: 121 LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 180
           LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK
Sbjct: 121 LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 180

Query: 181 SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 240
           SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI
Sbjct: 181 SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 240

Query: 241 TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 300
           TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK
Sbjct: 241 TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 300

Query: 301 PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 360
           PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY
Sbjct: 301 PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 360

Query: 361 PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 420
           PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF
Sbjct: 361 PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 420

Query: 421 RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS 480
           RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS
Sbjct: 421 RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAFS 480

Query: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540
           EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV
Sbjct: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540

Query: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 596
           TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL
Sbjct: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 596

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/592 (74%), Positives = 499/592 (84%), Gaps = 4/592 (0%)

Query: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSED-QILDTESYKLQNDNEFDPEHPDYQE 59
           MS+H  + +       + EKN I+LK T VSS D +  DTE+Y LQ D   +P+H DYQE
Sbjct: 1   MSTHIATNDDPSSINTSMEKNYIELKNTKVSSSDGEHKDTEAYTLQ-DGSIEPDHEDYQE 59

Query: 60  EGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPG 119
           EGYE+PT++E++TLR V GRIPFRCFL+A+VEL+ERFSYYGLSAPFQNYM N P+DSPPG
Sbjct: 60  EGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPG 119

Query: 120 VLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF 179
           VLQLNS GATGLSYFFQFWCYITP+ GGYLADT WGRYNTI VGT IYI+GIF+LFITSF
Sbjct: 120 VLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSF 179

Query: 180 KSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHD 239
           K++AG++GAL GFI+ALILIG  TG IK+NLSVLIADQIPAKRPRVKTLKSGERVIEDHD
Sbjct: 180 KTVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHD 239

Query: 240 ITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTL 299
           +TIQNVFMFFYLMINIGSLSVIATTELE +VGFWAAYLLPFCFFWIAVIV+V G+R Y +
Sbjct: 240 VTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYII 299

Query: 300 KPTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLF 359
           KPT DRVI KSFK CW L KNKF+ ++  P+ +PE  F W+DKFV+EI+ ALAACKVFLF
Sbjct: 300 KPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLF 359

Query: 360 YPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTP 419
           YPIYWTCYGQM NNF+TMGSM+QLHGLPNDIFQAI+SI+LI+FIPICEKF YPFIRRFTP
Sbjct: 360 YPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTP 419

Query: 420 FRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVAWQVPAYVLIAF 479
            RP+T+I  GF  A+ +MVW+CVLQ+FIY TGPNY  PL  G N++HV WQVPAYV IAF
Sbjct: 420 LRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELGANDIHVGWQVPAYVFIAF 479

Query: 480 SEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLA 539
           SEIFASITGLEYAYSKAPA+MKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY  LA
Sbjct: 480 SEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLA 539

Query: 540 VTAFITGCAFWFCFRHYNDIEDEMNALNYED--EDIITENNQDIEMVHPLSA 589
           V  F++G  FW CFR YN IEDEMNAL++ D  ED I     + E V  L A
Sbjct: 540 VACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEILIRRAEDEDVASLKA 591

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/556 (71%), Positives = 457/556 (82%), Gaps = 14/556 (2%)

Query: 18  DEKNNIDLKKT---TVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLR 74
           D+KN++ L K    T+  + +I+D  + + ++D            EGYE+PTEEELRTL+
Sbjct: 16  DKKNDLVLTKENSHTIEEDSRIVDDLASQYEDD----------IPEGYEVPTEEELRTLK 65

Query: 75  HVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYF 134
           HV G IP RC+LIAVVELSERFSYYGLSAPFQNYMAN P D PPG+LQLNSDGATGLSYF
Sbjct: 66  HVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYF 125

Query: 135 FQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIV 194
           FQFWCY+TP+ GGY+ADT+WG+YNTIAVGTGIYI GIF+LF+TS  SI  KN  LGGFIV
Sbjct: 126 FQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIV 185

Query: 195 ALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMIN 254
           A+ILIGI TG IK+NLSVLIADQ+P ++P VKT K+GERVIED ++T+QNVFMFFYLMIN
Sbjct: 186 AIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMIN 245

Query: 255 IGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFC 314
           IGSLSVIAT+ELE H GFWAAYLLPFCFFWIAV+VLVLG+  Y   P  D+VI K FK  
Sbjct: 246 IGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVL 305

Query: 315 WALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNF 374
           W LTKN+FN+ A  P+ NP   + W DKFV+EI+ AL ACKVFLFYPIYWTCYGQM + F
Sbjct: 306 WILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGF 365

Query: 375 VTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLAS 434
           VT GSM++LHGLPND FQ IDSIA+IVFIP+CE   YPFIR++TPFRPITKI +GF  AS
Sbjct: 366 VTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFAS 425

Query: 435 ASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAY 493
             M+WA VLQ +IYK GP+YK PL  DGPN +HVA QVPAYVL+AFSEIFASITGLEYAY
Sbjct: 426 GCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAY 485

Query: 494 SKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCF 553
           SKAPASMKSFIM++FL  NAFGSAIGCALSPVSKDPD+TWLY GLAV  FI+GC FW CF
Sbjct: 486 SKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCF 545

Query: 554 RHYNDIEDEMNALNYE 569
           R YNDIE+EMNA++YE
Sbjct: 546 RKYNDIEEEMNAMDYE 561

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/598 (63%), Positives = 460/598 (76%), Gaps = 16/598 (2%)

Query: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61
           S     E+  +  V+ +EKN     K +  S+D    TE + L          P  ++  
Sbjct: 9   SDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLS---------PSPEDNE 59

Query: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121
           +E PT+EELR+LRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+D+P G+L
Sbjct: 60  FEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGML 119

Query: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120 SLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241
           +  ++ ALGGFI ++ILIGI TG IKANLSVLIADQ+P ++P +K LKSGERVIED +IT
Sbjct: 180 VGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNIT 239

Query: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFW+AV+ LV G++ Y  +P
Sbjct: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRP 299

Query: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361
             D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300 IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYP 359

Query: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TPF+
Sbjct: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFK 419

Query: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFS 479

Query: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540
           EIFASITGLEYAYSKAPA+MKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480 EIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDED------IITENNQDIEMVHPLSAYTS 592
             FI+GC FW CFR YND E+EMNA++YE+ED      I      DIE++ P+ +  S
Sbjct: 540 ACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKS 597

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/580 (66%), Positives = 454/580 (78%), Gaps = 26/580 (4%)

Query: 14  SVITDEKNNIDLKKTTV----SSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEE 69
           S+   EKN + ++  ++    S E   LD + Y++ ND+E               PTEEE
Sbjct: 7   SITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPNDDE---------------PTEEE 51

Query: 70  LRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGAT 129
           LR+LRHV G IPFRC+LIA+VELSERFSYYGLSAPFQNYM N   D+P GVL L S GAT
Sbjct: 52  LRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGAT 111

Query: 130 GLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGAL 189
           GL+YFFQFWCY+TPV GG+LADT WG+Y TI VGTG+Y+VGIF+LFITS  S+  KN AL
Sbjct: 112 GLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTAL 171

Query: 190 GGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFF 249
           GGFI A++LIGI TG IKANLSVLIADQ P ++PR+KT K GERVIED +ITIQNVFMFF
Sbjct: 172 GGFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFF 231

Query: 250 YLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEK 309
           YLMINIGSLSVIATTELE+H GFWAAYLLPFCFFWIAVIVL +GR+SY   P  D+VI K
Sbjct: 232 YLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAK 291

Query: 310 SFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQ 369
           SF+    L K++F++ AV P+ +PE  + W+D FVEEI+ AL ACKVF+FYPIYW  YGQ
Sbjct: 292 SFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQ 351

Query: 370 MTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYG 429
           MT+ FV++G  +QLHGLPND FQAIDSIALIVFIPICE + YPFIRR+TPF+PITKI +G
Sbjct: 352 MTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFG 411

Query: 430 FWLASASMVWACVLQYFIYKTGPNYKHPL--ADGPNNVHVAWQVPAYVLIAFSEIFASIT 487
           F   SASM+WA VLQ+FIYKTGP Y HP+   +GPNN+H+ WQVPAYVLIAFSEIFASIT
Sbjct: 412 FMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASIT 471

Query: 488 GLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGC 547
           GLEYAYSKAP SMKSFIM++FL  NAFGSAIGCALSPV  DP Y W++ GLAV +FI+GC
Sbjct: 472 GLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGC 531

Query: 548 AFWFCFRHYNDIEDEMNALNYED-----EDIITENNQDIE 582
            FW  F H ND E+EMNA++YE+     +D + +   D+E
Sbjct: 532 LFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLE 571

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/573 (66%), Positives = 457/573 (79%), Gaps = 9/573 (1%)

Query: 5   TNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEM 64
           T  E  +      ++   I LK+TT SSE+   + E+Y + +D E +P        GYE+
Sbjct: 16  TEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEP--------GYEI 67

Query: 65  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLN 124
           PTEE++ TLRHVSG+IP RC+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVL+LN
Sbjct: 68  PTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELN 127

Query: 125 SDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAG 184
           S GATGLSYFFQFWCY+TPV GG++ADT WG+YNTI VGTGIY+ GIF+LFITS  SIA 
Sbjct: 128 SSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIAS 187

Query: 185 KNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQN 244
           K+ +LGGFI A+ILIGI TG IKANLSVLIADQ+P ++PRVKTLKSGERV+ED +IT+QN
Sbjct: 188 KDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQN 247

Query: 245 VFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSD 304
           VFM+FYLM+N+GSLSVIATTELE+H  FWAA+LLPFCFFWIAV+VLV GR  Y  +   +
Sbjct: 248 VFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKRE 307

Query: 305 RVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYW 364
           + I+KSFK  W ++KNKF+ ++  P+ +PE  + W DKFV+E   AL+ACKVFLFYPIYW
Sbjct: 308 KSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYW 367

Query: 365 TCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPIT 424
             YG M + FVT GSM++LHGLPNDIFQAIDS ALI+FIPICE+F YPFIRRFTPF+PIT
Sbjct: 368 VIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPIT 427

Query: 425 KITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEIF 483
           KI +GF  A+ +MVW+CVLQ FIYK GP Y HPL   GPN +HV WQVPAYVLIAFSEI 
Sbjct: 428 KIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEIL 487

Query: 484 ASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAF 543
           ASITGLEYAYSKAP SMKSFIM+LFLF NA GS +G ALSPVS DP +TWL+ GL V  F
Sbjct: 488 ASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACF 547

Query: 544 ITGCAFWFCFRHYNDIEDEMNALNYEDEDIITE 576
           I GC FW  FR YND E+EMNA++YEDE+ + E
Sbjct: 548 IGGCIFWIIFRKYNDTEEEMNAMDYEDEEDLRE 580

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/567 (65%), Positives = 449/567 (79%), Gaps = 11/567 (1%)

Query: 11  EKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQND-----NEFDPEHPDYQEEGYEMP 65
           EK+  IT  K   +   TT S+E+++ D E+Y L N      N+FD    D  EEGYE P
Sbjct: 21  EKIEEITTTKK--ETNATTSSTEEKLHDVETYNLSNSANDSTNDFDD---DEMEEGYEEP 75

Query: 66  TEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNS 125
           T+EEL TL+ V G+IP RC+LI VVEL+ERFSYYGLSAPFQNYM N P+DSP GVL LNS
Sbjct: 76  TDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNS 135

Query: 126 DGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGK 185
            GATGLSYFFQFWCY+TPV GG++ADT WG+YN+I+VGTG YIVGIF+LFIT+  SIA +
Sbjct: 136 SGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQ 195

Query: 186 NGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNV 245
           N +LGGFIV++ILIGIGTGFIKANLSVLIADQ+P ++PRVK LKSGERVIED +IT+QNV
Sbjct: 196 NASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNV 255

Query: 246 FMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDR 305
           FM FYLMINIGS+SV+ATTELE H GFWAAYLLPFCFFWIAV++LV GR+ Y  +   D 
Sbjct: 256 FMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDN 315

Query: 306 VIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWT 365
           V++KSFK CW + KNK +++A  P+ +PE  + W+D+FV+E++  +AACKVF+FYPIYW 
Sbjct: 316 VVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWV 375

Query: 366 CYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITK 425
            YG M + FVT GS ++LHG+PND  Q  DSIALI+FIPI E F YPFIRRFTP RPITK
Sbjct: 376 QYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITK 435

Query: 426 ITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFA 484
           IT GF++   +M WA VLQ+FIY TGP Y HPL+ D PN +HVAWQ+PAYVLIAFSEIFA
Sbjct: 436 ITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFA 495

Query: 485 SITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFI 544
           SITGLEYAYSKAP SMKSF+M++FL  NAFGS +G ALS V+ DP + WL+ GLAV+  +
Sbjct: 496 SITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGV 555

Query: 545 TGCAFWFCFRHYNDIEDEMNALNYEDE 571
           TG  FW CFR  N  E+EMNA++Y+ E
Sbjct: 556 TGILFWLCFRGLNATEEEMNAMDYDAE 582

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/598 (63%), Positives = 457/598 (76%), Gaps = 16/598 (2%)

Query: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61
           S     E+     VI +EK      K +  S+D    TE Y L          P  ++E 
Sbjct: 9   SDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLS---------PSPEDED 59

Query: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121
           +E PTEEE++TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 60  FEGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119

Query: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120 SLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241
           +  ++ A+GGFI A+ILIGI TG IKANLSVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 180 VGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNIT 239

Query: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299

Query: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361
             D+VI KSFK CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300 IGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYP 359

Query: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALI+FIPI EKF YPFIRR+TP +
Sbjct: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLK 419

Query: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN+VHV WQ+PAYVLI+FS
Sbjct: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFS 479

Query: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540
           EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480 EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDED------IITENNQDIEMVHPLSAYTS 592
             FI+GC FW CFR YND E+EMNA++YE+ED      I      DIE++ P+ +  S
Sbjct: 540 ACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 597

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/598 (62%), Positives = 457/598 (76%), Gaps = 16/598 (2%)

Query: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61
           S     E+     VI +EK +    K +  S+D    TE Y L +  E         +E 
Sbjct: 9   SDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPE---------DED 59

Query: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121
           +E PTEEE +TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 60  FEAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119

Query: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 120 GLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179

Query: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241
           +  ++ A+GGFI A+ILIGI TG IKAN+SVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 180 VGNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNIT 239

Query: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299

Query: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361
             D+V+ KSF+ CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 300 IGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYP 359

Query: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALIVFIPI EKF YPFIRR+TP +
Sbjct: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLK 419

Query: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN++HV WQ+PAYVLI+FS
Sbjct: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFS 479

Query: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540
           EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 480 EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539

Query: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENN------QDIEMVHPLSAYTS 592
             FI+GC FW CFR YND E+EMNA++YE++D    N+       DIE++ P  +  S
Sbjct: 540 ACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRS 597

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/608 (61%), Positives = 449/608 (73%), Gaps = 22/608 (3%)

Query: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61
           S  T +E+   ++ I    NN ++ +      D       Y    D + D +   +QE+ 
Sbjct: 12  SFETENEQVNDVTTIDVTDNNQNVVQMVNGGGDI-----DYIPTQDEKRDQKFETFQEDS 66

Query: 62  YEMPTEEE-------------LRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNY 108
             +  E E             LRTL+HV G+IP RC+L+AV+EL+ERFSYYGLSAPFQNY
Sbjct: 67  SIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNY 126

Query: 109 MANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYI 168
           M N P+DSPPG L L+S GATGLSYFFQFWCY+TPV  GY+ADT WG++ TI +GTGIYI
Sbjct: 127 MQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYI 186

Query: 169 VGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTL 228
           VGIF+LFITS  SI   N A+GGFIV LIL+GI TG IKANLSV+IA+QIP ++ RV T 
Sbjct: 187 VGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITK 246

Query: 229 KSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVI 288
           K+G RVIED DITIQNVFM FY MINIGSLSVIATTELE H GFWAAYLLPFCFFW+AVI
Sbjct: 247 KNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVI 306

Query: 289 VLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIR 348
           VL++G ++Y   P  D+VI K FK    L +N+FN  +  PA NP+  + W DKFV+EI 
Sbjct: 307 VLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIM 366

Query: 349 VALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEK 408
            AL ACKVF+FYPIYW CYGQM NNFV+ G  ++LHGLPND FQAIDSIALIVFIPICE+
Sbjct: 367 RALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICER 426

Query: 409 FFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHP--LADGPNNVH 466
           F YPFIR++TPF+PITKI +GF   + SM WACVLQ+FIYK  P Y HP    +GPN++H
Sbjct: 427 FVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIH 486

Query: 467 VAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVS 526
           VA QVPAY L+A SEIFASITGLEYAYSKAPASMK+FIM++FL  NAFG+AIGCALSPVS
Sbjct: 487 VALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVS 546

Query: 527 KDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQ--DIEMV 584
           KDP Y WLY GLAV  F+ GC FW  F+ YND+E+E+N L++E+ D + E     DIEM+
Sbjct: 547 KDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMI 606

Query: 585 HPLSAYTS 592
            P+S+  S
Sbjct: 607 QPISSRRS 614

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/606 (61%), Positives = 457/606 (75%), Gaps = 25/606 (4%)

Query: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61
           +SH +S++  ++ +++          T++ + DQ+   E  K+ +D   D E+ D Q+  
Sbjct: 19  ASHIDSKQDHEVKIVSK------FDSTSLQNSDQL---EITKVGDD---DIEYDDNQD-- 64

Query: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121
           +  PTEEE++TL+HVSG+IP RC+LIAVVELSERFSYYGL+APFQNYMAN P+D+P GVL
Sbjct: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124

Query: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181
            L++ GA+ LSYFFQFWCYITP+ GGY+ADT WG+YNTI  GTGIY+VGIF+LFITS  S
Sbjct: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184

Query: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241
           I  +  ALGG++ A+ILIGI TG IKAN+SVLIA+QIP  +PRV T K G+RVIED +IT
Sbjct: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244

Query: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301
            QNVFMFFY+MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+VLV+GR  Y + P
Sbjct: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304

Query: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361
             D++I KSFK  W L KNK N+ A  P+ NPE  + W+DKFVEEIR AL ACKVF+FYP
Sbjct: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364

Query: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421
           IYW  YGQM NNFVT    ++LH LPND  QA DSIA+IVFIPI E+F YPF+RRFTPFR
Sbjct: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424

Query: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYV 475
           PITKI +GF   S +M+WA VLQ FIYK GP Y  P+      A+ PN VHVAWQVPAYV
Sbjct: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484

Query: 476 LIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLY 535
           LIA SEI AS+TGLEYAYS APASMKSFIM++FL  NAFGSAIG A+SP ++DP YTW +
Sbjct: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544

Query: 536 CGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDI-----ITENNQDIEMVHPLSAY 590
            GLAV  FI GC FW CFR YN+ ED MN +++ D+D             IE++ P++++
Sbjct: 545 TGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTSIEVMEPITSF 604

Query: 591 TSPKSL 596
            S KSL
Sbjct: 605 RSIKSL 610

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/600 (61%), Positives = 456/600 (76%), Gaps = 23/600 (3%)

Query: 11  EKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEEL 70
           ++L    D   NID K    ++E++ LD    +   D+E DP +    E GY  PTEEE+
Sbjct: 30  KELDSSHDVTFNIDDKVENDTNEEE-LD----EFAVDDEADPYN---DEWGYVEPTEEEM 81

Query: 71  RTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATG 130
            TL+HV+G IP+RC+LIAVVELSERFSYYGLSAPFQNYMAN P+D+P G+LQLN++GATG
Sbjct: 82  ATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATG 141

Query: 131 LSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALG 190
           LSYFFQFWCYITP+ GGY+ADT W +YNTIAVGT IYI+GIF+LFIT+  SIA K  A G
Sbjct: 142 LSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATG 201

Query: 191 GFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFY 250
           GF+ A+ILIGIGTG IKANLSVL+A+QIP ++ RV T K GERVIED DIT+QNVFMFFY
Sbjct: 202 GFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFY 261

Query: 251 LMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKS 310
           LMINIG+LSV+ATTELE H GFWAAYLLPFCFFWIAV++LV+GR SY +KP  D+VI K 
Sbjct: 262 LMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKC 321

Query: 311 FKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQM 370
           FK  + + KNKFN+ +  P+ NPE+ + W DKFV+EI  ++ ACKVF+FYPIYW  YGQM
Sbjct: 322 FKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQM 381

Query: 371 TNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGF 430
            NNF+T    ++LH +PND  Q  DSI +IVFIPI E+F YP IRRFTP +PITKI  GF
Sbjct: 382 INNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGF 441

Query: 431 WLASASMVWACVLQYFIYKTGPNYKHPLADG------PNNVHVAWQVPAYVLIAFSEIFA 484
              S +MVWA VLQ FIYK GP Y HP+A G      PN VHVAWQ+PAYV+IA+SEIFA
Sbjct: 442 MCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFA 501

Query: 485 SITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFI 544
           S+TGLE+AYS AP SMK+FIM++FLF NA G+A+G A+SP S DP YTW++ GLAV+ F+
Sbjct: 502 SVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFV 561

Query: 545 TGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIE--------MVHPLSAYTSPKSL 596
            GC FW CF HYNDI+ +M A+++ ++D+I  +  D+E         V P+ +  S KSL
Sbjct: 562 AGCLFWICFHHYNDIDADMKAIDFVEDDMINASG-DVEKTASSGFSTVEPIISMRSAKSL 620

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/563 (65%), Positives = 444/563 (78%), Gaps = 7/563 (1%)

Query: 25  LKKTTVSSEDQILDTESYK---LQNDN--EFDPEHPDYQEEGYE-MPTEEELRTLRHVSG 78
           +K+T  SS D +   E  K   + +D   E    H   + E Y+  PTEEE++TL+HV+G
Sbjct: 1   MKRTETSSTDGVDSVEKQKAVEVVDDKLVEVISSHNGLEVESYDDEPTEEEMKTLKHVAG 60

Query: 79  RIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFW 138
            IPFRC+LIAVVELSERF+YYGLS PFQNYM N P D+P G+L L S GATGLSYFFQFW
Sbjct: 61  TIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLSYFFQFW 120

Query: 139 CYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALIL 198
           CY+TP+ GG+L+DT  G+YNTI  GTG+Y++GI +LF+TS  SI  +N A GGFI A+IL
Sbjct: 121 CYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGFIAAIIL 180

Query: 199 IGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSL 258
           IGI TG IK+N+SVLIADQ P +R RV T K G RVIED +IT+QNVFM FYLMINIGSL
Sbjct: 181 IGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSL 240

Query: 259 SVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALT 318
           SVIATTELE HVGFWAAYLLPFCFFWIAVIVL +G+ SY   P  D+VI K FK      
Sbjct: 241 SVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAI 300

Query: 319 KNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMG 378
           KNKFN+ A  P+ +P+  F W DKFV+EI  +L+ACKVFLFYP+YW CYGQM N FV++G
Sbjct: 301 KNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVG 360

Query: 379 SMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMV 438
             ++LHGLPND FQAIDSIALIVFIPICE F YP+IR+FTPFRPITKI +GF   +A+MV
Sbjct: 361 GTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMV 420

Query: 439 WACVLQYFIYKTGPNYKHPLADG-PNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAP 497
           WA VLQ+FIYK+GP YK+P+A+  PN++H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP
Sbjct: 421 WAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAP 480

Query: 498 ASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYN 557
            +MKSFIMA+FL  NAFGSAIGCALSPV+KDPDY WLY GL V  F  G  FWFCF+HYN
Sbjct: 481 VTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYN 540

Query: 558 DIEDEMNALNYEDEDIITENNQD 580
           D E+ MNAL+Y+++  + ++++D
Sbjct: 541 DTEEAMNALDYDEDPTMLKHSKD 563

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/594 (62%), Positives = 444/594 (74%), Gaps = 10/594 (1%)

Query: 12  KLSVITDEKNNIDLKKTTVSSED-------QILDTESYKLQND-NEFDPEHPDYQEEGYE 63
           + S   DEKN ++++K   S +D       +I D E + L  D +  +      +++ +E
Sbjct: 4   RFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDDFE 63

Query: 64  MPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQL 123
            PTEEEL+TLRHV+G IP RC+LIA+VELSERFSYYGLSAPFQNYM N P+D+P G+L L
Sbjct: 64  APTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGL 123

Query: 124 NSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIA 183
            S GATGLSYFFQFWCY+TPV GG+++DT WG+YNTI VGT IY+ GIF+LFITS   + 
Sbjct: 124 KSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVT 183

Query: 184 GKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQ 243
             +GALGGFI A+ILIGI TG IK+NLSVLIADQ+P K+PRV   K GERVIED ++T+Q
Sbjct: 184 NSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQ 243

Query: 244 NVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTS 303
           NVFMFFY  IN+GSLSV+ATTELE H GFWAAYLLPFCFFW+AV VLV GR  Y   P  
Sbjct: 244 NVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVG 303

Query: 304 DRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIY 363
           D+VI KSFK  + L+KNKFN  A  P+ NP+  F W DKFV+EI+ AL ACKVF+FYP+Y
Sbjct: 304 DKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVY 363

Query: 364 WTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPI 423
           W CYG M NNFVT G  ++LH LPND  QA DSIALI+FIPI E+F YPFIRR+TP RPI
Sbjct: 364 WVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPI 423

Query: 424 TKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL-ADGPNNVHVAWQVPAYVLIAFSEI 482
           TKI +GF + S +MVWA VLQ+FIY  GP Y HPL  D PN++HVAWQ+PAYVLIA SEI
Sbjct: 424 TKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEI 483

Query: 483 FASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTA 542
           FASITGLEYAYSKAP SMKSFIM++FL  NAFGSAIGCALSPVS DP + W Y GLA   
Sbjct: 484 FASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACAC 543

Query: 543 FITGCAFWFCFRHYNDIEDEMNALNYE-DEDIITENNQDIEMVHPLSAYTSPKS 595
           FI G  FWF +   ND E+ MNAL+YE DE +   ++ D E    + +  S KS
Sbjct: 544 FIAGWVFWFIYSGLNDEEEAMNALDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS 597

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/573 (62%), Positives = 446/573 (77%), Gaps = 11/573 (1%)

Query: 31  SSEDQILDTESY-KLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAV 89
           +S ++I   ES+  + + N++     D+  E    PT+EE++TLRHVS +IP RC+L+AV
Sbjct: 23  NSVEKIARPESFVDVLDKNQYINADSDHGRE----PTDEEMKTLRHVSEQIPVRCWLVAV 78

Query: 90  VELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYL 149
           VEL+ERFSYYGLSAPFQNYM N P+D+P G+L L + GAT LSYFFQFWCY++P+LGG++
Sbjct: 79  VELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFV 138

Query: 150 ADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKAN 209
           ADT WG+Y TI VGTGIY+VGIF+LFITS  SI   + +LGGFI +LILIG+ TG IKAN
Sbjct: 139 ADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILIGLATGMIKAN 198

Query: 210 LSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQH 269
           +SVLIADQIP  RP VK LKSGERVIED +IT+QN+FMFFYLMINIGSLSVIATTE+E H
Sbjct: 199 ISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAH 258

Query: 270 VGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTP 329
           +GFWAAYLLPFCFF++AV VL+LGR  Y   P  D+VI KSFK CW + +NKF + A  P
Sbjct: 259 IGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARP 318

Query: 330 AENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 389
           + NPE+ + W DKF++EI+ A+AACKVF+FYPIYW CYGQM +NFV+   M++LHGLPND
Sbjct: 319 SLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPND 378

Query: 390 IFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYK 449
             QAIDSIALIVFIPICE+F YPFIRRFTPFRPITKI YGF   + +M WA VLQ+FIYK
Sbjct: 379 FLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYK 438

Query: 450 TGPNYKHPLA------DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSF 503
            GP Y +P+A      + PN +H+AWQVPAYVLIAFSEIFASITGLEYAYSKAP SM+SF
Sbjct: 439 AGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSF 498

Query: 504 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 563
           IM++FL   AFGSA+G ALS VS +P + W + GLAV+ FI GC FW  F  YND E+ M
Sbjct: 499 IMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAM 558

Query: 564 NALNYEDEDIITENNQDIEMVHPLSAYTSPKSL 596
           NA++YE++D++         + P+++  S K +
Sbjct: 559 NAIDYEEDDVLNYGVSIHYDLEPIASVNSDKRI 591

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/593 (61%), Positives = 449/593 (75%), Gaps = 19/593 (3%)

Query: 1   MSSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEE 60
           + +H+NS+ +  LS   D K+ I++    VS+E+QI D  S   ++  E        ++E
Sbjct: 6   LETHSNSDLS--LSSQLDNKDKIEVH--VVSTENQI-DVHSLDDEDYEE--------EDE 52

Query: 61  GYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGV 120
            Y  PTEEEL+TLRHVSG IP RC+LIA+VEL+ERFSYYGLSAPFQNYMAN P+D+P G+
Sbjct: 53  DYVAPTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGL 112

Query: 121 LQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFK 180
           LQLNS GAT +SYFFQFWCY+TP+ GGY+ADT+WG+YNTI  GTGIY+ GIF+LF+TS +
Sbjct: 113 LQLNSSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIE 172

Query: 181 SIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDI 240
           SI  +N A GG+I A+ILIGI TG IK+N+SVLIA+Q+P ++ RV T   GERVIED  +
Sbjct: 173 SITTQNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKL 232

Query: 241 TIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLK 300
           T+QN+FMFFYLMINIGSLSVIATTELE H GFWAAYLLPFCFFWIAV+VL++G++ Y  K
Sbjct: 233 TVQNIFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRK 292

Query: 301 PTSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFY 360
           P  D+VI K F   W   KNK ++ +  P+ +PE  + W DKFVEE+R A+ ACKVFLFY
Sbjct: 293 PVGDKVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFY 352

Query: 361 PIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPF 420
           PIYW  YGQM NNFVT    ++LHGLPND  QAIDSIA+IVFIPICEKF YPFIR+FTPF
Sbjct: 353 PIYWCVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPF 412

Query: 421 RPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAY 474
           R ITKI +GF   SA+M+WA VLQ FIYK GP +  PL      A  PN VH+AWQVPAY
Sbjct: 413 RSITKIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAY 472

Query: 475 VLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWL 534
           VLIAFSEIFASITGLEYAYS AP SMKSFIM++FL   AFGSA+G A+SP S DP +TW 
Sbjct: 473 VLIAFSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWA 532

Query: 535 YCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVHPL 587
           + GLAV+ FI GC FW CFR YN+ ED M+ +++ DE +    N+    + P+
Sbjct: 533 FTGLAVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDMANKASSFISPV 585

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/583 (60%), Positives = 432/583 (74%), Gaps = 5/583 (0%)

Query: 5   TNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEM 64
           T S+E     +++D K++ +    T    + I  T      N+  ++    D  +E +  
Sbjct: 11  TYSQEYNNNILMSDNKDDKNYNFITEDEPNSIASTIIEGNSNEENYNRSTDDDDDEDFIE 70

Query: 65  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLN 124
           PTEEE+RTL+ V G IP RC+L+AV+ELSERFSYYGLSAPFQNYM N P D+PPG L LN
Sbjct: 71  PTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLN 130

Query: 125 SDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAG 184
           + GATGLSYFFQFWCYITP+ GGY+ADT WG+YNTI VG   YI GIF+LF+TS   +  
Sbjct: 131 TQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTS 190

Query: 185 KNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQN 244
            + A+GGFIV++I+IG+GTG IKANLSV+IA+Q+P ++ R+ T K G RVIED DIT+QN
Sbjct: 191 YSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQN 250

Query: 245 VFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSD 304
           VFM FY MIN+GSLSV+ATTELE   GFWAAYLLPFCFFW+AV+VL++G + +   P  D
Sbjct: 251 VFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGD 310

Query: 305 RVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYW 364
           + I KSFK    L KNKFN+ +  P+ +PE  + W DKFVEEIR A+ AC VF FYPIYW
Sbjct: 311 KTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYW 370

Query: 365 TCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPIT 424
            CYGQM NNFVT G  ++LH LPND  Q IDSIALIVFIPICE+  YPF+RRFTP RPIT
Sbjct: 371 VCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPIT 430

Query: 425 KITYGFWLASASMVWACVLQYFIYKTGPNYKHP--LADGPNNVHVAWQVPAYVLIAFSEI 482
           KIT GF+  S SMVWA VLQ+F+Y+  P Y HP    +GPN++HV WQVPAY LIA SEI
Sbjct: 431 KITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEI 490

Query: 483 FASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTA 542
           FASITGLEYAYSKAPASMKSFIM++FLF  A GSA+G ALSPVS DP +TW Y GLAV+ 
Sbjct: 491 FASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSC 550

Query: 543 FITGCAFWFCFRHYNDIEDEMNALNYEDE--DIITEN-NQDIE 582
           FI G AFW CF  YND EDE+N ++ + +   I +EN N D+E
Sbjct: 551 FIAGIAFWLCFSRYNDEEDELNNIDDQPDVIQISSENENDDLE 593

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/519 (68%), Positives = 414/519 (79%), Gaps = 6/519 (1%)

Query: 65  PTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLN 124
           PTEEEL+TL   +G IPF C+L+A++EL+ERFSYYGLSAPFQNYM N PSD+PPG L LN
Sbjct: 67  PTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLN 126

Query: 125 SDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAG 184
           S GATGLSYFFQFWCY+TP+  G++ADT WG++NT+ +GT IYI+GIF+LFITS  +I  
Sbjct: 127 STGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITS 186

Query: 185 KNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLK-SGERVIEDHDITIQ 243
            N ALGGFIVA+ILIGI TG IKANLSV+IADQ+P K+ RV T K SG+RVIED  +TIQ
Sbjct: 187 YNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQ 246

Query: 244 NVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTS 303
           NVFM FY MIN+GSLSVIATTELE HVGFWAAYLLPFCFFWIAV+VL  G R +  KP  
Sbjct: 247 NVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIG 306

Query: 304 DRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIY 363
           DRVI K F     L KN FN+    P  NPE  + W DKFV+EI+ +L ACKVFLFYPIY
Sbjct: 307 DRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIY 366

Query: 364 WTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPI 423
           W CYGQM NNFVT GS +QLHGLPND FQAI+SIALIVFIPI EKF YPFIR+FTP +PI
Sbjct: 367 WVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPI 426

Query: 424 TKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA--DGPNNVHVAWQVPAYVLIAFSE 481
           TK+T GF   S +MVWA VLQ+FIY+ GP Y HP+   +GPN+VHVAWQVPAY LI+ SE
Sbjct: 427 TKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSE 486

Query: 482 IFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVT 541
           IFASITGLE AYSKAP SMKSFIM++FL  NAFG+AIGCALS VS+DP Y WLY GLAVT
Sbjct: 487 IFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVT 546

Query: 542 AFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENNQD 580
            F  G AFWF F+HYND ED MN +++E ++   EN ++
Sbjct: 547 CFCAGIAFWFTFKHYNDEEDAMNNIDFESDN---ENEKN 582

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/563 (63%), Positives = 427/563 (75%), Gaps = 20/563 (3%)

Query: 20  KNNIDLK----KTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRH 75
           KNN D+K    K   +S D+I D      ++DN+         E G E PTEEEL TLRH
Sbjct: 58  KNNTDIKVYISKDHHASSDKI-DFIGAVDEDDNQ--------NENGRE-PTEEELSTLRH 107

Query: 76  VSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFF 135
           VS RIPF C+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVLQL S GAT LSYFF
Sbjct: 108 VSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFF 167

Query: 136 QFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVA 195
           QFWCY+TP+LGGYLADT WG+YNTI VG   Y+VGI +LF+T+  SI  KN +LGGFIV+
Sbjct: 168 QFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVS 227

Query: 196 LILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINI 255
           LI+IGIGTGFIKANLSVLIADQIP  RPR+K LK+GE+VIED ++T+QNVFMFFYLMINI
Sbjct: 228 LIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINI 287

Query: 256 GSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCW 315
           GSLSV+ATT LE   GFWAAYLL FCFFW+ ++VLV GR+ Y  +P  D VI + FK CW
Sbjct: 288 GSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICW 347

Query: 316 ALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFV 375
               N FN +   P+ NPE  + W+D F++EIR A  ACKVF FYPIYW  YGQM NNFV
Sbjct: 348 IGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFV 407

Query: 376 TMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASA 435
           T    ++LHGLPND  QAI+SIALIVFIPI E+F YPFIRRFTPFRP+TKI  GF   S+
Sbjct: 408 TQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSS 467

Query: 436 SMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYVLIAFSEIFASITGL 489
           +MV+A VLQ+FIYK GP Y  P+      A+ PN VH+ WQVPAYVLI+ SEIFASITGL
Sbjct: 468 AMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGL 527

Query: 490 EYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAF 549
           EYAYSKAPA+MK+FIM++FL  NA GSA+G ALSP +++P Y W + GLAV  FI GC F
Sbjct: 528 EYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLF 587

Query: 550 WFCFRHYNDIEDEMNALNYEDED 572
           W CF HYN  E+ +NAL+Y+ E+
Sbjct: 588 WLCFHHYNKDEEALNALDYKTEE 610

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/394 (65%), Positives = 315/394 (79%), Gaps = 7/394 (1%)

Query: 206 IKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTE 265
           IKANLSVLIADQ+P ++P +K LKSGERV+ D +IT+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61

Query: 266 LEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWS 325
           LE H GFWAAYLLPFCFFWIAV+ L+LG++ Y  +P  D+VI KSF+ CW L KNKF+++
Sbjct: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121

Query: 326 AVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHG 385
           A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYPIYWT YG M ++F+T  SM++LHG
Sbjct: 122 AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181

Query: 386 LPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQY 445
           +PND  QA DSIALI+FIPI EKF YPFIRR+TPF+PITKI +GF   S +M WA VLQ 
Sbjct: 182 IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241

Query: 446 FIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFI 504
           FIYK GP Y  PL  + PN VHV WQ+PAYVLI+FSEIFASITGLEYAYSKAPASMKSFI
Sbjct: 242 FIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 301

Query: 505 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMN 564
           M++FL   AFGSAIGCALSPV+ DP +TWL+ GLAV  FI+GC FWFCFR YND E+EMN
Sbjct: 302 MSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMN 361

Query: 565 ALNYEDED------IITENNQDIEMVHPLSAYTS 592
           A++YE+ED      I      DIE++ P+ +  S
Sbjct: 362 AMDYEEEDEFDLNPISAPKANDIEILEPMESLRS 395

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  260 bits (664), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 175/575 (30%), Positives = 272/575 (47%), Gaps = 41/575 (7%)

Query: 49  EFDPEHPDYQE---EGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPF 105
           E D    D+ E   + +  PTE E   LR V G   +  + I ++E SER SYYG     
Sbjct: 13  EIDGHSEDFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGTGDRL 72

Query: 106 QNYMAN-------------TPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADT 152
            N++                 S++  G L +    AT L+    F  Y  P++ GY+AD 
Sbjct: 73  NNFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGYVADR 132

Query: 153 NWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGK-NGALGGFIVALILIGIGTGFIKANLS 211
            WGR   + +G  + IV   V  I S   + G  + AL   I+ +I + I T F+K  L 
Sbjct: 133 YWGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVKPILL 192

Query: 212 VLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVG 271
             +  Q P     VKTL SGERVI D D ++Q + M FY  IN+GS   +AT+   + VG
Sbjct: 193 PTLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVG 252

Query: 272 FWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVI----EKSFKFC-----WALTKNKF 322
           +W A+L+P   F I   VL++ RR    +P S R +     K  K C     W+  +   
Sbjct: 253 YWLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGT 312

Query: 323 NWSAVTPAENPEVTFS---------WDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNN 373
            W    P+    +            + +  V++ RV ++AC +FL+Y IY    G + + 
Sbjct: 313 FWDYAKPSNLRSLGRQGWRKSKPGFYPESLVQDARVTISACTIFLYYVIYNINDGGIGSI 372

Query: 374 FVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFT-PFRPITKITYGFWL 432
             +  + L   G+PND+    + + +IVF+PI ++  YP +R+    FRP+ +I  GF +
Sbjct: 373 MNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMV 432

Query: 433 ASASMVWACVLQYFIYKTGP--NYKHPLADGPNNVHVAWQVPAYVLIAFSEIFASITGLE 490
           A+ +     ++Q+ IY+T P  NY      G + + +      Y L  FSE  A  TG E
Sbjct: 433 AALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYALTGFSECLAMTTGYE 492

Query: 491 YAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFW 550
            A+ ++P  MK+F+MALFLFM+A  +A+G  ++P   DP     +  LA        AF 
Sbjct: 493 IAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVLA--GLGAAVAFA 550

Query: 551 FCFRHYNDIEDEMNALNYEDEDIITENNQDIEMVH 585
           F +R++N +   M     E E +  +    +  + 
Sbjct: 551 FLWRYWN-LHHVMEQERIEREALAKQEEPALNTIR 584

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 176/560 (31%), Positives = 270/560 (48%), Gaps = 47/560 (8%)

Query: 64  MPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNY-------------MA 110
           +PTEEE RTLR +     +  +LI  +EL+ER SYYG      NY               
Sbjct: 43  LPTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGAT 102

Query: 111 NTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVG--TGIYI 168
              S++  G L      AT L    +F  Y  P++ GYL D   G   T+  G  TG   
Sbjct: 103 AHGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTG--- 159

Query: 169 VGIFVLFITSFKSIAGK--NGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVK 226
           V   ++FI S   +  K  + A+   ++ LI + + T F+K  L  L+  Q P +   VK
Sbjct: 160 VASHIIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVK 219

Query: 227 TLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIA 286
           TL++GERVI D D ++Q + M FY  INIG+   +AT+   + VGFW A+L+P   +   
Sbjct: 220 TLETGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAM 279

Query: 287 VIVLVLGR--------RSYTLKPTSDRVIEKSFKFCW-ALTKNKFNWSAVTPAENPEV-T 336
            +V  L +          Y+L     +V+  +F   W A  K    W    P+   ++  
Sbjct: 280 PVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGK 339

Query: 337 FSWDDK-------FVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 389
             W  K        V++ ++ L+AC +F +Y IY     Q+T    +    +  +G+PND
Sbjct: 340 VGWRKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPND 399

Query: 390 IFQAIDSIALIVFIPICEKFFYPFIRRFT-PFRPITKITYGFWLASASMVWACVLQYFIY 448
           +    + +++IV IPI +   YP +RR    F+P+ +I  GF LA AS V   ++Q+ IY
Sbjct: 400 VISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIY 459

Query: 449 KTGPNYKHPLADGPNNVHV----AWQVPA-YVLIAFSEIFASITGLEYAYSKAPASMKSF 503
           +T     H        + V    +W V   Y L   SE  A  T  E AY ++P  MKSF
Sbjct: 460 ETSSCGYHATTCSEKGLGVSPLSSWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSF 519

Query: 504 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEM 563
           ++ALFLF +A  +AI   ++P+ KDP     +   A   FI+GC F + FR   +++ EM
Sbjct: 520 VLALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFR---NLDKEM 576

Query: 564 NALNYEDEDIITENNQDIEM 583
                E E ++ E+++  E+
Sbjct: 577 LQEKRERE-LLQESSESDEL 595

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  231 bits (588), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 171/617 (27%), Positives = 287/617 (46%), Gaps = 58/617 (9%)

Query: 16  ITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRH 75
           ++D +    ++K+ V+    +L+T++Y     +E     P    E    PTE E  TLR 
Sbjct: 1   MSDHEKLSSVEKSQVA----VLETDTY-----SEGGSGTPLSLPE----PTEHERTTLRR 47

Query: 76  VSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMAN----------------TPSDSPPG 119
           V     +  + I ++E SER SYYG      N++                      +  G
Sbjct: 48  VLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAG 107

Query: 120 VLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF 179
            L +    AT L+    F  Y  P++ GY+AD  W R   + +G  + I+   +  I + 
Sbjct: 108 ALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGAL 167

Query: 180 KSIAGK-NGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDH 238
             + G    AL   ++ +I + I T F+K  L   +  Q P +   V+TL SGERV+ D 
Sbjct: 168 PPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDR 227

Query: 239 DITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIA-VIVLVLGRRSY 297
           D ++Q + M FY  INIGS   +AT+   + +G+W A+L+P   + I   ++LVLGR   
Sbjct: 228 DASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLR 287

Query: 298 TLKPTSDRVIE---KSFKFC-----WALTKNKFNWSAVTPAENPEVTFS-WDDK------ 342
              P+   ++    K  + C     W   ++   W+   P+   +   + W  K      
Sbjct: 288 DEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFY 347

Query: 343 ---FVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIAL 399
               V++ RV L+A  +FL+Y IY    G + +   +  + L  +G+PND+    + + +
Sbjct: 348 AESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCI 407

Query: 400 IVFIPICEKFFYPFIRRFT-PFRPITKITYGFWLASASMVWACVLQYFIYKTGP--NYKH 456
           IVF+P+ +   YP +R+    F+P+ +I  GF +A+ +     ++Q  IY T P   Y  
Sbjct: 408 IVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYAT 467

Query: 457 PLADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGS 516
               G + V +      Y L   SE  A  TG E A+ ++PA MKSF+MALFLF +A  +
Sbjct: 468 ECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSA 527

Query: 517 AIGCALSPVSKDPDYTWLYCGLA-VTAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIIT 575
           A+G  ++P   DP     +  LA + AF+   AF F +R+++   D+   L   +   + 
Sbjct: 528 ALGEIVTPSLVDPHLVIPFGVLAGLGAFM---AFVFLWRYWS--LDKTMELERAERRALE 582

Query: 576 ENNQDIEMVHPLSAYTS 592
                +  +  + +Y S
Sbjct: 583 AEEGAMPAITSVRSYVS 599

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 152/534 (28%), Positives = 247/534 (46%), Gaps = 38/534 (7%)

Query: 71  RTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYM-----------ANTPSDSPPG 119
           + LRHV     +  ++I ++EL+ER SYYG      N+               P D  PG
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 120 VLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF 179
            L      AT L+   +F  Y  P++ GY+AD   G    + +G    +V   +  I + 
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 180 KSIAGKNG-ALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDH 238
            ++   N   +   ++ L+ + + T F+K  L  ++  Q P +   VKTL +GERVI + 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 239 DITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYT 298
           D ++Q + M FY  IN+GS   +AT    Q VG+W ++L+P   F I   +L+  +    
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 299 LKPTSD-------RVIEKSFKFCW-ALTKNKFNWSAVTPAENPEVTFS---------WDD 341
             P  +       +VI+  F+  W    ++   W    P+    +  +         + +
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 342 KFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIV 401
             VE+ R+ LAAC +FL+Y IY     Q+++        +   G+PND+    + +A+I+
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 402 FIPICEKFFYPFIRRFT-PFRPITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLAD 460
            +PI +    P +RR    F+P+ +I +GF LA  + V   ++Q  IY T P  KH    
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 461 GPNNVHVA----WQVPA-YVLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFG 515
                 V+    W V   YVL   SE FA  TG E A+ ++P  MK+F+M+LFL   A  
Sbjct: 464 SETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALS 523

Query: 516 SAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYE 569
           S +    + +  DP     +   AV    T  A  F +R++N ++  M A   E
Sbjct: 524 SILTQIFNGIMTDPYLVIPFILFAVLG--TLFAILFLYRYWN-LDKVMEAERRE 574

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  206 bits (523), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 162/567 (28%), Positives = 262/567 (46%), Gaps = 46/567 (8%)

Query: 38  DTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFS 97
           + E+ K+    + + E    + E  ++PTE E  TLR +        + I ++E +ER S
Sbjct: 4   EKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGS 63

Query: 98  YYGLSAPFQNY------------MANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVL 145
           +YG      N+             A  P +  PG L      AT +    +F  Y   ++
Sbjct: 64  FYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSII 123

Query: 146 GGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSF--KSIAGKNGALGGFIVALILIGIGT 203
            GY++D   G+   + +G  +  VG  +LFI +     +A  N A    +VAL+ + + T
Sbjct: 124 TGYISDVYIGQIKMLWIGVWLG-VGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCT 182

Query: 204 GFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIAT 263
            F+K  L  L+  Q P K   VKTL SGERVI D D ++Q + M FY  IN+G+   +AT
Sbjct: 183 SFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLAT 242

Query: 264 TELEQHVGFWAAYLLPFCFFWIAVIVL-VLGRRSYTLKPTSDRVIEKSFK-----FCWAL 317
               Q VG+W A+ +P   + +  IVL  L     T +P+ + V+ +S K     + W  
Sbjct: 243 AYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGW 302

Query: 318 TKNKFN---WSAVTPA----------ENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYW 364
            K  ++   W    P              +  F +D+K+V + ++ ++AC +FL+Y IY 
Sbjct: 303 IKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGF-YDEKYVYDTKLTISACTIFLYYVIY- 360

Query: 365 TCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFT-PFRPI 423
             +  +     +    ++  G+PND+F   + I++IV +PI +   YP +RR+   F+P+
Sbjct: 361 QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPV 420

Query: 424 TKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLADGPNNVHVA-----WQVP-AYVLI 477
            +I  GF +         ++Q+ +Y T P         P   H       W V   Y L 
Sbjct: 421 YRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVAIEYALG 480

Query: 478 AFSEIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCG 537
             SE  A  TG E A+ ++P  MK F++ALF+F  A  SAI   ++P  KDP   +L   
Sbjct: 481 GTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDP---YLIQP 537

Query: 538 LAVTAFITGCAFWFCFRHYNDIEDEMN 564
            AV A +           Y D++ +M 
Sbjct: 538 FAVCAGVGALTAIIFLWRYWDLDKQMK 564

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 81/213 (38%), Gaps = 28/213 (13%)

Query: 18  DEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVS 77
            E+N +D   T V S +   D  SY   N +E   +  D+ E     P E   +     +
Sbjct: 5   SEQNVVD--STIVESNN---DVGSYHSDNISETKKDISDFDEAA--APVEIPKKPASAYT 57

Query: 78  GRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTP------SDSPPGVLQLNSDGATGL 131
             +   C ++A       +     +     +MA T       S  P G   ++      L
Sbjct: 58  -SVCIMCLMVAFGGFISGWD----TGTIGGFMAQTDYINRFGSTHPSGTKYMSKVRTGLL 112

Query: 132 SYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGG 191
              F   C I  V  G L D+  GR   I VG  IYIVGI +   +  K           
Sbjct: 113 VSIFNVGCAIGSVFLGRLGDS-IGRRKGIVVGASIYIVGIVIQIASIDKWFQ-------- 163

Query: 192 FIVALILIGIGTGFIKANLSVLIADQIPAKRPR 224
           + +  I+ G+G+G I A LS ++  ++  K  R
Sbjct: 164 YFIGRIIGGLGSGAI-AVLSPMLISEVSPKHLR 195

>Skud_7.628 Chr7 complement(1052224..1054074) [1851 bp, 616 aa] {ON}
           YBR298C (REAL)
          Length = 616

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 22/183 (12%)

Query: 11  EKLSVITDEKNNIDLKKTTVSSEDQILD-------TESYKLQN---DNEFDPEHPDYQEE 60
           E  S IT++KN ++ +      +D   +       T S +L +   DN+ + E  +  ++
Sbjct: 24  ESSSAITNQKNGLNTEDFEEGKKDGAFELDHLEFTTSSARLGDSDGDNDNEIETTNAADD 83

Query: 61  GYEMPTEEELRTLRHVSGRIP---FRCFLIAVVELSERFSYYGLSA-----PFQNYMANT 112
             E  +EE+  TLR    + P       L++   + E +    LSA      FQ    + 
Sbjct: 84  ANEANSEEKSMTLRQALKQYPKAALWSILVSTTLVMEGYDTALLSALYALPVFQRKFGSL 143

Query: 113 PSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIF 172
            SD   G  ++NS    GL+        I   + GY+ +    RY T+    G+    IF
Sbjct: 144 SSD---GTYEINSQWQIGLNMCVLCGEMIGLQITGYMVECMGNRY-TMITALGLLTAYIF 199

Query: 173 VLF 175
           +L+
Sbjct: 200 ILY 202

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 117/335 (34%), Gaps = 77/335 (22%)

Query: 6   NSEEAEKLSVITDE----KNNIDLK-KTTVSSEDQ----ILDTESYKLQNDNEFDPEHPD 56
           + +   +L ++TD+        +L+ K  V+ ED     +   E    +  NE D E  +
Sbjct: 12  HEKAGGRLPLVTDDYMRDGQTRELRMKPPVADEDGAEEVLAADEKAATEATNELDVEE-E 70

Query: 57  YQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLS---APFQNYMANTP 113
           Y + GY                    R +L  +      F  +G +     ++ Y++N  
Sbjct: 71  YPDGGY--------------------RAWLTVLGSFVGIFPIWGTANALGAYEGYISNH- 109

Query: 114 SDSPPGVLQLNSDGATGLSYFFQFW---CYITPVLGGYLADTNWGRYNTIAVGTGIYIVG 170
                   QL S GA  +S+ F      C++  V  G   D N G+   I VG+ +Y+ G
Sbjct: 110 --------QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFG 160

Query: 171 IFVLFITSFKSIAGKNGALGGFIVALIL-IGIGTGFIKANLSVLIADQIPAKRPRVKTLK 229
           IF++          +   L  FI+A  L  G+G G +   L   +A     +R    +L 
Sbjct: 161 IFMM---------SECTKLWHFILAFSLSSGVGAGILTTPLISCVATWFHRRRAVATSLA 211

Query: 230 SGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIV 289
           +    I    I I  +    Y+ I                   WA  +L   F       
Sbjct: 212 TCGGSI--GGIVIPLILRRMYVTIGYK----------------WALKVLALVFLVSLTFA 253

Query: 290 LVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNW 324
             L R   T +P   R    + +F        FNW
Sbjct: 254 AFLARERVTPRPKPFRSHRDTIRF---YLSTSFNW 285

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 10/118 (8%)

Query: 107 NYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGI 166
           +++    + +  GVL L++     L   F   C I  V  G L D  +GR   +  GT I
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDL-YGRRWGLIFGTSI 160

Query: 167 YIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPR 224
           ++VG+ +   +  K           + +  I+ GIG G I A LS ++  ++  K  R
Sbjct: 161 FVVGVIIQIASVSKWFQ--------YFIGRIIAGIGMGVI-AVLSPMLISEVAPKELR 209

>TBLA0A10540 Chr1 (2603824..2605305) [1482 bp, 493 aa] {ON} 
          Length = 493

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 103 APFQNYMANTPSDSPPGVL-------QLNSDGATGLSYFFQ---FWCYITPVLGGYLADT 152
           A F   +A+  +   PGV+       QLN   +  + + F    F C+IT +LGG L D 
Sbjct: 85  ASFIGMVASYGTMYAPGVIENYIKENQLNDTSSFEIGWIFSLYIFICFITFILGGTLFD- 143

Query: 153 NWGRYNTIAVGTGIYIVGIFVL 174
           N+G    I +GT I++  +F L
Sbjct: 144 NFGFKKPILIGTIIHVGSLFSL 165

>KLTH0F14322g Chr6 (1174310..1177012) [2703 bp, 900 aa] {ON} similar
           to uniprot|Q01454 Saccharomyces cerevisiae YPR135W CTF4
           Chromatin-associated protein required for sister
           chromatid cohesion interacts with DNA polymerase alpha
           (Pol1p) and may link DNA synthesis to sister chromatid
           cohesion
          Length = 900

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 184 GKNGALGGFIVALILIGIGTGFIKANLSVLIADQI 218
           GK  A+GG  + LIL+G+  G  K   +V + DQ+
Sbjct: 106 GKTAAVGGDDLELILVGLADGSAKTRTTVTLEDQV 140

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 13/119 (10%)

Query: 89  VVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGY 148
           ++ L + F+YY      QN    T      G    +   AT +  F+ F   +T    G+
Sbjct: 361 IINLFQEFAYY-----MQNTYMLTVLLVAVG---QSKKSATRIIKFYSFVGVLTAFFLGF 412

Query: 149 LADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIK 207
           +          IA+G GI+ V   +L     +   G  GA  G I A+ ++G G GF+K
Sbjct: 413 VVAKVRRTKEFIALGIGIWFVAFGLL-----EHYEGGLGARAGIIAAICILGFGNGFLK 466

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 43/94 (45%), Gaps = 10/94 (10%)

Query: 131 LSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALG 190
           L   F   C I  V  G L DT  GR   I V   IY+VGI V+ I S K          
Sbjct: 99  LVSIFNIGCAIGSVFLGRLGDTI-GRRKGIVVAVSIYMVGI-VIQIASVKKWF------- 149

Query: 191 GFIVALILIGIGTGFIKANLSVLIADQIPAKRPR 224
            +++  I+ G+G G I A LS ++  ++  K  R
Sbjct: 150 QYLIGRIISGLGAGCI-AVLSPMLISEVSPKHLR 182

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 18/109 (16%)

Query: 124 NSDGATGLSY--------FFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLF 175
           +SDG+  LS          F   C I  V+ G L DT  GR   I +   IYIVGI +  
Sbjct: 95  HSDGSKYLSKVRTGLLVSIFNVGCAIGSVVLGRLGDTV-GRRKGIVIAVFIYIVGIVIQI 153

Query: 176 ITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPR 224
            +  K           + +  I+ G+G+G I A LS ++  +I  K  R
Sbjct: 154 ASIDKWYQ--------YFIGRIIAGLGSGTI-AVLSPMLISEISPKHLR 193

>TDEL0B07220 Chr2 complement(1271585..1273306) [1722 bp, 573 aa]
           {ON}  YDR536W
          Length = 573

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 155 GRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSV 212
           GR   I +G+ I IVG  V+  T+F+       ALG F+V  ++ G+GTG   + + V
Sbjct: 103 GRKPLIVIGSVITIVGA-VISTTAFRDY----WALGQFVVGRVITGVGTGLNTSTIPV 155

>AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YHR096C (HXT5) and YDR342C (HXT7)
          Length = 535

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 48/113 (42%), Gaps = 9/113 (7%)

Query: 107 NYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGI 166
           +++A     SP G  +L+ D    +   F   C +  +    + D  +GR   +A  T +
Sbjct: 76  DFIARFGQLSPSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIGDA-YGRKIGLATVTAV 134

Query: 167 YIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIP 219
           Y++GI +    S K           + V  I+ G+G G I     +LI++  P
Sbjct: 135 YVIGIVIQISASDKWYQ--------YFVGRIISGLGVGGIAVLSPMLISETSP 179

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 5/72 (6%)

Query: 501 KSFIMALFLFMNAFGSAIG---CALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYN 557
           K+ I  +   M+  G+ +G     LS      ++ W +   A+ AF+ G   WFC    N
Sbjct: 251 KNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIP--N 308

Query: 558 DIEDEMNALNYE 569
           DIE     L  +
Sbjct: 309 DIEKNPQGLKMD 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,563,953
Number of extensions: 3041920
Number of successful extensions: 13658
Number of sequences better than 10.0: 66
Number of HSP's gapped: 14061
Number of HSP's successfully gapped: 66
Length of query: 596
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 481
Effective length of database: 40,294,809
Effective search space: 19381803129
Effective search space used: 19381803129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)