Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H002105.702ON1454144163360.0
SAKL0E14916g5.702ON177910866401e-66
Suva_11.3315.702ON189810166312e-65
ZYRO0G06600g5.702ON182011876204e-64
TDEL0B021905.702ON181011376097e-63
Skud_11.3345.702ON188510826098e-63
YKR095W (MLP1)5.702ON187510596034e-62
Ecym_40185.702ON176911875882e-60
Smik_11.3585.702ON187810195793e-59
AFR286W5.702ON175811725481e-55
NCAS0A032005.702ON178810605033e-50
KLTH0E01056g5.702ON17717124998e-50
KLLA0A00594g5.702ON17489754773e-47
Kwal_55.196975.702ON176010564651e-45
CAGL0G02497g5.702ON17809154497e-44
NDAI0E050405.702ON19736404076e-39
Suva_9.395.702ON16827893558e-33
Skud_9.195.702ON16809743503e-32
Smik_9.205.702ON16829513396e-31
TBLA0E017305.702ON18206273379e-31
YIL149C (MLP2)5.702ON16797513299e-30
NDAI0F002905.702ON15543622842e-24
Kpol_1043.705.702ON13214562724e-23
KAFR0D022205.702ON16744662572e-21
KNAG0C065905.702ON16517732563e-21
KNAG0L021405.702ON16081892214e-17
NCAS0G002305.702ON17356432152e-16
TPHA0E002305.702ON12846311481e-08
TPHA0D046105.702ON11831321428e-08
SAKL0F04466g7.156ON58279830.51
KNAG0H021602.267ON56277801.3
NCAS0E011003.438ON110864801.5
Skud_14.2842.267ON65688791.6
Smik_16.1268.599ON1216110791.7
YGR097W (ASK10)3.438ON114697791.8
TPHA0J003806.26ON356120753.8
Smik_6.1833.438ON114639764.2
AGR236W7.186ON117054755.5
ZYRO0B13838g4.309ON68437746.0
Smik_4.5345.296ON876119746.4
Suva_2.4515.296ON87789746.6
ZYRO0C12606g3.438ON113089746.9
Suva_10.364.18ON504179737.4
Suva_7.3803.438ON114439747.4
TBLA0H003802.426ON7247667.5
YDR285W (ZIP1)5.296ON87589738.3
KNAG0A077403.455ON119767738.9
Kwal_23.38643.393ON42372729.2
Smik_8.1575.369ON9161669.7
NOTE: 1 genes in the same pillar as KAFR0H00210 were not hit in these BLAST results
LIST: Kpol_2001.75

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00210
         (1454 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...  2445   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   251   1e-66
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   247   2e-65
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   243   4e-64
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   239   7e-63
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   239   8e-63
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   236   4e-62
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   231   2e-60
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   227   3e-59
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   215   1e-55
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   198   3e-50
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   196   8e-50
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   188   3e-47
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   183   1e-45
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   177   7e-44
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   161   6e-39
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   141   8e-33
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   139   3e-32
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   135   6e-31
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   134   9e-31
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   131   9e-30
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   114   2e-24
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   109   4e-23
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   103   2e-21
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   103   3e-21
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    90   4e-17
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    87   2e-16
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    62   1e-08
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    59   8e-08
SAKL0F04466g Chr6 complement(358639..360387) [1749 bp, 582 aa] {...    37   0.51 
KNAG0H02160 Chr8 (388161..389849) [1689 bp, 562 aa] {ON} Anc_2.2...    35   1.3  
NCAS0E01100 Chr5 complement(206838..210164) [3327 bp, 1108 aa] {...    35   1.5  
Skud_14.284 Chr14 complement(523897..525867) [1971 bp, 656 aa] {...    35   1.6  
Smik_16.126 Chr16 complement(224488..228138) [3651 bp, 1216 aa] ...    35   1.7  
YGR097W Chr7 (678695..682135) [3441 bp, 1146 aa] {ON}  ASK10Comp...    35   1.8  
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...    33   3.8  
Smik_6.183 Chr6 (302111..305551) [3441 bp, 1146 aa] {ON} YGR097W...    34   4.2  
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    33   5.5  
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    33   6.0  
Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W ...    33   6.4  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    33   6.6  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    33   6.9  
Suva_10.36 Chr10 complement(71147..72661) [1515 bp, 504 aa] {ON}...    33   7.4  
Suva_7.380 Chr7 (654400..657834) [3435 bp, 1144 aa] {ON} YGR097W...    33   7.4  
TBLA0H00380 Chr8 complement(73665..73883) [219 bp, 72 aa] {ON} A...    30   7.5  
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    33   8.3  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...    33   8.9  
Kwal_23.3864 s23 (465097..466368) [1272 bp, 423 aa] {ON} YBR130C...    32   9.2  
Smik_8.157 Chr8 complement(238878..239039,239120..239230) [273 b...    30   9.7  

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score = 2445 bits (6336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1270/1441 (88%), Positives = 1270/1441 (88%)

Query: 1    MEASQELDAASSISNFLSIPKDQISKLDTDVIDALSKKSEEYNXXXXXXXXXXXXXXXXX 60
            MEASQELDAASSISNFLSIPKDQISKLDTDVIDALSKKSEEYN                 
Sbjct: 1    MEASQELDAASSISNFLSIPKDQISKLDTDVIDALSKKSEEYNSLKESSLGLSSSISELS 60

Query: 61   XXXQKEKLASQXXXXXXXXXXXXRINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSK 120
               QKEKLASQ            RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSK
Sbjct: 61   KTLQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSK 120

Query: 121  DEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAID 180
            DEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAID
Sbjct: 121  DEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAID 180

Query: 181  NELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQ 240
            NELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQ
Sbjct: 181  NELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQ 240

Query: 241  NQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQ 300
            NQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQ
Sbjct: 241  NQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQ 300

Query: 301  NIPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNM 360
            NIP         HASGRNNSALSLSGDVNILRKHF                ILQELERNM
Sbjct: 301  NIPEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNM 360

Query: 361  PSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRT 420
            PSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRT
Sbjct: 361  PSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRT 420

Query: 421  VLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNV 480
            VLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNV
Sbjct: 421  VLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNV 480

Query: 481  KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540
            KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ
Sbjct: 481  KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540

Query: 541  IKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEI 600
            IKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEI
Sbjct: 541  IKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEI 600

Query: 601  ENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKE 660
            ENLHQANTDVNISLDKEKSARKLAEDRYNLLEY                      ILDKE
Sbjct: 601  ENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKE 660

Query: 661  KQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVT 720
            KQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVT
Sbjct: 661  KQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVT 720

Query: 721  QMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYK 780
            QMNSLNNELQTLLKETKSGYDDKLKISALKC            RMSELKSQNDSEIKWYK
Sbjct: 721  QMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYK 780

Query: 781  ATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSKDVSEEKRALEKELSEV 840
            ATIDDLKANVF               FSKTLENVQNELTLANSKDVSEEKRALEKELSEV
Sbjct: 781  ATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNELTLANSKDVSEEKRALEKELSEV 840

Query: 841  KSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTL 900
            KSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTL
Sbjct: 841  KSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTL 900

Query: 901  QARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSY 960
            QARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSY
Sbjct: 901  QARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSY 960

Query: 961  ERIMQENSELSKVVELLREEVKNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQIT 1020
            ERIMQENSELSKVVELLREEVKNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQIT
Sbjct: 961  ERIMQENSELSKVVELLREEVKNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQIT 1020

Query: 1021 XXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAA 1080
                                  QDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAA
Sbjct: 1021 NLNERLSELLEENESLLARLESQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAA 1080

Query: 1081 QKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQREEKN 1140
            QKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQREEKN
Sbjct: 1081 QKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQREEKN 1140

Query: 1141 KDALGTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKS 1200
            KDALGTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKS
Sbjct: 1141 KDALGTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKS 1200

Query: 1201 SLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKS 1260
            SLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKS
Sbjct: 1201 SLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKS 1260

Query: 1261 ELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEG 1320
            ELESSFEQKIKEEAKSLLLHS              SGRETLQQEFDEQLNIVRKKAFEEG
Sbjct: 1261 ELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEG 1320

Query: 1321 KQHVLMKSAFLERKISMLEGQXXXXXXXXXXXXXXXXXVSSTDEHNSSIQGNPFFNLGKE 1380
            KQHVLMKSAFLERKISMLEGQ                 VSSTDEHNSSIQGNPFFNLGKE
Sbjct: 1321 KQHVLMKSAFLERKISMLEGQLKEKNKLNNNSKNLKENVSSTDEHNSSIQGNPFFNLGKE 1380

Query: 1381 QMNVPRFXXXXXXXXXXXXLNPFTSFEQAETKTHEEHLPPHIATMVDTDDQDDQKRPFDE 1440
            QMNVPRF            LNPFTSFEQAETKTHEEHLPPHIATMVDTDDQDDQKRPFDE
Sbjct: 1381 QMNVPRFTSESSTMSTTSSLNPFTSFEQAETKTHEEHLPPHIATMVDTDDQDDQKRPFDE 1440

Query: 1441 A 1441
            A
Sbjct: 1441 A 1441

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  251 bits (640), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 273/1086 (25%), Positives = 515/1086 (47%), Gaps = 41/1086 (3%)

Query: 93   ADLNKVVEENKNLYENSHKLTK-------EIETSKDEKLLLRTQLDKVTFTLSLTMKQKQ 145
             DL    +E K L +N+  L K       E++T K   L  + ++ ++T  ++L     Q
Sbjct: 150  GDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQ 209

Query: 146  HTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLR 205
              E E  SK + F SY+ R   E Q  +  L +I +EL +    +  L  R  +LS+ L+
Sbjct: 210  WLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLKSRANDLSQQLQ 269

Query: 206  GKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQK 265
             K++E+KSL +S      +F  E  L+ +LI+ L+ QI++ + +LES  ++   +     
Sbjct: 270  DKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVD 329

Query: 266  LDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHAS--GRNNSALS 323
             ++ +++ ++    +KLEISE + + L  +++E  +             S   +N+    
Sbjct: 330  AEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAGNTSKVSLDSKNSIVPK 389

Query: 324  LSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNIL 383
            L GD+ +L+K                   + ELE  +P L+S+KER+  LEKEL+   ++
Sbjct: 390  LHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALM 449

Query: 384  LEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSL 443
            LE   K+  +K  EL   +S+ ++  + I+SL  QR+ LA QV++LL+ +         L
Sbjct: 450  LEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPL 509

Query: 444  GRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEK 503
              ++   + + + ++ +    D+++I+ ERL +F+++ ELQ +NM+LL   R LA K E 
Sbjct: 510  TPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEA 569

Query: 504  LEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQKKEKTEKESISA 563
             EK +  +    E ET+ +AKEAIL LQEY++ LESQ++ ++ E    K   ++K + + 
Sbjct: 570  EEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNG 629

Query: 564  MSKIEDDASSHTI-------DLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDK 616
             S +    + H +       +L   LS+  + S   I  LN EI +L++A  D +++L+K
Sbjct: 630  PSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEK 689

Query: 617  EKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSK 676
            E+S+R LAEDR  L+                        IL ++ +   +    ISCKS+
Sbjct: 690  ERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQ 749

Query: 677  LSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKET 736
            LS  ++++ + ++E +L    Q  L+ + E+L  ERNN+R+ +TQ+ +L  E ++LL+ET
Sbjct: 750  LSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEET 809

Query: 737  KSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANVFXXXXX 796
            +  +  K      +              +S+  S  DS+ KWY+   D L   +      
Sbjct: 810  QKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREK 869

Query: 797  XXXXXXXXXXFSKTLENVQNEL-----------TLANSKDVSEEKRALEKELSEVKSQLE 845
                          +E++ N+L            L  S+ V  +   L +EL + + +L 
Sbjct: 870  LSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLA 929

Query: 846  KSNLEVKEYENVISTS-------KRSFENKSIQYEDRIKALASKLDSELRERTTLQENLS 898
             +  +V++Y+++  +S       K + E    +Y ++I+ L  + D    +   L++ +S
Sbjct: 930  DAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQIS 989

Query: 899  TLQARMVVQQDELTSN----NNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYD 954
             L   +  Q+ +  S        L +L+     L   +  ++ K ++++  +  +T   +
Sbjct: 990  NLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYAN 1049

Query: 955  SLSKSYERIMQENSELSKVVELLREEVKNRTSNGEK-EGDLEDTESIIKKGQDVWDEEKK 1013
            +  K+YE+ +Q+++++SK + LLR E +   S  E      E+ +  +++ +  W+++  
Sbjct: 1050 TAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSS 1109

Query: 1014 VFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETNAAGNE--ETLAALRSERT 1071
             +E ++                         KG  + S +      E    L +LR E+ 
Sbjct: 1110 DYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKD 1169

Query: 1072 SLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVH 1131
             L  KL  + +EE+ +R KL+  E  L  +  EL K++      S+  +++ +I+  L  
Sbjct: 1170 ILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQ 1229

Query: 1132 LKEQRE 1137
            L   RE
Sbjct: 1230 LNLLRE 1235

 Score = 99.4 bits (246), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 102/169 (60%), Gaps = 17/169 (10%)

Query: 1190 EMKDNFEKEKSSLLSQQEQEIEK------------LTDNERKLREFYEEEIQKKVSQAEE 1237
            E+++ FE+EK+S+L  +EQE+ +            + + ++K  E YE++  +++ ++ E
Sbjct: 1506 ELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNE 1565

Query: 1238 NLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXXSG 1297
             LKKRIRLPTEEKIN I+EK++ ELE+ FE  ++++A+ +                    
Sbjct: 1566 QLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQ 1625

Query: 1298 -----RETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
                 ++ +Q++FDE +  ++K+AFEEGKQ   MKS FLE+KI+ LE Q
Sbjct: 1626 DLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQ 1674

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  247 bits (631), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 267/1016 (26%), Positives = 492/1016 (48%), Gaps = 84/1016 (8%)

Query: 127  RTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMT 186
            ++QL++ T  L+L    K   E E  SK + + SY+ +       +  +L  I N+ ++ 
Sbjct: 194  KSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLE 253

Query: 187  NGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTL 246
               N  L ++N ELSKDL+ K+ +IK+L +S  +   DF +E  L+ +LI+ L++Q+  +
Sbjct: 254  KTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAV 313

Query: 247  QEQLESLSDEKFDDPGT----QKLDKHE-LLRQIKNLNEKLEISERERLSLVHSMEEFQN 301
            +E+L +  +  + D  +    Q + ++E LL+ ++    KL   E E L L    EE   
Sbjct: 314  KEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEE--- 370

Query: 302  IPXXXXXXXXXHASGRNNSALS--LSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERN 359
                         +G+ +  L+   +GD  +L+K                   + ELE  
Sbjct: 371  -------------AGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHK 417

Query: 360  MPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQR 419
            +P ++S+KER+  LE ELN++ +LLEH   E   K  EL+ K  + +  +  I+ L+ QR
Sbjct: 418  VPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQR 477

Query: 420  TVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAA-NTAEAMSDSEKILLERLAQFK 478
              L RQ++YLL+    +      L +++++ +   L   ++A   SDS+KI+ ERL +F+
Sbjct: 478  LDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFR 537

Query: 479  NVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLE 538
            ++ +LQ +N +LL+V+R LA K E  E  +   + + E+ETIN+AKEAIL LQ    +LE
Sbjct: 538  DIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLE 597

Query: 539  SQIKELSDELAVQKKEKTEKES------ISAMSKIEDDASSHTIDLGKQLSANLKHSKDI 592
            S+I EL  E    K    ++E+      I  +++ + +  S T DL  ++S   + S + 
Sbjct: 598  SKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTEN 657

Query: 593  IDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXX 652
            +  LN E+++L+ + + ++I L +EKS+R LAE+R+ LL                     
Sbjct: 658  MSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINL 717

Query: 653  XXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNER 712
               I  ++ +   +  DY+SCKSKLS  E E+++L+ E  L IE +  L+ +   L +E+
Sbjct: 718  QNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEK 777

Query: 713  NNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXX--XXXXXXXXXRMSELKS 770
             +L + VTQ+ +L  E + LL ETK    +  KI AL+                + +L+ 
Sbjct: 778  TSLHIMVTQLQTLQKERENLLDETKKSCQN--KIDALQNAQNELKTEAIRKDQYIKQLEE 835

Query: 771  QNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNE-------LTLANS 823
             NDS+I+WY+  I+ L+ +                 F   +++++ E       L   N 
Sbjct: 836  DNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNV 895

Query: 824  KDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKL 883
             D S    +L +EL + K  L  +  +++EY+ +  T+ +S +  S Q ++  KA ++++
Sbjct: 896  LDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQI 955

Query: 884  DSELRERTTLQENLSTLQARMVVQQDE---------------------LTSNNNTLSELR 922
             +   E+T+L++ +S L+ +M    +E                     L +NN  +  ++
Sbjct: 956  QNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVK 1015

Query: 923  VSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVK 982
              Y+S L          ++++  +  +T   ++   +YE+ +Q+++++SK +  LRE++ 
Sbjct: 1016 TEYESKL----------SKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQL- 1064

Query: 983  NRTSNGEKE------GDLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXX 1036
              T  G+ E      G  E     +K+ +  W+ +K+    Q+                 
Sbjct: 1065 -HTYKGQVETLNLARGQFEKA---LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLL 1120

Query: 1037 XXXXXXQDKGNNSPS-AETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKL 1091
                       N P+ A++ +  N + L  LR ER  L  K+  A+++ + +R K+
Sbjct: 1121 YDQIELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKI 1176

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 105/259 (40%), Gaps = 70/259 (27%)

Query: 1224 YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSF----------------- 1266
            + EE+ KK+ +AEE LKKRIRLPTEEKI+ IIE++K +LE  F                 
Sbjct: 1520 HNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKM 1579

Query: 1267 --------EQKIKEEAKSLL-------------LHSXXXXXXXXXXXXXXSGRETLQQEF 1305
                    E +I+E+ K L              L S                   L++EF
Sbjct: 1580 EDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEF 1639

Query: 1306 DEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQXXXXXXXXXXXXXXXXXVSSTDEH 1365
            + +L  ++KK+FEEGKQ  +MK+  LERK++ +E Q                 V S  +H
Sbjct: 1640 NHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ----------LSETKQSVDSPPKH 1689

Query: 1366 NSSIQGNPFFNLGK---EQMNVP--------RFXXXXXXXXXXXXLNPFTSFE------- 1407
             S +  NP   L +   E  N P        +              NPFTS         
Sbjct: 1690 LSKM-PNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKPLQG 1748

Query: 1408 ---QAETKTHEEHLPPHIA 1423
               + E  ++E   P H+A
Sbjct: 1749 DEAEREPSSNETEPPTHLA 1767

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  243 bits (620), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 302/1187 (25%), Positives = 558/1187 (47%), Gaps = 91/1187 (7%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I ++++ + +  K ++++K L +   +L   ++  K ++L  ++++  +T  L++  K 
Sbjct: 153  KIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKN 212

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
             Q  E E  SK +   S + + + E   +     +  NEL++   +N  +  +NEEL+K 
Sbjct: 213  SQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKS 272

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDE---KFDD 260
            L+ K+ E+K L +SL     +F  E  ++ +LI+ L+NQ+K+LQ +L +  D+   +   
Sbjct: 273  LQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLA 332

Query: 261  PGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASG---- 316
             G +  +  +L++++  L E  E SERERL L   ++E   IP         + S     
Sbjct: 333  SGERNTENEKLIQELITLKENFEESERERLRLEALVQEL--IPGDDSQDDINNTSSFISL 390

Query: 317  RN-NSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEK 375
            RN +S+L    D+ IL+K                   + ELE  +P ++S+KER++ LEK
Sbjct: 391  RNKDSSLR---DMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEK 447

Query: 376  ELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQN 435
            ELN   +LL+H   E   +  E E    +  +  SSI++L  QRT LA QV++LL+ I  
Sbjct: 448  ELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISV 507

Query: 436  NETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSR 495
                G  L  +++  + + +  +   + SDS++++ ERL +F N+  LQ +NM+LL+  R
Sbjct: 508  QVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVR 567

Query: 496  ELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDEL----AVQ 551
            +LA K E  EK   K+I + E++TI +AKEAI+ LQ+Y+  LES+++ L+ E     A+ 
Sbjct: 568  KLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFKAIC 627

Query: 552  KKEKTEKE-SISAMSKIEDDASSHTIDLGKQLSANLK----HSKDIIDALNSEIENLHQA 606
             +  +++  S+SA     +   S   +  + L A L      S      LN+EI  L+++
Sbjct: 628  SRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIHELYRS 687

Query: 607  NTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYS 666
             T ++I L+KE+S++ L E+R  L+++                         ++ + + +
Sbjct: 688  KTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQDSRTAET 747

Query: 667  SRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLN---ERNNLRMTVTQMN 723
              + I+C SKL+  E ++ +L  E EL    Q++ RT +E  L    ERN+LR+ V+Q+ 
Sbjct: 748  VNELIACNSKLAVLETKVANLETEKEL---LQSSERTSRENYLKLSEERNSLRIMVSQLQ 804

Query: 724  SLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATI 783
            +L +E +  LKE ++ Y + L     +                ++++   ++I+WY+  +
Sbjct: 805  TLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKL 864

Query: 784  D-----------DLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSKDVSEEKRA 832
            D           +L+   F                 ++   +Q+   L+ S+  +  + +
Sbjct: 865  DSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESS 924

Query: 833  LEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTT 892
            L KEL + K  L  +  E+ +Y+N++ST++ S    +  Y    + L  ++++   E++ 
Sbjct: 925  LRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKSQ 984

Query: 893  LQENLSTLQARMVVQQDELTSNN-------NTLS--------------ELRVSYDSLLLE 931
            LQ+ ++ L   +   ++ L   N       NTL               +L+  YD+ +L 
Sbjct: 985  LQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQIL- 1043

Query: 932  QKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEV-KNRTSNGEK 990
                     +L+  +  +    +   ++YE  +Q++S +SK +  LRE+  K+R +    
Sbjct: 1044 ---------KLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRL 1094

Query: 991  EGDLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNNSP 1050
            +   E    ++++ +  W  +K+ +E Q+                         K +NS 
Sbjct: 1095 KNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSK-DNSD 1153

Query: 1051 SAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKS 1110
                  A   E L  LR ER  L  KLT +Q+EE+++R  L   E+ L     +L + + 
Sbjct: 1154 GVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQK 1213

Query: 1111 QIFELSSLPQNEHDILRHLVHLKEQREEKNKDALGTNKYMEQPNKVTTEAQ-------EK 1163
            +I   S L      I+  L  L   RE      +      E+ NK   E Q       E+
Sbjct: 1214 EITTHSELIGQHEKIIEQLNQLNLLRESN----ITLRNAAEEENKKNRELQEELNQLRER 1269

Query: 1164 IQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEI 1210
            I  LE +LN    L T+ LE D  +     N  KE+++   ++ QEI
Sbjct: 1270 ILPLESELN---TLHTSVLEKDQQL-----NLYKEEANRWKERSQEI 1308

 Score = 83.6 bits (205), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 74/117 (63%), Gaps = 6/117 (5%)

Query: 1225 EEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXX 1284
            EE I K++++AEENLKKRIRLPTEE+I  ++EK+K+ LE  +++K++E   SL       
Sbjct: 1538 EESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNN 1597

Query: 1285 XXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
                            LQ++F+ ++  V+KKAFEEGKQ   MKS  LERKIS LE Q
Sbjct: 1598 SDLKKQLEKD------LQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQ 1648

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  239 bits (609), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 295/1137 (25%), Positives = 529/1137 (46%), Gaps = 82/1137 (7%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I++++  K +  ++V +NKNL +   +   E++T K   L  +++L+ V   + +  K 
Sbjct: 149  KISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKS 208

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
             +  E E  SK +    Y+   + E Q  ++ +  + N+ ++       L K+N+E+S+D
Sbjct: 209  NEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQD 268

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
            L+ K+ EIK L + L T   +F  E  L+ +L++    Q+++ +E+L  L++EK +    
Sbjct: 269  LQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELR-LTEEKHNSTEA 327

Query: 264  QKLDKHELLRQIKNL---NEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASGRNNS 320
              L   +  R + +L    ++LE S  ERL L   + E                S  N S
Sbjct: 328  DNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG-----DSEEFDLDSTANVS 382

Query: 321  ALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSS 380
               L GD+ +L+K                   + ELE  +P ++S KERS  LEKEL+  
Sbjct: 383  IPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDI 442

Query: 381  NILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLL--IIQNNET 438
             +LLEH   E   K+ ELE    +   L  + ++L  QR+ LARQV++LL    +QN+  
Sbjct: 443  ALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSR 502

Query: 439  LGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELA 498
                L   ++  + + +        SDS+ I+ ERL +FK++  LQ RN +LL+ +R LA
Sbjct: 503  --GPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLA 560

Query: 499  SKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELS------------- 545
             + E+ EK +  +I S E +TI++AKEAI+ LQE + ++ES++  +              
Sbjct: 561  DRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQT 620

Query: 546  ----DELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIE 601
                D L    + K  +E+   +  +ED  S+ T +  K             + LN EI 
Sbjct: 621  SQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKN-----------NELLNQEIR 669

Query: 602  NLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEK 661
            NL+Q+ T + IS +KE+S+R LAEDR  LL+                       +  +E 
Sbjct: 670  NLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEA 729

Query: 662  QFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQ 721
            +   +   YISC+SKLS  EA   +L AE  L   +  +LR + + +  ERN+L + VTQ
Sbjct: 730  RNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQ 789

Query: 722  MNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQND---SEIKW 778
            + +L +E + LLKE+++ +  K  I+ L+             + +E+K+  D   ++ KW
Sbjct: 790  LQTLQSERENLLKESQASH--KAAIAQLEV-QTSELKTEISSKDNEIKASEDAKRAQTKW 846

Query: 779  YKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSKDVS----EEKRALE 834
            ++  ID++ ++                     + +++ ++  ++S+  S     +    E
Sbjct: 847  FQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGE 906

Query: 835  KELSEVKSQLEKSNLEVK-------EYENVISTSKRSFENKSIQYEDRIKALASKLDSEL 887
                +++  LEK+ +E+K       E++ + ST++ + +N S ++E+R +AL S  +  L
Sbjct: 907  TTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYL 966

Query: 888  RERTTLQENLSTLQARMVVQQDELTSNNN-----------TLSELRVSYDSLLLEQKTFK 936
             E+  L++ +S L+  +    +E     N            L  L  S  SL   +K + 
Sbjct: 967  AEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYD 1026

Query: 937  DKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVK-NRTSNGEKEGDLE 995
             K  +L+  +  +T   +   K+YE  +Q+++E+SK++  LR EV+  R+   + +   +
Sbjct: 1027 QKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQ 1086

Query: 996  DTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETN 1055
              + +++ G+  W  +K   +  I                         K       +  
Sbjct: 1087 QAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKL- 1145

Query: 1056 AAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFEL 1115
              G+ E L +LR ER  L  KLT +++EE+ +  K    E  L+E   +L K++      
Sbjct: 1146 LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNH 1205

Query: 1116 SSLPQNEHDILRHLVHLKEQREEKNKDALGTNKYMEQPNKVTTEAQEKIQDLEEQLN 1172
            S + +   DI+  L  +   RE        +N  +   N V   AQEK  DL+ +LN
Sbjct: 1206 SDIAKQHEDIMEQLNQMNLLRE--------SNVTLR--NAVNA-AQEKNSDLQSELN 1251

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 90/163 (55%), Gaps = 18/163 (11%)

Query: 1188 VQEMKDNFEKEKSSLLSQQEQEIEKLTDNE-----RKLREFYEEEIQKKVSQAEENLKKR 1242
             +E    FE+EK+ L S+     E ++  +     ++  E YE   Q+++ +AEENLKKR
Sbjct: 1485 TEEYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKR 1544

Query: 1243 IRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXXSGRETLQ 1302
            IR+PTEE+I  +++KRK+ELE  F++++KE                         ++ L+
Sbjct: 1545 IRMPTEERIKKVLDKRKTELEEEFQRRLKE---------NNLQPEGGDAKEREELKKQLE 1595

Query: 1303 QEFD----EQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
             EF+    E L   +KKAFEEGKQ   MKS  LERKIS LE Q
Sbjct: 1596 SEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQ 1638

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  239 bits (609), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 283/1082 (26%), Positives = 515/1082 (47%), Gaps = 61/1082 (5%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            R+ +++  K + N+   E +NL     +L  + +T     L  R++L++ T  L+L    
Sbjct: 151  RLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSN 210

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
            K   E E  SK + + SY+ R +     +   L  + N+ ++    N  L ++N ELS  
Sbjct: 211  KDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNS 270

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESL-----SDEKF 258
            L+ K+ ++K+L +SL T   +F +E  L+ +LI+ L+ Q+  ++E+L+S+     S+   
Sbjct: 271  LQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTS 330

Query: 259  DDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASGRN 318
            DD      +   LL+ ++   EKL   E E L L    EE                +G  
Sbjct: 331  DDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEE----------------TGEE 374

Query: 319  NSALS--LSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKE 376
            +  L+   S D  +L+K +                 + ELE  +P ++S+KER+  LE E
Sbjct: 375  SGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENE 434

Query: 377  LNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNN 436
            LN+S +LLEH   E   K  EL  K  + +   + I+ L  QR  L RQV+YLL+    +
Sbjct: 435  LNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVS 494

Query: 437  ETLGSSLGRKDLELLGQYLAA-NTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSR 495
                  L +++++ +   L   N+    SDS+KIL  RL +F+NV ELQ +N +LL+++R
Sbjct: 495  NDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITR 554

Query: 496  ELASKAEKLE---KVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQK 552
             LA K E  E   K NL +I   E++TIN+AKEAIL LQ     LES+++EL  E    K
Sbjct: 555  NLADKLESNEIKSKQNLLKI---ENKTINEAKEAILSLQSEKMSLESKVEELERERETLK 611

Query: 553  KEKTEKES------ISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQA 606
               +++ S      I  ++K + +  S   DL  ++S   + S   +  LN EI++++ +
Sbjct: 612  SSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDS 671

Query: 607  NTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYS 666
             +D++I L KEKS+R LAE+R+ LL                        I  ++ +   +
Sbjct: 672  KSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHET 731

Query: 667  SRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLN 726
              +YISCKSKLS  E  +++L+ E +L I+++ +L+ + + L +E+ +LR+ VTQ+ +L 
Sbjct: 732  LNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQ 791

Query: 727  NELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDL 786
             E + LL E +    +K+                    + +L+  N S+I+WY+  I+ L
Sbjct: 792  KEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETL 851

Query: 787  KAN-------VFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSKDVSEEKRALEKELSE 839
            K +       V                  K +E  +  L   N  D +    +L KEL  
Sbjct: 852  KKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKELEM 911

Query: 840  VKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLST 899
             K  L ++  +++EY+ +  ++ +S    + + ++  +A ++++ S   E+  L++ +S 
Sbjct: 912  SKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSL 971

Query: 900  LQARMVVQQDELTSNNNTLSELRVSYDSLLL-------EQKTFK----DKEAELRSVIAV 948
            L+ +     +EL    N + + +V +  ++        E +T K     K ++++  +  
Sbjct: 972  LKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQ 1031

Query: 949  KTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEKEG---DLEDTESIIKKGQ 1005
            +T   ++   +YE+ +Q+++++SK +  LRE++   T  G+ +       + E+I+K+ +
Sbjct: 1032 QTIYANTAQNNYEQELQKHADVSKTISELREQL--HTYRGQVKTLTLSRSELENILKENE 1089

Query: 1006 DVWDEEKKVFEVQIT-XXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETNAAGNEETLA 1064
              W  +K+    Q+                           GN    A      N + L 
Sbjct: 1090 KSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTLNNDILV 1149

Query: 1065 ALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHD 1124
             LR ER  L  K+T A+++ + +R K+   +  L +   +L   + +  E SS+ Q +HD
Sbjct: 1150 TLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIVQ-QHD 1208

Query: 1125 IL 1126
            ++
Sbjct: 1209 VI 1210

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 95/244 (38%), Gaps = 70/244 (28%)

Query: 1239 LKKRIRLPTEEKINGIIEKRKSELESSF----EQKIK-----EEAKSLLLHSXXXXXXXX 1289
            LKKRIRLPTEEKI+ IIE++K +LE  F    E+K+K     E+ +++L           
Sbjct: 1529 LKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEK 1588

Query: 1290 XXXXXXSGRETLQQ-----------------------------EFDEQLNIVRKKAFEEG 1320
                     E LQ+                             E +++L  V+KK+FEEG
Sbjct: 1589 QKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEG 1648

Query: 1321 KQHVLMKSAFLERKISMLEGQXXXXXXXXXXXXXXXXXVSSTDEHNSSIQGNPFFNLGK- 1379
            KQ   MK+  LERK++ +E Q                   S  +H +++  NP   L + 
Sbjct: 1649 KQQATMKTTLLERKLAKMESQ----------LSEIKQSAESPPKHANNV-PNPLLGLPRK 1697

Query: 1380 --EQMNVP--------RFXXXXXXXXXXXXLNPFTSFE----------QAETKTHEEHLP 1419
              E  N P        +              NPFTS            Q ET  ++   P
Sbjct: 1698 IEENSNSPFNTLLSGEKLLKFNSKSSSSGAFNPFTSPSPKKLLQKDDVQKETSNNKTDPP 1757

Query: 1420 PHIA 1423
             H+A
Sbjct: 1758 THLA 1761

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  236 bits (603), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 284/1059 (26%), Positives = 500/1059 (47%), Gaps = 79/1059 (7%)

Query: 127  RTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMT 186
            RT+L++ T  L+L        E E  SK + + SY+ + +    ++   L  + N+ +M 
Sbjct: 194  RTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQME 253

Query: 187  NGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTL 246
               N  L ++N ELSK L+ K+ EIK L +SL +   +F +E  L+ +L++ L++Q+  +
Sbjct: 254  RTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAV 313

Query: 247  QEQLES---LSDEKF--DDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQN 301
            +E+L S   L+  K   DD   Q  +  +LL++++   EKL   E+E L L    +E   
Sbjct: 314  KEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDE--- 370

Query: 302  IPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMP 361
                            N SA S S D   L+K                   + ELE  +P
Sbjct: 371  ----------ADEDNENLSAKS-SSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVP 419

Query: 362  SLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTV 421
             ++S+KER+  LE ELN++ +LLEH   E   K  EL  K  +     + + +L  QR  
Sbjct: 420  IINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLD 479

Query: 422  LARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAM-SDSEKILLERLAQFKNV 480
            L RQ++YLL+    +      L +++++ +   +  + +    SDS+K++ ERL +FKN+
Sbjct: 480  LCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNI 539

Query: 481  KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540
             +LQ +N +LL+V R LA K E  EK + + +   E ET+N+AKEAI+ L+     LES+
Sbjct: 540  IQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESR 599

Query: 541  IKELSDELAVQKKEKTEKE------SISAMSKIEDDASSHTIDLGKQLSANLKHSKDIID 594
            I+EL  EL   K     ++      +I  +++ + D  S   DL  ++S   + S + + 
Sbjct: 600  IEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMS 659

Query: 595  ALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXX 654
             LN EI++L+ + +D++I L KEKS+R LAE+R+ LL                       
Sbjct: 660  LLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQN 719

Query: 655  XILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNN 714
             IL ++ +   +  +Y+SCKSKLS  E E+ +L+ E +L +  +  L+ +   L  E+++
Sbjct: 720  TILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDS 779

Query: 715  LRMTVTQMNSLNNELQTLLKETKSGYDDKL-----KISALKCXXXXXXXXXXXXRMSELK 769
            LR+ VTQ+ +L  E + LL+ET+     K+      +S LK              + +L+
Sbjct: 780  LRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELK-----KETSQKDHHIKQLE 834

Query: 770  SQNDSEIKWYKATIDDLK-------ANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLAN 822
              N+S I+WY+  I+ LK        +V                  K +E  +  L   N
Sbjct: 835  EDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYN 894

Query: 823  SKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASK 882
              D +    +L KEL + K  L  +  ++KEY+++  T+ +S +  + + ++  K   ++
Sbjct: 895  VMDETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQ 954

Query: 883  LDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAEL 942
            + +   E+T+L++ +S L+ +M           N  +EL +    +  E+  FK + + L
Sbjct: 955  IKNLTDEKTSLEDKISLLKEQMF----------NLNNELDLQKKGMEKEKADFKKRISIL 1004

Query: 943  RS----VIAVKTGNYDSLSK-----------------SYERIMQENSELSKVVELLREEV 981
            ++    V AVK+     LSK                 +YE+ +Q+++++SK +  LRE++
Sbjct: 1005 QNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQL 1064

Query: 982  KNRTSNGE-KEGDL--EDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXX 1038
               T  G+ K  +L  +  E+ +K+ +  W  +K+    Q+                   
Sbjct: 1065 --HTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYD 1122

Query: 1039 XXXXQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHAL 1098
                    +   +  TN  G    L  LR ER  L  K+T A+++ + +R K+   +  L
Sbjct: 1123 QIQIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVEL 1182

Query: 1099 SENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQRE 1137
             +   +L   + +    SS+ Q   DI+  L  L   RE
Sbjct: 1183 QDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRE 1221

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 105/212 (49%), Gaps = 58/212 (27%)

Query: 1186 SLVQEMKDNFEKEKSSLLSQQEQEI-EKLTDNERKLREF---------------YEEEIQ 1229
            ++V+ MK +FE++K   + ++ QE+ EK+ + + +L +                +E+E+ 
Sbjct: 1459 NIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVS 1518

Query: 1230 KKVSQAEENLKKRIRLPTEEKINGII---------------------------------- 1255
            +K+ +AEE LKKRIRLPTEEKIN II                                  
Sbjct: 1519 QKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRK 1578

Query: 1256 ------EKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXXSGRETLQQEFDEQL 1309
                  ++++ ELE+ + +K++EE K +   S                R  L++EF+ +L
Sbjct: 1579 QLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESR--LREEFNNEL 1636

Query: 1310 NIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
              ++KK+F+EGKQ  +MK+  LERK++ +E Q
Sbjct: 1637 QAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ 1668

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  231 bits (588), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 294/1187 (24%), Positives = 547/1187 (46%), Gaps = 92/1187 (7%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I+ +   K + ++++  NK L ++S  L   I+  K ++L  ++++ ++   L+L    
Sbjct: 145  KISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQELNLVKSN 204

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
                  E  SK +   S++++   E QN  E + ++ ++L      N+ L  +  ELS  
Sbjct: 205  ADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQ 264

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
            L+ K+ E K L + L T   +F  E  L+ +LI+ L++Q+ +++  LE+ + +  +  G 
Sbjct: 265  LQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN-AYQSANQNGM 323

Query: 264  QKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF------QNIPXXXXXXXXXHASGR 317
               +K +LL ++ +  + LE ++ E + L  ++ E         +              +
Sbjct: 324  STPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSK 383

Query: 318  NNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKEL 377
             ++   L GD+ IL+K                   + ELE  +P L+S+KER+  LE+EL
Sbjct: 384  ISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLEREL 443

Query: 378  NSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNE 437
            N   +LLE   K+   K+ EL + +++ +N  S + SL  QR+ LA QV+YLL+ +   +
Sbjct: 444  NDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRD 503

Query: 438  TLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSREL 497
                 L  +++E + + +++      SD++ I+ ERL QFK+V ELQ++N +LL   R+L
Sbjct: 504  DAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQL 563

Query: 498  ASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDEL-AVQKKEKT 556
            A K E  EK +  ++ S E +T+ +AKEAIL LQE+ Q+LE Q+K +S E  A +     
Sbjct: 564  ADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSA 623

Query: 557  EKESISAMSKIEDDA--SSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISL 614
             K+  SA S          H ++L K+L    + S+D I  LN EI+ L++A ++V + L
Sbjct: 624  NKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVIL 683

Query: 615  DKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCK 674
            ++E+S++ LAE+R  L++                       +L ++++   +  + I+ K
Sbjct: 684  EQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATK 743

Query: 675  SKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLK 734
            S+LS   +++  L +E +   + +  L+ + EAL  E    ++ V+Q+ +L  E   LL+
Sbjct: 744  SQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQLQTLQRERDILLE 803

Query: 735  ETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKA---NVF 791
            E ++ Y   ++                     E +  + S+ KW++A +D L     N  
Sbjct: 804  EAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNAR 863

Query: 792  XXXXXXXXXXXXXXXFSKTLE--------NVQNELTLANSKDVSEEKRALEKELSEVKSQ 843
                            +K+L           Q+   LAN+ D++++   L K L +    
Sbjct: 864  KTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANIN 923

Query: 844  LEKSNLEVKEYENVISTSKRSF-----------------------ENKSIQ-----YEDR 875
            L  +  ++++Y+++   S++S                        E KS+        D+
Sbjct: 924  LADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLNDQ 983

Query: 876  IKALASKLDSE----LRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLE 931
            IK L S+LD +      E++ L + LS LQ            +  +L EL+  Y+     
Sbjct: 984  IKDLNSELDHQKSQNQSEKSELIKKLSILQG-----------SQRSLDELKSEYE----- 1027

Query: 932  QKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEKE 991
                 +K ++L+  +  +    +   K+YE+ +Q++++++K + LLREE +   S  E E
Sbjct: 1028 -----EKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKS--EME 1080

Query: 992  G---DLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNN 1048
            G      + +S +++ +  W ++    E Q++                        K  +
Sbjct: 1081 GFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATS 1140

Query: 1049 SPS--AETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELK 1106
            S S  A + +A + E +  LR ER  L  KL  + +EE+ +R +L   +  L     E  
Sbjct: 1141 SDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFS 1200

Query: 1107 KIKSQIFELSSLPQNEHDILRHLVHLKEQREEKNKDALGTNKYMEQPNKVTTEA---QEK 1163
            K ++   +     +++  I+  L  L   RE        + KY+EQ      E    QE+
Sbjct: 1201 KTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQ 1260

Query: 1164 IQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEI 1210
            +Q LE QL   K+L  T  E D  +     +  KE+SS   Q+ Q+I
Sbjct: 1261 LQPLESQL---KSLTITISERDQQI-----SLLKEESSRWKQRSQDI 1299

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (61%), Gaps = 2/125 (1%)

Query: 1219 KLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLL 1278
            KL   YE++  +++ +AEE LKKRIRLP+EE+IN +IE+R+  L+  FE +++  A  L 
Sbjct: 1542 KLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELF 1601

Query: 1279 LHSXXXXXXXXXXXXXXSGRET--LQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKIS 1336
              +                 E   L+ +FDEQL +VRKKAFEEGKQ ++MK   LE KI+
Sbjct: 1602 KENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIA 1661

Query: 1337 MLEGQ 1341
             LEGQ
Sbjct: 1662 KLEGQ 1666

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  227 bits (579), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 265/1019 (26%), Positives = 483/1019 (47%), Gaps = 95/1019 (9%)

Query: 127  RTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYK---DRKELEYQNVMENLTAIDNEL 183
            R +L++    L++        E E  SK + + SY+   D+  LE +N + +L +   + 
Sbjct: 194  RAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRS---DF 250

Query: 184  RMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQI 243
            ++   KN  L ++N+ELSK L+ K+ EIKSL + L +   +F +E  L+ +L++ L++Q+
Sbjct: 251  QVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQL 310

Query: 244  KTLQEQLESLSD-EKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNI 302
              ++E+L+S    E  +D      +K +L+++++   E+L   + E + L   + E    
Sbjct: 311  NAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETD-- 368

Query: 303  PXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPS 362
                            +S    S D  +L+K                   + ELE  +P 
Sbjct: 369  ------------EESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416

Query: 363  LSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVL 422
            ++S+KER+  LE ELN++ +LLEH   E   K  EL  K  +     + I +L  QR  L
Sbjct: 417  INSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476

Query: 423  ARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAM-SDSEKILLERLAQFKNVK 481
             RQV+YLL+    ++     L ++++  +   L  ++  A  +DS+KI+ ERL +F+++ 
Sbjct: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536

Query: 482  ELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQI 541
            ELQ +N +LL++ R LA + E  E  + + +   E ETIN+AKEAIL L+   ++LES++
Sbjct: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKV 596

Query: 542  KELSDEL----AVQKKEKTE--KESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDA 595
            +EL  E     A+   E+T     +I  +++ + +      DL   +S   + S + +  
Sbjct: 597  EELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656

Query: 596  LNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXX 655
            LN EI++L+ + +D++I L KEKS+R LAE+R+ LL                        
Sbjct: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716

Query: 656  ILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNL 715
            IL ++ +   +  +YISCKSKL+  E E+ +L+ E +L I+++  L+ + + L +E+  L
Sbjct: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776

Query: 716  RMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSE 775
            R+ VTQ+ +L  E + LL ET+  Y +K+                   R+ +L+  N+S 
Sbjct: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836

Query: 776  IKWYKATIDDLKAN---VFXXXXXXXXXXXXXXXFSKTLENVQNE----LTLANSKDVSE 828
            I+WY+  I+ LK +   +                  K+LE   +E    L   N  D + 
Sbjct: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896

Query: 829  EKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELR 888
               +L KEL + K  L  +  +++EY+ +  T+ +S +    ++E+  K  ++++ +   
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956

Query: 889  ERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAV 948
            E+++L+E +S L+ ++    +EL                  L+ K  K+++AE R  I++
Sbjct: 957  EKSSLEEKISLLKEQIFNLNNELD-----------------LQNKGMKEEKAEFRKKISI 999

Query: 949  KTGN----------YDS-LSK-----------------SYERIMQENSELSKVVELLREE 980
               N          Y+S LSK                 +YE+ +Q+++++SK +  LRE+
Sbjct: 1000 LQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1059

Query: 981  VKN-RTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXX---XX 1036
            +   R             ES +K+ +  W  ++K    Q+                    
Sbjct: 1060 LHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQ 1119

Query: 1037 XXXXXXQDKG----NNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKL 1091
                   DKG    N+ P+  +        L +LR ER  L  K+T A+++ + +R K+
Sbjct: 1120 IELYTTADKGVTDTNDKPALNS-------ILLSLRRERDILDTKVTVAERDAKMLRQKI 1171

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 106/207 (51%), Gaps = 54/207 (26%)

Query: 1187 LVQEMKDNFEKEKSSLLSQQEQEI-EKLTDNERKLREF---------------YEEEIQK 1230
            +V+ MK  FE++K + + ++ +E+ EK+ + + +L +                +EEE+  
Sbjct: 1456 IVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVN 1515

Query: 1231 KVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQK--------------------- 1269
            ++ +AEE LKKRIRLPTEEKI+ IIE+++ +LE  F++K                     
Sbjct: 1516 RIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQ 1575

Query: 1270 ----IKEEAKSL----------LLHSXXXXXXXXXXXXXXSGRET-LQQEFDEQLNIVRK 1314
                I+E+ K L          L HS              +  ET +++E D +L  ++K
Sbjct: 1576 FEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLR--AEIETKMRKELDNELQHIKK 1633

Query: 1315 KAFEEGKQHVLMKSAFLERKISMLEGQ 1341
            K+FEEGKQ  +MK+  LERK++ +E Q
Sbjct: 1634 KSFEEGKQQAMMKTTLLERKLAKMESQ 1660

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  215 bits (548), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 267/1172 (22%), Positives = 552/1172 (47%), Gaps = 57/1172 (4%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I+ +D  + +L +V+  NK L  +  +L   +++ + + L  + ++ ++   L+L    
Sbjct: 142  KISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSN 201

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
             + T  +   K +   SY+++   E Q+    L  + NEL + +   A L  +N ELSK 
Sbjct: 202  AEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQ 261

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
            L+  + E K L +SL +   +F  E  L+ +LI  L  Q+ T+++ LE   D    + G 
Sbjct: 262  LQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYD-VAKNGGM 320

Query: 264  QKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF---QNIPXXXXXXXXXHASGRNNS 320
               ++  LL  + +  +KLE+S+     L  +++E     N+             G  + 
Sbjct: 321  SDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSG 380

Query: 321  ALSLS---GDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKEL 377
              ++S   GD+  LRK                   + ELE  +P L+S+K+R   LEK+L
Sbjct: 381  GSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQL 440

Query: 378  NSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNE 437
            N   +LLE   +E  +K  ++++ +++  +  + +  L  QR+ LARQV+ LL+ I   +
Sbjct: 441  NGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRD 500

Query: 438  TLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSREL 497
                 L  +++E + +  +   +   SD++ I+  RL +FK+V ELQ +N +LL   R+L
Sbjct: 501  DSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQL 560

Query: 498  ASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDE------LAVQ 551
            A K E+ E     ++ S E  T+N+AKEAIL LQE+ Q LE Q++ ++ E      L  +
Sbjct: 561  AQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSE 620

Query: 552  KKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVN 611
             K  +    + A +    + +     L  +L A  + S+     LN EI+ L+++N+ + 
Sbjct: 621  GKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLA 680

Query: 612  ISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYI 671
            I L++E+S+R+LA+++ +L++                       +L+++ +   +  +++
Sbjct: 681  IELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFV 740

Query: 672  SCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQT 731
            S KS+L +  +++T L++E +   + +  L+ + E+L  + N+ ++ + Q+ +   E  +
Sbjct: 741  SAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDS 800

Query: 732  LLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANVF 791
            L++ET+  Y+ +++    +                EL S + ++ KW+++ +D LK  + 
Sbjct: 801  LIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELG 860

Query: 792  XXXXXXXXXXXXXXXFSKTLENVQNEL----------TLANSKDVSEEKRALEKELSEVK 841
                               L +  ++L          +L    D +   ++L K+L E  
Sbjct: 861  SSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEAN 920

Query: 842  SQLEKSNLEVKEYENVISTSKR-SFENKSIQ-YEDRIKALASKLDSELRERTTLQENLST 899
             +L  +  E++ Y+   + ++R S    ++Q  +D  K  A  L++EL   T L  +++ 
Sbjct: 921  RKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAEL---TKLNSDIAM 977

Query: 900  LQARMVVQQDELTSNNNTL----SELRVSYDSLLLEQKTFKDKEA-------ELRSVIAV 948
               R+ V +DEL     T     SEL+   ++L+ +++  ++ +A       +L++ +  
Sbjct: 978  ANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEK 1037

Query: 949  KTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEK-EGDLEDTESIIKKGQDV 1007
            +  + +     Y+  +Q+ +E+S+ +E LR+  ++  S   K +   E+   ++++ +  
Sbjct: 1038 QISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQT 1097

Query: 1008 WDEEKKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETN--AAGNEETLAA 1065
            WD++K   E  +                         +  +S        ++   E +  
Sbjct: 1098 WDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVT 1157

Query: 1066 LRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSLPQNEHDI 1125
            LR ER  L  K+  +++EE+ +R +L  T+  L     +L + K  + E +   QN+ ++
Sbjct: 1158 LRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEEL 1217

Query: 1126 LRHLVHLKEQREE------KNKDALGTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLET 1179
               L  L   RE       +++     N++++  N++ +  QEK+Q +EEQ+   K+L  
Sbjct: 1218 FEKLNQLNLLREHNMSLRNESEKVSEHNEFLQ--NEILS-LQEKVQPMEEQI---KSLTA 1271

Query: 1180 TSLEHD---SLVQEMKDNFEKEKSSLLSQQEQ 1208
            T  E +   +L++E  D +++    +L + E+
Sbjct: 1272 TLTEKEQKLALLKEESDRWKQRSQDILHKYER 1303

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 154/314 (49%), Gaps = 52/314 (16%)

Query: 1060 EETLAALRSERTSLIEKLT--AAQKEERSVRHKLRETEHAL--SENAFELKKIKSQIFEL 1115
            E  L+  R + TSL  +LT   A +++  V H+L ET+  L  +EN   + K +  I   
Sbjct: 1373 EAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSI--- 1429

Query: 1116 SSLPQNEHDILRHLVHLKEQREEKNKDALGTNK------YMEQPNKVTTEAQEKIQDLEE 1169
                 +E    + L  L +Q E   K++  ++       Y EQP  V       ++D ++
Sbjct: 1430 -----SEESFKKQLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTAV-------LEDFKK 1477

Query: 1170 QLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIEKLTDN------------- 1216
            Q+   +    T +E  S  QE+    E  + + L+++E+ +E+L D+             
Sbjct: 1478 QVEEERR---TLIE--SHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNL 1532

Query: 1217 ---ERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEE 1273
               ++K  E YE++  +++ +AEE LKKRIRLP+EE+IN +IE+++  LE  F  K+   
Sbjct: 1533 EALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNAT 1592

Query: 1274 AKSLLLHSXXXXXXXXXXXXXXSGRETLQ------QEFDEQLNIVRKKAFEEGKQHVLMK 1327
            A +LL  +                +E +Q       +F+ QL  V+KKAFEEG+Q  +MK
Sbjct: 1593 ALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMK 1652

Query: 1328 SAFLERKISMLEGQ 1341
               LE KIS LE Q
Sbjct: 1653 VKLLESKISKLESQ 1666

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  198 bits (503), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 255/1060 (24%), Positives = 493/1060 (46%), Gaps = 54/1060 (5%)

Query: 109  SHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELE 168
             H L  EI++ K    L  T ++K++  L    + K+  E+E  +K+K    Y    + E
Sbjct: 168  CHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAE 227

Query: 169  YQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSE 228
             Q + + ++ ++N   +   +N  L K N  +S +L  K S+++ L N   T   +   E
Sbjct: 228  IQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKE 287

Query: 229  KQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERE 288
              L+ ++I+ LQ Q++ LQ+    + + K   P  Q  ++  L  +++ L +KL  +E +
Sbjct: 288  LSLKQEMIDVLQTQVQKLQDDYTRILNTK--QPIVQNDEERNL--EVEELKQKLIETETQ 343

Query: 289  RLSLVHSMEEFQNIPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXX 348
               L   +EE +NI           +S  +N       D++ ++K               
Sbjct: 344  ---LNKELEERRNI------TMQTESSTLSNQQ---QEDLDTIKKELIQERYQKEKLQNQ 391

Query: 349  XXXILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNL 408
                + ELE+ +P+++S+K+R+  LEKEL  + +LLE++++E    + EL+       ++
Sbjct: 392  VEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSV 451

Query: 409  RSSINSLAFQRTVLARQVKYLLL--IIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDS 466
            +    SL  QR  LA Q++Y+L+   +QN+      L  +++  +   L   + E  SDS
Sbjct: 452  KWETKSLTKQRNDLAHQLQYILIHTSVQNDS--NGPLSAEEVRFIQDILDNESNEESSDS 509

Query: 467  EKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEA 526
            ++++ ERL  F+N+ ELQ +N+ LL+  RELA K E  E+         E + I++AKEA
Sbjct: 510  QQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEA 569

Query: 527  ILVLQEYSQKLESQIKELSDELAVQKK-----EKTEKESISAMSKIEDDASSHTIDLGKQ 581
            I+ LQ Y+ KLE +IK L+DEL   K       K E E +    ++ ++ +    +L  +
Sbjct: 570  IISLQSYNTKLEDKIKTLNDELDCYKSLPKPDTKVETEHL----RLNEENTDLIKELETR 625

Query: 582  LSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXX 641
            L+ + + S     +LN+EI+++ + ++        E+++R+LAE R  L++         
Sbjct: 626  LATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVE 685

Query: 642  XXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTL 701
                           L ++++   + ++Y+SCK  LS ++ E+  ++++  +S   + +L
Sbjct: 686  NEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSL 745

Query: 702  RTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXX 761
            +     +  ERN L+  V+Q+ SL  E + +   TK     +L     +           
Sbjct: 746  KDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNK 805

Query: 762  XXRMSELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNEL--- 818
               + EL+S   SEI+WY+  ID +K                    +  ++ +Q +L   
Sbjct: 806  DREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQAS 865

Query: 819  --------TLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSI 870
                     L NS +V  +   L+ EL + K  L ++  E+ +Y+   S  +   EN   
Sbjct: 866  ESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQN 925

Query: 871  QYEDRIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTL----SELRVSYD 926
              E+  K    K+++  ++R  L +  S L  ++    +EL   N       SE+    +
Sbjct: 926  TVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLN 985

Query: 927  SLLLEQKTFKDKEAELRSVIAV------KTGNYDSLSK-SYERIMQENSELSKVVELLRE 979
             LL +    ++   +    ++       +  +Y ++++ +YE+ +Q+++EL+K +  LRE
Sbjct: 986  ELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLRE 1045

Query: 980  EVKN-RTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXX 1038
            +    R      + +    E +++K + +W+E++K +E QI                   
Sbjct: 1046 DAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFD 1105

Query: 1039 XXXXQDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHAL 1098
                  K  NS + +++A  NE+ + +LRS+R  L  +L+  ++E +++R KL      L
Sbjct: 1106 QVDLLSKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTEL 1165

Query: 1099 SENAFELKKIKSQIFELSSLPQNEHD-ILRHLVHLKEQRE 1137
            +    +L +I+ Q +E + +   EHD I+  L  L   RE
Sbjct: 1166 TNTRAKLTEIRQQ-YENTKISVEEHDNIMNQLNQLNLLRE 1204

 Score =  105 bits (261), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 129/267 (48%), Gaps = 46/267 (17%)

Query: 1186 SLVQEMKDNFEKEKSSLLSQQEQEI-EKL-----------TDNERK----LREF------ 1223
            ++V+EMK +FE+EK   +  Q  E  EKL           TD + K    L++       
Sbjct: 1442 NVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQ 1501

Query: 1224 ----YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLL 1279
                YEE + K++ QAEENLK+RIRLPTEEKIN +I+K+K+ELE  +++K+ + AK LL 
Sbjct: 1502 WEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELL- 1560

Query: 1280 HSXXXXXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLE 1339
                              ++ L++  D++L   + KAFEEGKQ  +MK+ FLE+KIS LE
Sbjct: 1561 --SSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLE 1618

Query: 1340 GQXXXXXXXXXXXXXXXXXV-SSTDEHN--------------SSIQ-GNPFFNLGKEQMN 1383
             Q                 + + +DE+N              S IQ  NP  + G   + 
Sbjct: 1619 SQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLA 1678

Query: 1384 VPRFXXXXXXXXXXXXLNPFTS-FEQA 1409
            + +              NPFTS F+Q 
Sbjct: 1679 LNQSRAPSSLQNGSDSSNPFTSPFQQT 1705

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score =  196 bits (499), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 183/712 (25%), Positives = 350/712 (49%), Gaps = 15/712 (2%)

Query: 84  RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
           +I+++ + K + + +++EN+ L + +  L  E   SK E L  + +L +++  LSL    
Sbjct: 146 KISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSN 205

Query: 144 KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
            +  ES+   K   F +Y+   + +   + + L  ++ EL+ +   N  L + N  ++ D
Sbjct: 206 SEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITND 265

Query: 204 LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
           L  ++  +K L ++L +   +F  E  L+++L++ L+ Q+++L+  LE  S     D G+
Sbjct: 266 LETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGS 325

Query: 264 QKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASGRNNSALS 323
                + L  ++    ++LE SE +   L  ++++  +           H      S   
Sbjct: 326 FSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYP--ASVTD 383

Query: 324 LSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNIL 383
           L GD+++L++                   + ELE  +P LSS+K+R+  LE++L  +  +
Sbjct: 384 LYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYM 443

Query: 384 LEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSL 443
           LE I K+    + +L + +++  +    I+ L  QR+ LARQV+YLL+           L
Sbjct: 444 LESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPL 503

Query: 444 GRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEK 503
             +++  + + L         D++K++ ERL +F+++ ELQ++N  LL+  R LA K E 
Sbjct: 504 TTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLES 563

Query: 504 LEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDEL----AVQKK-EKTEK 558
            E+ +  +  + E++ I +AKEAI+ LQE++Q+LES+I+ L+ E     A+Q       K
Sbjct: 564 EEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNK 623

Query: 559 ESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEK 618
            +  A++  +   S+   DL + L    + ++  +  LNSEI+ L +  T + I ++KE+
Sbjct: 624 ITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKER 683

Query: 619 SARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLS 678
           +++ LAE+R  + +                       +L ++ +   +    I C+SKL+
Sbjct: 684 TSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLA 743

Query: 679 TAEAEITSLRAENELSIETQTTLRTKK----EALLNERNNLRMTVTQMNSLNNELQTLLK 734
           T E+E+ S  A+    IE+ ++ + K     E L  ERNNL + VTQ+ +L  E   LL 
Sbjct: 744 TLESELKSSVAK----IESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLA 799

Query: 735 ETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDL 786
           ET+  Y +K+    ++               ++    NDS  +WY+  ID L
Sbjct: 800 ETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSL 851

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 77/128 (60%), Gaps = 4/128 (3%)

Query: 1218 RKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSL 1277
            ++  E YE++  K++ ++ E L+KRIRLPTEEKIN I+E RKSELE  FE K+++ A  L
Sbjct: 1531 KQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASEL 1590

Query: 1278 LLHSXXXXXXXXXXXXXXSGRETLQ----QEFDEQLNIVRKKAFEEGKQHVLMKSAFLER 1333
                                 E L+    +E DE++  VRKKAF+EGKQ   MKS FLE+
Sbjct: 1591 ANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEK 1650

Query: 1334 KISMLEGQ 1341
            KI+ LE Q
Sbjct: 1651 KIAKLEAQ 1658

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  188 bits (477), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 230/975 (23%), Positives = 459/975 (47%), Gaps = 55/975 (5%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I ++ + KA LN+    NK L +       E++T +  +L  ++++ ++   ++L  + 
Sbjct: 137  KIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRMEQEITLLREN 196

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
                 ++  +K      +++    E Q+    ++ +++EL +    N +L +    L + 
Sbjct: 197  NDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQ 256

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
            L  K+SE K +++    S  +   E  L+ ++I+AL+  +++L++++++  +       T
Sbjct: 257  LEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFT 316

Query: 264  QKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF-QNIPXXXXXXXXXHASGRNNSAL 322
            +K ++ EL+ ++  +  +L+ SE   + L  +++E   NI           AS   + ++
Sbjct: 317  EK-ERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSV 375

Query: 323  --SLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSS 380
               L GD+ +L+K                   + ELE  +P L+S+KERS  LE+ELN  
Sbjct: 376  IPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEV 435

Query: 381  NILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETL- 439
             ILLE   K+   KS++L+  ++   +  + I SL+ QR  LA Q++YLL+    NE++ 
Sbjct: 436  TILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLV----NESIK 491

Query: 440  ---GSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRE 496
               G  L  ++L+ +     +      SD++ I+ +RL +F++V ELQ +N +LL   R 
Sbjct: 492  SEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRN 551

Query: 497  LASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDE------LAV 550
            LA + E+ E  N  QI   EDET+ +AKE IL L +++Q LE+Q+  LS E      L+V
Sbjct: 552  LADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSV 611

Query: 551  QKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDV 610
                 T   +  A++    D      DL  +L+A ++ +++     +SE  NL +   ++
Sbjct: 612  NASSGT--NTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEI 669

Query: 611  NISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDY 670
            +++ + EK++R LAEDR NLL+                       +  ++K+   +    
Sbjct: 670  SLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSL 729

Query: 671  ISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQ 730
            I  KS LS+ ++E++ L++E +   + Q  L+ + E    E    ++ + Q+ +L  E +
Sbjct: 730  IKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQRERE 789

Query: 731  TLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANV 790
             LLKET++ Y +KL+   ++               + + S  + +  W++  ID L +  
Sbjct: 790  MLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEA 849

Query: 791  FXXXXXXXXXXXXXXXFSKTL-----------ENVQNELTLANSKDVSEEKRALEKELSE 839
                               T+              Q+   L+N  D       L +EL +
Sbjct: 850  AQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEK 909

Query: 840  VKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLST 899
            V  QL  S  +++ ++ +   S +S    S  +E+  K     + +   ER  LQ  ++ 
Sbjct: 910  VNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNI 969

Query: 900  LQARMVVQQDEL--------TSNNNTL---SELRVSYDSLLLEQKTFKDKEAELRSVIAV 948
            L  ++    +E+        T  N T+   S+L++  +S+   +  +++K A ++  + +
Sbjct: 970  LNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEM 1029

Query: 949  KTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEKEGDLEDTESI-------I 1001
            +T   +   +SYE  +Q+++++SK +  LR E ++  S      DLE  ++        +
Sbjct: 1030 QTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKS------DLETLKTQSQLAMENL 1083

Query: 1002 KKGQDVWDEEKKVFE 1016
            K  + +W+E+K  +E
Sbjct: 1084 KNSEKLWNEQKTEYE 1098

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 1224 YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXX 1283
            YE++  +K+  AEE LKKRIRLPT++KI+ I+E RK+ LE SFE+K+ E+A+ L      
Sbjct: 1560 YEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGN 1619

Query: 1284 XXXXXXXXXXXXSG-RETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
                        +  +++++++F+  L  +++K+FEEGKQ V +K  FLE KI  LE Q
Sbjct: 1620 DAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQ 1678

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  183 bits (465), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 243/1056 (23%), Positives = 482/1056 (45%), Gaps = 43/1056 (4%)

Query: 84   RINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQ 143
            +I  I TL+ +  ++++E + L + + +L  +    K E+L  +    +++  +SL    
Sbjct: 148  KIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQKVSLLNTN 207

Query: 144  KQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKD 203
             +  ES+   K   F +Y+ R + E  +V + L   + +L+        L ++N +   +
Sbjct: 208  NEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQNGQKESE 267

Query: 204  LRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGT 263
            L G+   +K L + L ++  +F  E  L+ +L+  L+ Q+  L+ +LE  +  +      
Sbjct: 268  LEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKNSPQASTDAA 327

Query: 264  QKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASGRNNSALS 323
                + ++  ++ +  ++LE SE +   L  ++E+                SG + S   
Sbjct: 328  TTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQL-------LSADEKTISG-SQSLPD 379

Query: 324  LSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNIL 383
            L  D+ IL+K                   + ELE  +P LSS+K+R+  LEKEL  +  +
Sbjct: 380  LYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELAETAYM 439

Query: 384  LEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSL 443
            L+ I K+  + +A+L++ +S+  +L S I++L  QR+ LARQV+YLL+ +         L
Sbjct: 440  LDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGDSHGPL 499

Query: 444  GRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEK 503
              ++   + + +     +   D++ I+ ERL +FKN+ ELQ +N  LL   R LA++ E 
Sbjct: 500  SAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLANQLET 559

Query: 504  LEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDEL----AVQKKEKTEKE 559
             E+    +  + E++TI +AKEAI+ LQ++ Q+LE++I  ++ E     A+Q +   E  
Sbjct: 560  EERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQSQTSHEG- 618

Query: 560  SISAMSKIEDDASSHT----IDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLD 615
            S   +  +   AS ++     +L + LSA  + ++  +  L +E + L ++ +++ ++++
Sbjct: 619  SNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKSELVVNVE 678

Query: 616  KEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKS 675
            KEKS+R LAE+R  + +                       +  ++ +   +  + I CKS
Sbjct: 679  KEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETISELIDCKS 738

Query: 676  KLSTAEAEI-TSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLK 734
            +L+T  AE+  S+  EN L+   Q  L+   E L  ERN L + VTQ+ +L  E  TLLK
Sbjct: 739  QLATLSAELKNSIAKENLLNTSHQ-KLKETNEQLTKERNELTILVTQLQTLQKERDTLLK 797

Query: 735  ETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWY-----------KATI 783
            ++   +  K+     +              +S+  S +DS  +WY           K+T 
Sbjct: 798  DSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALNECLKSTT 857

Query: 784  DDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSKDVSEEKRALEKELSEVKSQ 843
             DL +                          Q+   L  + DV  +  AL  EL + +  
Sbjct: 858  SDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDALRSELEKTRIN 917

Query: 844  LEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTLQAR 903
            L+ +  +V EY+ + +++K +    +   E   +    ++++  +ER  L  + + L+ +
Sbjct: 918  LKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAVLKDQ 977

Query: 904  MVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNY---------- 953
            +     EL    N L  L+  ++    E K+ K   A ++    ++              
Sbjct: 978  LANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTEDLNQQAMY 1037

Query: 954  -DSLSKSYERIMQENSELSKVVELLREEV-KNRTSNGEKEGDLEDTESIIKKGQDVWDEE 1011
             +   ++YE+ +Q ++++SK +  LREE  K++      E  + + +  +++ +  W  +
Sbjct: 1038 ANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQ 1097

Query: 1012 KKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETNAAGNEETLAALRSERT 1071
            K+ +E Q +                      +D  ++ P  +   +   E ++ L+ E  
Sbjct: 1098 KQEYETQASLSSQRIEDLSTQNRLLFDQISLKD-TDSIPINDELKSEARELISTLKRECD 1156

Query: 1072 SLIEKLTAAQKEERSVRHKLRETEHALSENAFELKK 1107
             L  KL  A+++E +++ KL  TE  LS    E++K
Sbjct: 1157 ILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRK 1192

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 87/153 (56%), Gaps = 9/153 (5%)

Query: 1189 QEMKDNFEKEKS--SLLSQQEQEIEKLTDNERKLREFYEEEIQKKVSQAEENLKKRIRLP 1246
            Q ++D  E EKS  S  S +  +IE L   +++  E YE+   K++ +A E L+KRIRLP
Sbjct: 1500 QRLEDKAELEKSLASSESLKSSDIENL---KKEWEEEYEQRTIKRIEEANEILRKRIRLP 1556

Query: 1247 TEEKINGIIEKRKSELESSFEQKIKEEAKSLL----LHSXXXXXXXXXXXXXXSGRETLQ 1302
            TEEKIN IIE RK EL+  FE K+++    L     L +                +  ++
Sbjct: 1557 TEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRHKQEVEKLKADMK 1616

Query: 1303 QEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKI 1335
            +E DE++   +KKAF+EGKQ   MKS FLE+KI
Sbjct: 1617 REMDEEVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  177 bits (449), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 224/915 (24%), Positives = 439/915 (47%), Gaps = 74/915 (8%)

Query: 127  RTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMT 186
            +++L++    + L  K ++  E E  +K +HF  Y+ + +L   + + N+  + ++L++ 
Sbjct: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIE 238

Query: 187  NGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTL 246
                  L K+ +E ++ L+  + E K L++ L     +F  E  ++D+LI   +NQIK+L
Sbjct: 239  KSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298

Query: 247  QEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXX 306
            +  L+    +KF      + +  E+   +K+L E+L ++ER+   +       ++I    
Sbjct: 299  ESTLQ----QKFKTAEANEENSSEV---VKSLKEELSLAERKLQDMEEKCVRLESILDHD 351

Query: 307  XXXXXXHASGR-------------------NNSALSLS---GDVNILRKHFXXXXXXXXX 344
                     GR                   ++S++SLS   GD+ IL++           
Sbjct: 352  SNDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411

Query: 345  XXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESE 404
                    + ELE  +P ++S++ER++ LEKEL  + +LLEH  KEN  K+ EL+  + +
Sbjct: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471

Query: 405  CSNLRSSINSLAFQRTVLARQVKYLLL---IIQNNETLGSSLGRKDLELLGQYLAANTAE 461
             S+  S +  L  QRT LA Q++YLL+   II +N+ L   L   +++ +   ++ +   
Sbjct: 472  ISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHL---LNEDEIKFIKNLVSNDNMA 528

Query: 462  AMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLE---KVNLKQISSEEDE 518
            + +DS+K++ E L +FK++++LQ +NM+L++  R LA + E+ E   K        E++E
Sbjct: 529  STNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNE 588

Query: 519  TINDAKEAILVLQEYSQKLESQIKELSDE------LAVQKKEKTEKESISAMSKIEDDAS 572
               +AKEAIL L++ ++ LE  ++ ++ E      L  + +E+  K S S     E  + 
Sbjct: 589  IFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSY 648

Query: 573  SHTI--DLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNL 630
            + T+  DL  +L+     S     AL  E+  LH+  + +N+ ++K +SA+ LAE+R  +
Sbjct: 649  NETVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKI 708

Query: 631  LEYXXXXXXXXXXXXXXXXXXXXXXIL--DKEKQFSYSSRDYISCKSKLSTAEAEITSLR 688
             +                       +L  DKE Q ++SS  Y+   SK S+ E  + +L 
Sbjct: 709  TQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSS--YVEAISKNSSLETSVRNLE 766

Query: 689  AENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISA 748
             E  L  + + +L+++      E+  LR+ VTQ+ SL +E +TLL+  +S +  ++    
Sbjct: 767  TEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVN 826

Query: 749  LKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXX------ 802
                            + +++ + +++ +WY+  ID+                       
Sbjct: 827  YINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLH 886

Query: 803  -XXXXFSKTLENVQNEL----TLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENV 857
                   K LE  Q  +    T+  +   ++E+  + KEL + K +L  +  +++E++N+
Sbjct: 887  LQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNL 946

Query: 858  ISTSK-------RSFENKSIQYEDRIKALASKLDSELRER-TTLQENLSTLQARMVVQQD 909
               S+        SF  K   Y D IK L  +  +E+  R   L++ L  ++  + VQ +
Sbjct: 947  SQNSEDALKELNASFNAKDRDYRDAIKTLTEE-KTEIEGRFEILKQQLENIKNELTVQSE 1005

Query: 910  ELTSN----NNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQ 965
            E  S       T++EL+ +   +   +K F++K  +L + +  +T   ++  K+YE+ +Q
Sbjct: 1006 EAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ 1065

Query: 966  ENSELSKVVELLREE 980
             ++++SK +  LRE+
Sbjct: 1066 RHADVSKTISELREQ 1080

 Score =  114 bits (285), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 87/225 (38%), Positives = 127/225 (56%), Gaps = 42/225 (18%)

Query: 1145 GTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLS 1204
             TNK +E+  KV       I DL+ QL  A N      + +  V+ +K  FE +K+  ++
Sbjct: 1445 NTNKEIEELQKV-------IDDLKTQL--AANSTDADEQTNRNVEAIKREFENQKTKFIA 1495

Query: 1205 QQEQEIEK------------LTDNERK----------LREFYEEE----IQKKVSQAEEN 1238
            ++ +E  K              +NE+           LR+ +EE+    IQK++++AE+N
Sbjct: 1496 EKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDN 1555

Query: 1239 LKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLL--HSXXXXXXXXXXXXXXS 1296
            LKKRIRLP+EEKIN IIEKR+SELES F+QKI+++A+ LL+  HS              +
Sbjct: 1556 LKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHS-----NEFNNELKEA 1610

Query: 1297 GRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
              + L++ F+++L   RKKAFEEGKQ   MK+  LERKI  LE Q
Sbjct: 1611 LEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQ 1655

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1973

 Score =  161 bits (407), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 168/640 (26%), Positives = 314/640 (49%), Gaps = 39/640 (6%)

Query: 127 RTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMT 186
           RTQL++++  L    K+K   E     K + F+SY+++   E Q++   L  + NEL   
Sbjct: 194 RTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQM 253

Query: 187 NGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTL 246
              N  L +R +ELS  LR   + +K+++ S          E  L+ QLI  LQ+Q+  L
Sbjct: 254 KSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNEL 313

Query: 247 Q-EQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXX 305
           Q E    LS    D   + + D  +  R+I +L  +L   +   + L   + + ++    
Sbjct: 314 QRENGNELSLTVSDTASSSRKD-SDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAV 372

Query: 306 XXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSS 365
                   +    NS      D+++L+K                   + +LE  +P+L +
Sbjct: 373 SNSTS---SDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEA 429

Query: 366 YKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQ 425
           Y+ R+   E+EL  + +LLE   KE    S+EL + +S   ++   I  +A QR+ LA Q
Sbjct: 430 YRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQ 489

Query: 426 VKYLLLIIQN---NETLGSSLGRKDLELLGQYLAAN--TAEAMSDSEKILLERLAQFKNV 480
           +++ L  + N   N++ G  L  ++++ +   +  +    +  +D++K++ ERL +FK++
Sbjct: 490 LQFFL--VHNSVANDSAGP-LTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDI 546

Query: 481 KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540
            ELQ +NM+LL+ +RELA+K E+ +K+   + S  E+ETI +AKEAIL LQ Y+  L ++
Sbjct: 547 IELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAK 606

Query: 541 IKELSDELAVQKKEKTEKESISAMSKIEDDASSHTID----------------LGKQLSA 584
           I  L+ EL          E+   +S  ED ++    D                L  ++++
Sbjct: 607 IAALTKEL----------ETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIAS 656

Query: 585 NLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXX 644
            ++ SK+  + LN +I  L + N  ++I L +EKSA++LAE+R  LL+            
Sbjct: 657 IIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENER 716

Query: 645 XXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTK 704
                      +++++K+   +    I  +S+L+T E +    + E +L   ++  L+ +
Sbjct: 717 LQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNE 776

Query: 705 KEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKL 744
              L  E+N++++ VT++ +L +E + LL  T+  ++ +L
Sbjct: 777 LTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKEL 816

 Score =  104 bits (260), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 1218 RKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSL 1277
            +++ E YE+   +++ +AEENLK+RIRLPTEEKIN +I+KR+++LE+ F+ K++  AK L
Sbjct: 1543 KQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKEL 1602

Query: 1278 LLHSXXXXXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISM 1337
            L                   +E L ++++E+L +V+KKAF+EG+Q VLMK++FLE+KI+ 
Sbjct: 1603 LTGDEKNEFFDRMKKEI---QEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITK 1659

Query: 1338 LEG 1340
            LE 
Sbjct: 1660 LES 1662

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  141 bits (355), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 202/789 (25%), Positives = 346/789 (43%), Gaps = 77/789 (9%)

Query: 116 IETSKDEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKEL-------- 167
           ++T K   L L+ + D V     L ++ K+  E +         S++D K L        
Sbjct: 160 LQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQL--------SFRDEKTLVDDVTRTS 211

Query: 168 EYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLS 227
             QN+ E L    N+    +  N  L  +N++LS  +  KI EIK+L++++     DF  
Sbjct: 212 HVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSK 271

Query: 228 EKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISER 287
           E  LQ  + + L++Q+ + ++     + EK +D   +      ++ ++ +   +LE S+ 
Sbjct: 272 EMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKD 331

Query: 288 ERLSLVHSMEEFQNIPXXXXXXXXXHASGRNNSALSLS---GDVNILRKHFXXXXXXXXX 344
           E        +  QNI               +N   S++    D+  L++           
Sbjct: 332 E-------CQRLQNIVADCIEEDEAAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQ 384

Query: 345 XXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESE 404
                   ++ELER  P L S+KER+  LE+EL +S  LLE I         EL     +
Sbjct: 385 LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444

Query: 405 CSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMS 464
            +N  ++I+SL  QR  LARQVK LLL I   +   S L   +L  L + L +       
Sbjct: 445 INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504

Query: 465 DSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAK 524
           DS+ I+ ERL +F N  ELQ +NM+LL   R LA K E  E    K ++  E++TI +AK
Sbjct: 505 DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564

Query: 525 EAILVLQEYSQKLESQIKELS---DELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQ 581
           +AI+ L+  +  LES+I  LS   D   +       K    A +K E        +L  +
Sbjct: 565 DAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESE 624

Query: 582 LSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXX 641
           LS     +  ++  LN E+    ++ ++  I+L +  + + LA ++ NLL+         
Sbjct: 625 LSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKTK 684

Query: 642 XXXXXXXXXXXXXXILDKEKQFSYSS---------RDYISCKSKLSTAEAEITSLRAENE 692
                          L+K++  + SS          +    K+K  +   EI++L  +N 
Sbjct: 685 ---------------LEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKN- 728

Query: 693 LSIETQTTLRTKKEAL-------LNERNNLRMTVTQMNSLNNELQTLLKETKS-GYDDKL 744
                 T LR  KE+L         E+  L+M +T+  + +NE Q L  ++K   Y+ K+
Sbjct: 729 ------TDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNE-QKLKSDSKQVQYNTKI 781

Query: 745 KISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXX 804
           K     C             +  L++  +S++KW + TIDD + N+              
Sbjct: 782 KNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTI 841

Query: 805 XXFSKTLENVQNELT--------LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYEN 856
              S  +++++ EL         L NS D +  + AL+KEL   +  L+ ++ +++ YE 
Sbjct: 842 RKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEE 901

Query: 857 VISTSKRSF 865
           +IST + + 
Sbjct: 902 IISTDENTL 910

 Score = 66.6 bits (161), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 43/58 (74%)

Query: 1224 YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHS 1281
            YEEE  +++ +AEENLKKRIRLP+EE+I  II KRK ELE  F++K+K  + S  L S
Sbjct: 1442 YEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLSS 1499

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  139 bits (350), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 240/974 (24%), Positives = 421/974 (43%), Gaps = 108/974 (11%)

Query: 170  QNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEK 229
            QN+ E L     E    +  N  L  +N++LS  +  K+ EIK+L+++  T   +F  E 
Sbjct: 214  QNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEM 273

Query: 230  QLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISER-- 287
             LQ ++ + L++Q+ + +        EK DD    KL K+          E ++++E   
Sbjct: 274  TLQKKMNDLLRSQLTSFERGHSLRPKEKGDD----KLCKNP---------EHIDVAEELI 320

Query: 288  -ERLSLVHSMEEFQNIPXXXXXXXXXHASGRN-NSALSLSG----DVNILRKHFXXXXXX 341
              +L L  S EE Q +          + +  N N+A    G    ++  L++        
Sbjct: 321  DAKLKLEKSKEECQLLKNIVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQ 380

Query: 342  XXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNILLEHI---KKENLDKSAEL 398
                       + ELE   P+L S+KER+  LE EL  S  LLE +   K+++  K   L
Sbjct: 381  KFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSL 440

Query: 399  EKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAAN 458
            E+K    ++  ++I+SL  QR  LARQVK LL  I   +T  S L   +L  L + L + 
Sbjct: 441  EQK---INSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESE 497

Query: 459  TAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDE 518
                  DS+ I+ E+L +FKN+ ELQ +NM+LL   R LA K E  E    K ++  E++
Sbjct: 498  NTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQ 557

Query: 519  TINDAKEAILVLQEYSQKLESQIKELSDE------LAVQKKEKT--EKESISAMSKIEDD 570
            TI +AKEAI+ ++  + KL  ++  L+ E      LA     KT  + E I+     E  
Sbjct: 558  TIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGIT-----EAT 612

Query: 571  ASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNL 630
                  +L  +LS+    S  II  LN ++    ++ TD  I+L + ++ + L  ++  +
Sbjct: 613  YEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAM 672

Query: 631  LEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSS-RDYISCKSKLSTAEAEITSLRA 689
            L+                            + + YS+  D    ++K+ + + EI++L+ 
Sbjct: 673  LQERINHLKTQLEKQRLSAAPPV-------QDYKYSNLTDLSHSENKIGSLKYEISNLKK 725

Query: 690  ENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISAL 749
            EN   I  + +L    E    E+  L + +++  + +NE   +    +  Y  ++K+   
Sbjct: 726  ENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEK 785

Query: 750  KCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSK 809
                           +  L+S  +S++KW + TIDD + N+                 S 
Sbjct: 786  NLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSL 845

Query: 810  TLENVQNELT--------LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVIST- 860
             +EN+ NEL         L+N+ D +  +  L KEL + + +L+ ++ ++K YE +IST 
Sbjct: 846  EIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTN 905

Query: 861  -------------SKRSFENKSIQYEDRIKALA----SKLDSELRERTTLQENLSTLQAR 903
                         +K   E K IQ E++ K       S L  EL E   LQ  L    + 
Sbjct: 906  ENVLKELNGELKKAKEDCETK-IQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASY 964

Query: 904  MVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERI 963
            +V+Q +++      + E++   D +    + ++ +E                 S  Y+  
Sbjct: 965  LVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEE-----------------SSQYQSE 1007

Query: 964  MQENSELSK-VVELLREEVKNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITXX 1022
            ++ N +LS+ V+ L +E    +T   + +  L  T+ ++ + +  W EEK  +E ++   
Sbjct: 1008 LKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISN 1067

Query: 1023 XXXXXXXXXXXXXXXXXXXXQDKGNNSPSAETNAAGNEETL------AALRSERTSLIEK 1076
                                  +G+NS         NE+ L      + LR ER+SL  K
Sbjct: 1068 IEQTESLRVENSVLIEKIDGATEGSNS---------NEKYLELVSLFSNLRHERSSLETK 1118

Query: 1077 LTAAQKEERSVRHK 1090
            LT  +++   +R K
Sbjct: 1119 LTTCKRDLALLRQK 1132

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (78%)

Query: 1224 YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLL 1279
            YEEE  K++ +AEENLKKRIRLP+EE+I  II KRK ELE  FE+K+KE  KSL+ 
Sbjct: 1443 YEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVF 1498

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  135 bits (339), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 240/951 (25%), Positives = 400/951 (42%), Gaps = 108/951 (11%)

Query: 193  LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLES 252
            L  +N++LS  +  KI EIK+L+++      +F  E  LQ  + + L +Q+ + +    S
Sbjct: 237  LLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSS 296

Query: 253  LSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXX 312
                K DD   +  D + +  ++ N   + + S+ E   L + + +F             
Sbjct: 297  GEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDF-----VQEDKATV 351

Query: 313  HASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTF 372
              +G +++   L  D+ +LRK                   + ELE   P L S+KER+  
Sbjct: 352  DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411

Query: 373  LEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINS-------LAFQRTVLARQ 425
            LE EL  S  LLE I       S    K E E ++LR  INS       L  QR  LARQ
Sbjct: 412  LEHELKRSTELLETI-------SMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQ 464

Query: 426  VKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQN 485
            VK LLL     +     L + DL  L + L + +    +D++ I+ ERL +F N+ ELQ 
Sbjct: 465  VKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQE 524

Query: 486  RNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELS 545
            +N++LL   R LA K E  E      ++  E +TI +AK+AI+ L+  + K+ES+I  L 
Sbjct: 525  KNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILL 584

Query: 546  DELAVQKKEKTEKE---SISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIEN 602
             E    K   + KE   +++A +  E        +L  +LS+    S  +I  L  E+  
Sbjct: 585  RERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTT 644

Query: 603  LHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQ 662
              +   D  I+    ++ + LA+++ ++LE                         D EKQ
Sbjct: 645  YKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKT-----------------DLEKQ 687

Query: 663  -FSYSS-------RD---YISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNE 711
              S  S       RD    +  ++K      EI+SL+ E   S+  + +L    E    E
Sbjct: 688  KLSVPSFVQDNKVRDSTELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKE 747

Query: 712  RNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRMSELKSQ 771
            +  L+M + +     NE +         YD ++K                   +  L+S 
Sbjct: 748  KIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSS 807

Query: 772  NDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELT--------LANS 823
             DS++KW + TIDD +  +                 S  +EN+ NEL         L N+
Sbjct: 808  KDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNT 867

Query: 824  KDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQ-------YEDRI 876
             D S  + AL KEL + + +L+ ++ +V+ YE +IST++++ +  + Q       Y+ RI
Sbjct: 868  SDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARI 927

Query: 877  -----KALA-----SKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYD 926
                 + LA     S L  EL E  +LQ  L      +V Q ++L +    + E++   D
Sbjct: 928  ELECKEKLANEEELSLLRRELDEIRSLQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKID 987

Query: 927  SLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTS 986
             +    + +K +          KT  + S       IM+ N ELS++V  L +E  +   
Sbjct: 988  KMNWNVQVYKKE----------KTSQFQS-------IMKANKELSELVTRLEKEATDSQM 1030

Query: 987  NGEK-EGDLEDTESIIKKGQDVWDEEKKVFEVQITXXXXXXXXXXXXXXXXXXXXXXQDK 1045
              +K +  L  T+ ++   +  W EEK  +E ++                         +
Sbjct: 1031 ELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTE 1090

Query: 1046 GNNSPSAETNAAGNEETL------AALRSERTSLIEKLTAAQKEERSVRHK 1090
            G++         GNE+ L      + LR ER SL  KLT  +++   V+ K
Sbjct: 1091 GSD---------GNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQK 1132

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 82/137 (59%), Gaps = 25/137 (18%)

Query: 1162 EKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIEK--------- 1212
            E+I+ L+ +L   KN   +S       ++++DN E+EK+ +++++ +E EK         
Sbjct: 1364 EEIESLKRELQVFKNANNSS----DAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKS 1419

Query: 1213 -----LTDNERKL----REF---YEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKS 1260
                 + DN   +    +E+   YEEE  +++ +AEENLKKRIRLP+EE+I  II KRK 
Sbjct: 1420 KSTGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKE 1479

Query: 1261 ELESSFEQKIKEEAKSL 1277
            ELE  F++K+KE A SL
Sbjct: 1480 ELEEEFQRKLKENASSL 1496

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1820

 Score =  134 bits (337), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 176/627 (28%), Positives = 303/627 (48%), Gaps = 39/627 (6%)

Query: 183 LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242
           L+    K + L  +N +L+K     I EIK+L+++L  +  D   E  ++ +LI+ LQ Q
Sbjct: 223 LKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQ 282

Query: 243 IKTLQEQLESLSD-----EKFDDPGTQKLDKHELLRQ-IKNLNEKLEISERERLSLVHSM 296
           + + QE+L    +      KF D  +Q    +E L+  I++L  K+E  + E  +L +SM
Sbjct: 283 LSSTQEELRQNVELNSKFTKFPDLESQ----NETLKSDIQDLTLKIEELQNENFNL-NSM 337

Query: 297 EEFQNIPXXXXXXXXXHASGRNNSAL-SLSGDVNILRKHFXXXXXXXXXXXXXXXXILQE 355
                I          + S   +S L +L   +N+L+K                   + E
Sbjct: 338 -----INQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIE 392

Query: 356 LERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSL 415
           LE  +P +SS++E++  LE EL +  +LL     E      +L   +S+    +S+I  L
Sbjct: 393 LENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKEL 452

Query: 416 AFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSE----KILL 471
             QR  LA QVK+LLL +      G  L R+++E + +   +N +E ++ SE     ++ 
Sbjct: 453 IRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKI--SNNSEDLNGSELTSQHVIS 510

Query: 472 ERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQ 531
           ERL  F N++ELQ +NM+LL   R L+   E +E  N  +    +++TI DAKEAIL LQ
Sbjct: 511 ERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQ 568

Query: 532 EYSQKLESQIKELSDELAVQKKEKTEKESISAMSKIEDDASSHTID-----------LGK 580
            ++  LES++K L  E    K       SI +  K +D +SS + +           L +
Sbjct: 569 YHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIE 628

Query: 581 QLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXX 640
           +L A LK +K   DAL S+I +     +++ ISL+KEKS+  L  ++ +L E        
Sbjct: 629 ELKAELKKNK---DALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKT 685

Query: 641 XXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTT 700
                          I+ +E +       YI+ ++++S  + +++  ++E +  +++Q +
Sbjct: 686 ENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDS 745

Query: 701 LRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXX 760
           L ++      E+N LR+ ++Q+ SL NE  TLL +T+  +  K+                
Sbjct: 746 LNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGS 805

Query: 761 XXXRMSELKSQNDSEIKWYKATIDDLK 787
               + +L   N+S+  WY+ TIDDLK
Sbjct: 806 KMTEIQKLSISNESQCTWYQNTIDDLK 832

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 96/174 (55%), Gaps = 27/174 (15%)

Query: 1190 EMKDNFEKEKSSLLSQQEQEIEKL----TDNERKLREF----------YEEEIQKKVSQA 1235
            E++  ++ EK  LL + E++IE L    TD   K+ EF          YE+   +++ +A
Sbjct: 1453 ELEAQWKLEKDKLLKEYEEKIEDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEA 1512

Query: 1236 EENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXX 1295
            +E LKKRIRLP+E KIN +IEKRK ELE+ +E K++E+     L+               
Sbjct: 1513 KETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEK-----LNEIEANRNSIETIDPG 1567

Query: 1296 SGRETLQQE--------FDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
              RE +++E        F+  LN  +KK+FEEGKQ   MK+  LERKIS LE Q
Sbjct: 1568 KLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQ 1621

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score =  131 bits (329), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 188/751 (25%), Positives = 334/751 (44%), Gaps = 72/751 (9%)

Query: 190 NAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQ 249
           N  L  +N++LS+ +  K+ E+K+L+++      +F  E  LQ  + + L++Q+ +L++ 
Sbjct: 234 NKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKD 293

Query: 250 LESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNI--PXXXX 307
               + EK DD   +  +  +++ ++ +   +LE S+ E        +  QNI       
Sbjct: 294 CSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNE-------CQRLQNIVMDCTKE 346

Query: 308 XXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSYK 367
                  S  + +   L  D+ +L++                   + ELE   P L S+K
Sbjct: 347 EEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFK 406

Query: 368 ERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSIN-------SLAFQRT 420
           ER+  LE EL  S  LLE +       S    K+E E ++LR  IN       SL  QR 
Sbjct: 407 ERTKSLEHELKRSTELLETV-------SLTKRKQEREITSLRQKINGCEANIHSLVKQRL 459

Query: 421 VLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNV 480
            LARQVK LLL     +   S L + +L  L + L ++     +DS+ I+ ERL +F NV
Sbjct: 460 DLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNV 519

Query: 481 KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540
            ELQ +N++LL   R LA K E  E    K +   E++TI +AK+AI+ L+  + K+E++
Sbjct: 520 NELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETR 579

Query: 541 IKELSDE------LAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIID 594
           I  L  E      LA  ++ K    S+++M   E        +L  +LS+    +  II 
Sbjct: 580 INILLRERDSYKLLASTEENKANTNSVTSM---EAAREKKIRELEAELSSTKVENSAIIQ 636

Query: 595 ALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXX 654
            L  E+    ++      +L+  ++ + LA+++  +LE                      
Sbjct: 637 NLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE------------- 683

Query: 655 XILDKEKQF--SY-------SSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKK 705
             L+K+K +  SY       +S +    + K+ + E EI+ L+ E    I T+ +L    
Sbjct: 684 --LEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDF 741

Query: 706 EALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXRM 765
           E    E+  L+M + +    +NE +      +  Y  K+K                   +
Sbjct: 742 EQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEI 801

Query: 766 SELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELT------ 819
             ++S  DS++KW + TIDD +  +                 S  +EN+  EL       
Sbjct: 802 ESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQY 861

Query: 820 --LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIK 877
             L  + D S  +  L KEL +++ QL+ +N +++ YE +IS++    EN  I+ ++ + 
Sbjct: 862 KFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSN----ENALIELKNELA 917

Query: 878 ALASKLDSEL----RERTTLQENLSTLQARM 904
                 D+++    +E+   +E+LS L+  +
Sbjct: 918 KTKENYDAKIELEKKEKWAREEDLSRLRGEL 948

 Score = 65.9 bits (159), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 1183 EHDSLVQEMKDNFEKE-KSSLLSQQEQEIEKLTDNERKLREF---YEEEIQKKVSQAEEN 1238
            E D ++ E    FEK+ + +L      E E   D E   +E+   YE+E  +++ +AEEN
Sbjct: 1395 EKDRIIDERTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEEN 1454

Query: 1239 LKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSL 1277
            LKKRIRLP+EE+I  II KRK ELE  F +K+KE A SL
Sbjct: 1455 LKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSL 1493

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  114 bits (284), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 186/362 (51%), Gaps = 29/362 (8%)

Query: 191 AELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQL 250
           A L   NE LS DL+ K+  IK L+++L +S  +F  E  L+ ++   L N+I + ++Q+
Sbjct: 246 ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQI 305

Query: 251 ESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPXXXXXXX 310
           E L+ +  + P      + ++++++ +L EKL  SE+E   L  +++++ NI        
Sbjct: 306 ERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK---- 355

Query: 311 XXHASGRNNSALSLSGD----VNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSSY 366
                      +S  G+    + ILR+                   L ELE+ +P + S+
Sbjct: 356 ----------LISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSF 405

Query: 367 KERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQV 426
           KER++ LE+EL      LE   KE   K  EL   + + SN     + L  QR+ LA QV
Sbjct: 406 KERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQV 465

Query: 427 KYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNR 486
           +YLLL I N     S    K+  L+ + ++    E  +DS KI+ +RL  F+NVKELQ +
Sbjct: 466 QYLLLCIDN----KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQK 521

Query: 487 NMQLLQVSRELASKAEKLEKVNLKQIS-SEEDETINDAKEAILVLQEYSQKLESQIKELS 545
           NM+LL+ +R+L    E+ E+   K +  ++ ++ +  AK   + L+++ + LES+I  +S
Sbjct: 522 NMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIIS 581

Query: 546 DE 547
            E
Sbjct: 582 QE 583

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 104/174 (59%), Gaps = 26/174 (14%)

Query: 1183 EHDSLVQEMKDNF----EKEKSSLLSQQE-------QEIEKLTDNERKLREFYEEEIQKK 1231
            E D L+++MK  F    EKEK ++L+Q++       QE   + + ++K  E  E  I K+
Sbjct: 1306 EKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKR 1365

Query: 1232 VSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXX 1291
            +++AEENLKKR+RLP+EEKIN +IEKR+  LE  FE K++E    L L++          
Sbjct: 1366 ITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE----LGLNA-------DGN 1414

Query: 1292 XXXXSGRETLQQEFDEQLNI----VRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
                  R  +++E  E+ N+    ++KKAFEEGKQ  +MKS  LERK+S LE Q
Sbjct: 1415 GVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  109 bits (272), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 132/456 (28%), Positives = 217/456 (47%), Gaps = 50/456 (10%)

Query: 353 LQELERNMPSLSSYKERSTFLEKELNSSNILLEHI---KKENLDKSAELEKKESECSNLR 409
           L ELE+ +P + ++K     L+  LN  N+++E +   KKENL     ++K  +E S   
Sbjct: 222 LNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKS--- 278

Query: 410 SSINSLAFQRTVLARQVKYLLL--IIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSE 467
           SSI +L  QRT LA Q++YLL+   IQN+      L + ++  +   +  +     SD +
Sbjct: 279 SSIEALDIQRTDLAHQLQYLLIHSSIQNDN--NGPLSKSEILFMQNLINKDKQRLSSDVQ 336

Query: 468 KILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAI 527
            ++ +RL +FK++  LQ +NM+L +  R LA   E  E        + +++TIN+AKE I
Sbjct: 337 SVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETI 396

Query: 528 LVLQEYSQKLESQIKELSDEL-----AVQKKEKTEKESISAMSKIEDDASSHTIDLGKQL 582
           L LQEY+  L+ +I  L  ++     ++   +++EK+  +  S +  D  S    L K L
Sbjct: 397 LSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFNYHSNLVKDLESK---LSK-L 452

Query: 583 SANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXX 642
           SA   +S+  I+ LN +I+NL+   TD+ I+L+KEKS+  LA ++  LL+          
Sbjct: 453 SA---YSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLEN 509

Query: 643 XXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLR 702
                        + ++EK  +    DYI CK+ L         L   N L     T L 
Sbjct: 510 EELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNL---------LDFTNRL-----TLLN 555

Query: 703 TKKEALLNERNNLRM-------TVTQMNSLNNELQTLLKETKSGYDDKLK-----ISAL- 749
             K  L  E N+L+         +  ++S +  L+  L+   S Y DK+K     IS L 
Sbjct: 556 NNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLN 615

Query: 750 -KCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATID 784
            +              + +L S N  +I WY+  +D
Sbjct: 616 EQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 126/466 (27%), Positives = 230/466 (49%), Gaps = 42/466 (9%)

Query: 179 IDN---ELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQL 235
           IDN   E+ +    N  L  +N+ELS++++ K+ EIK   +   T   +FL E  L+D++
Sbjct: 169 IDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRI 228

Query: 236 INALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHS 295
            ++L+ Q+K +Q++ +S+ +E      T + +  +++ Q+ +  ++L+ S  E   L   
Sbjct: 229 NSSLETQLKEIQQE-KSIQNE----DNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSY 283

Query: 296 MEEFQNIPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQE 355
           + EF N                          +    ++F                 + E
Sbjct: 284 VNEFINDVNGEYSSSSSLLKKELLKVKEQKDYLETQVENF-----------------ITE 326

Query: 356 LERNMPSLSSYKERSTFLEKELNSSNILLEHI--KKENLDKSAELEKKESECSNLRSSIN 413
           LE  +P + S ++++  LEKEL+    L++ I  ++E+L+K  +  K++SE ++    I 
Sbjct: 327 LEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHND--GMIQ 384

Query: 414 SLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLER 473
           +L  QR+ LA Q+++LLLI+    T  + L + + + + +    +T    +DS+ I+ ER
Sbjct: 385 TLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISER 444

Query: 474 LAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEY 533
           L +F ++ ELQ +NM +L   R LA + E+ EK+      + E +T+ +AK+A+L LQEY
Sbjct: 445 LLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQEY 504

Query: 534 SQKLESQIKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDII 593
           +  LE +++    E  V K     K   S      +D   HT   GK L   L+ +++  
Sbjct: 505 TNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTT--GK-LQNELQQTREY- 560

Query: 594 DALNSEIENLHQANTDV-------NISLDKEKSARKLAEDRYNLLE 632
             L  EIE L + N D+         S+ K +SA++ AE +  L+E
Sbjct: 561 --LTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIE 604

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 99/163 (60%), Gaps = 11/163 (6%)

Query: 1188 VQEMKDNFEKEKSSLLSQQEQEIEKLTDN--------ERKLREFYEEEIQKKVSQAEENL 1239
            V+E+ + FE  ++ +LS+Q + +    DN        +++LR+ +EE+  +++ +A+ENL
Sbjct: 1338 VRELNEKFESGRNEVLSKQSENV--TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENL 1395

Query: 1240 KKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXXXXSGRE 1299
            K+ IRLP+EEKI  IIEKR++ELES F+++++E+A  + L                   E
Sbjct: 1396 KRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELE 1455

Query: 1300 -TLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341
              ++Q+   +L  +R KAFEEGK+   MK+  LERK+S LE Q
Sbjct: 1456 HAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQ 1498

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 174/773 (22%), Positives = 340/773 (43%), Gaps = 80/773 (10%)

Query: 176 LTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQL 235
           L + + ELR+   + A L  + E LS++L  + ++I+ L ++ K    ++  E       
Sbjct: 166 LVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDE------- 218

Query: 236 INALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQ--IKNLNEKLEISERERLSLV 293
           IN  +++ + LQEQ+ SL  E        KL  HE   +  I    E++ + +R      
Sbjct: 219 INLQKHRARLLQEQVASLEKEA-------KLVGHETEPEYEIPPPGEEVALQQRS----- 266

Query: 294 HSMEEFQNIPXXXXXXXXXHASGRNNSALSLS---GDVNILRKHFXXXXXXXXXXXXXXX 350
           HS+                  +G + ++ S+S    +++IL                   
Sbjct: 267 HSI------------SMDSLLTGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVH 314

Query: 351 XILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRS 410
             + ELE+  P + S+K++S   + +++   + LEH+ K+      E+E+ + +   +  
Sbjct: 315 KFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISG 374

Query: 411 SINSLAFQRTVLARQVKYLLL---IIQNNETLGSSLGRKDLELLGQYLAANTAEA---MS 464
               L  +R  LARQ++YLLL   +  +++ L SS    +   + + L  +  E     +
Sbjct: 375 QDKILRRERFDLARQLQYLLLNGFVKDSDDPLTSS----EFSYIKEILNTDPEEGNTSST 430

Query: 465 DSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAK 524
           DS+ I+ +R+ +FK++ ELQ +N+ LL   R L+ +AE LE+   K  S +  E IN+AK
Sbjct: 431 DSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER---KLESGDSIEAINEAK 487

Query: 525 EAILVLQEYSQKLESQIKELSDELAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSA 584
           + +L LQ+Y+  LE++++ L+++L   +   +  +     S + D   ++   L  +  +
Sbjct: 488 QTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSD--GNNIQALKNKYDS 545

Query: 585 NLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXX 644
            +  S + I  L S+I NL Q+ +D+    +   +++ L EDR  + +            
Sbjct: 546 LMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENST 605

Query: 645 XXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTK 704
                      + ++E + S + + Y+ C +KL   + ++ +   E ++    Q+++  K
Sbjct: 606 LRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENK 665

Query: 705 KEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCXXXXXXXXXXXXR 764
               L ERNN +  + Q+ +L       LK+ +    +K+    L+              
Sbjct: 666 LNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETS 725

Query: 765 MSELKSQNDSEIKWYKATIDDLKANVFXXXXXXXXXXXXXXXFSKTLENVQNELTLANSK 824
            S   +   +E++WY+   D L  +                  +   + +   L  ANSK
Sbjct: 726 PSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSK 785

Query: 825 -----------DVSEEKRALEKELSEVKSQLEKSNLE-------VKEYEN---VISTSKR 863
                      DV++   ALE EL+  +++L  ++ E       +++Y++   V++  + 
Sbjct: 786 NKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQS 845

Query: 864 SFENKSIQYEDRIKALASKL---DSEL-RERTTLQENLSTLQARMVVQQDELT 912
             EN++    D I  L  +L     E  RE+  L + LS L+ R    Q ELT
Sbjct: 846 ELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIR----QAELT 894

 Score = 43.5 bits (101), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 25/173 (14%)

Query: 1234 QAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSXXXXXXXXXXXX 1293
            Q E + K+R+ L  +EK + ++  +  ELE  F+ +++ + K L                
Sbjct: 1406 QWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKEL------NALKDEIEEK 1459

Query: 1294 XXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQXXXXXXXXXXXX 1353
              +G E       + L  V+K+AFEEGKQ   MK + LERKI+ LE +            
Sbjct: 1460 CKTGHE-------DTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSV 1512

Query: 1354 XXXXXVSSTDEHNSSIQGN-PFFNLGKEQMNVPRFXXXXXXXXXXXXLNPFTS 1405
                    T  +N   Q N PF        +V                NPFT+
Sbjct: 1513 SEDAPRFVTPNNNKVQQANQPFLATAGSGFSV-----------QSSESNPFTT 1554

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/189 (34%), Positives = 103/189 (54%), Gaps = 22/189 (11%)

Query: 1168 EEQLNGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIEKLTDNERK-------- 1219
            E  + G+ N+E    ++   ++++K  FE EK  L+ +   E+ +  + E+K        
Sbjct: 1272 ENPIQGSVNVE----DYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNNNAN 1327

Query: 1220 ---LREFYEEEIQKK----VSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKE 1272
               LR+  EEE ++K    + +A+ENLKK IRLPTEEKI  +I KRK++LE  F+ K+ E
Sbjct: 1328 LEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAE 1387

Query: 1273 EAKSLLLHSXXXXXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLE 1332
            +A  L L                  RE ++   +E   +++KKAFEEG+Q   MK+  LE
Sbjct: 1388 QANLLKLSELSNKTADELEKEV---REEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLE 1444

Query: 1333 RKISMLEGQ 1341
            RKI+ LE +
Sbjct: 1445 RKIAKLEAR 1453

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 97/427 (22%), Positives = 179/427 (41%), Gaps = 88/427 (20%)

Query: 159 ESYKDRKELEYQNVMENLTAIDNELRMTNGKNAEL------FKRNEELSKDLRGK----I 208
           E+ + + EL+   + E L   +  +  TNG+  E       F+R++     +RGK    +
Sbjct: 107 ETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSL 166

Query: 209 SEIKSLENS----------------------------LKTSNGDFLSEKQLQDQLINALQ 240
           SEIK+L +S                            L +   DF  E   +D+L   L+
Sbjct: 167 SEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLK 226

Query: 241 NQIKTLQEQL----ESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSM 296
            Q+ +L  +L    E+ +  + +D   ++  +HE   +I N  E++E    E L ++   
Sbjct: 227 KQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHE--EEISNYKEQVE----ELLGILG-- 278

Query: 297 EEFQNIPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQEL 356
              Q  P                        +  LRK                   + EL
Sbjct: 279 ---QGAPS-----------------------IAHLRKLLLKERKENVSLKKQMESFVIEL 312

Query: 357 ERNMPSLSSYKERSTFLEKELN-SSNILLEHIKKENLDKSAELEKKESECSNLRSSINSL 415
           E  +P L   ++++  ++++L+ ++N ++E   K  +    EL     +  +L    + L
Sbjct: 313 EHRLPGLQILEKQNKEVQQKLHAATNKMIEE-SKAKIRTQRELSSSRQKVDHLNQIFHKL 371

Query: 416 AFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLA 475
             QR+ LA Q+++LL +  ++  L  S    +L  +   +     +A  DS++I+ +RL 
Sbjct: 372 RVQRSDLAHQIQFLLTVNSSDTVLPPS----ELSFIKTIIENENWDAYKDSQRIVSDRLL 427

Query: 476 QFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQ 535
           +F N+ ELQ +NM+L+   R L  K E  E  N   +      T+  AK  I  L++ + 
Sbjct: 428 RFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNA 481

Query: 536 KLESQIK 542
           +LES++K
Sbjct: 482 QLESEVK 488

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 159/643 (24%), Positives = 294/643 (45%), Gaps = 52/643 (8%)

Query: 158 FESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENS 217
           F + K     E +N  + L +++ +  +   +N    +RN EL+  +  ++ + KSLEN 
Sbjct: 211 FYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLEND 270

Query: 218 LKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDE-KFDDPGTQKLDKHELLRQIK 276
           L      F  E  L        Q++   L+E +E L +  K    GT  L+K  LL ++ 
Sbjct: 271 LNELKESFTREMTLT-------QHENDLLKEHIEYLKNTTKETTGGTSTLEKDRLLHELV 323

Query: 277 NLNEKLEISERERLSLVHSMEEFQNIPXXXXXXXXXHASGRNNSALSLSGDVNILRKHFX 336
           ++ + LE SE E + L   +E++                   N   +   ++ +L++   
Sbjct: 324 DIKKSLEKSELENVHLNDFIEQYLT----------------ENEESTSDNELVLLKEQLI 367

Query: 337 XXXXXXXXXXXXXXXILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLDKSA 396
                           + ELE  +P+++S K+R+  LE+EL     LLE  ++E+  +  
Sbjct: 368 KEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIK 427

Query: 397 ELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLA 456
           EL  +         +IN L  QR  LA QV++LLL +   +     L   ++  L + + 
Sbjct: 428 ELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIK 487

Query: 457 ANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEE 516
           +  ++  SDS+KI+ ERL +F ++  LQ +NM+LL  +R LA + E  +  ++++I    
Sbjct: 488 SRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKI---- 543

Query: 517 DETINDAKEAILVLQEYSQKLESQIKELSDE------LAVQKK-EKTEKESI-SAMSKIE 568
             T N++KE I  LQE    L S++++L  E      L++Q   E+T  E + S + K E
Sbjct: 544 --TRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQLQKKE 601

Query: 569 DDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRY 628
           +  +   ++    L ++L   K  +  LN  I  L +   D+N ++ KE S R +AE + 
Sbjct: 602 EQLTK--LERMSSLDSHLAEEKAKV--LNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKS 657

Query: 629 NLLEYXXXXXXXXXXXXXXXXXXXXXXILDKEKQFSYSSRDYISCKSKLSTAEAEITSLR 688
            +LE                       + D   +    SR+  + ++K+S  + EI S +
Sbjct: 658 KMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYK 717

Query: 689 AENEL--SIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQ---TLLKETKSGYDDK 743
            +N L  S + + TL +K  A   E+  L    ++++++ NEL+    L++E ++ Y + 
Sbjct: 718 -QNLLQYSKDNENTL-SKLAAATQEKETLG---SRLSTVKNELEQKINLMQERETYYKEH 772

Query: 744 LKISALKCXXXXXXXXXXXXRMSELKSQNDSEIKWYKATIDDL 786
             IS                 + + +++ +S+I WY+  +D L
Sbjct: 773 DSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSL 815

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 74/132 (56%), Gaps = 38/132 (28%)

Query: 1225 EEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSE---------------LESSFEQK 1269
            EE I ++++ AEENLKKRIRLP+EEKIN +IEKR+ E                E++ E++
Sbjct: 1481 EEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIEEE 1540

Query: 1270 IKEEAKSLLLHSXXXXXXXXXXXXXXSGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSA 1329
            +++E +                      RE L+ +FD +L  V+KKAF EGKQ   MK+ 
Sbjct: 1541 LRKEVE----------------------RE-LRVKFDNELAEVKKKAFLEGKQQSQMKTT 1577

Query: 1330 FLERKISMLEGQ 1341
             LERK+S LE Q
Sbjct: 1578 LLERKLSKLESQ 1589

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 140/631 (22%), Positives = 275/631 (43%), Gaps = 58/631 (9%)

Query: 87  QIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQKQH 146
           Q++ +    N+V  E   L +   +L  ++E  K   L  + +L+K++ T +    + + 
Sbjct: 62  QLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRE 121

Query: 147 TESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRG 206
            ES+  +   +  +  D ++ + Q +   +  + N++ +   K  +L K   +   +L+ 
Sbjct: 122 LESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKE 181

Query: 207 KISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQK- 265
           KISE+ +L+ S K       SE +L+D++I      I  L  ++ESL + + ++  +   
Sbjct: 182 KISELLALDTSFK-------SETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDIN 234

Query: 266 ----------LDKHELLRQIKNL---NEKLEISERERLSLVHSMEEFQNIPXXXXXXXXX 312
                     +DK E  R +      NEK++  + +   L  ++ EFQ+           
Sbjct: 235 IEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQS----------- 283

Query: 313 HASGRNNSALSLSGDVNILRKHFXXXXXXXXXXXXXXXXILQELERNMPSLSS----YKE 368
             +G N  +     D  IL+K                  ++ ELE + P L++      E
Sbjct: 284 -KTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINE 342

Query: 369 RSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSS---INSLAFQRTVLARQ 425
               L KE N+S    EH K     K  E EKK    S L+ S   I +L  +   L  Q
Sbjct: 343 LELLLSKEKNTS----EHFK--TTIKEIENEKKNI-ISRLKLSDDKIETLREENNDLTNQ 395

Query: 426 VKYLLLI--IQNNETLGSSLGRKDLELLGQYLAANTAEAMS---DSEKILLERLAQFKNV 480
           ++++L+   IQN++     L   +++ +       T  + +   +S+ I+ +RL +F++V
Sbjct: 396 IQFMLISNSIQNDKY--GELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESV 453

Query: 481 KELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQ 540
             LQ +NM+L++  R +  K +  E     +  +E D+ +N+AKE IL +   S KL+ +
Sbjct: 454 ISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEK 513

Query: 541 IKELSDELAVQKK---EKTEKESISAMSKIEDDASSHTID-LGKQLSANLKHSKDIIDAL 596
           I EL  +L   +    EK   ES+ A +K+  +     +D L   +    K + +II   
Sbjct: 514 ISELQQQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQASNIISMN 573

Query: 597 NSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYXXXXXXXXXXXXXXXXXXXXXXI 656
             ++ +L+  N ++     K   +R + + + +LL+                       I
Sbjct: 574 FDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTI 633

Query: 657 LDKEKQFSYSSRDYISCKSKLSTAEAEITSL 687
             K++  + +  +++ CK+ L +   ++ SL
Sbjct: 634 RRKDETLNSTIANHVDCKASLLSVTNDMNSL 664

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 77/132 (58%), Gaps = 5/132 (3%)

Query: 405 CSNLRSSINSLAFQRTVLARQVKYLLLIIQN--NETLGSSLGRKDLELLGQYLAANTAEA 462
            ++  S++ +L  QR+ L  Q+ YLL I Q+  NE     L   +L  +   +A  T   
Sbjct: 356 LNDFESTVKTLLQQRSDLGHQINYLL-ITQSYLNEDNNKILTENELNFIRNLVAQPTNTW 414

Query: 463 MSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDE--TI 520
            ++++ I+ ERL +F NV +L  +N++L+ + REL +K E +EK N ++    E +  +I
Sbjct: 415 STETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSI 474

Query: 521 NDAKEAILVLQE 532
           ++AK+ ++VL+E
Sbjct: 475 DEAKQRMIVLKE 486

>SAKL0F04466g Chr6 complement(358639..360387) [1749 bp, 582 aa] {ON}
            some similarities with uniprot|P40563 Saccharomyces
            cerevisiae YIR003W Hypothetical ORF
          Length = 582

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 1137 EEKNKDALGTNKYMEQPNKVTTEAQEKIQDLEEQLNGAKNLETTSLEHDSLVQEMKDNFE 1196
            +E++KD +G  +  E      TE+ E  +++E   NG +NL   ++EHD  + E++ +FE
Sbjct: 496  DEESKDTMGNTENTEN-----TESTENTENME---NGNQNLRDGTVEHDEQIGEIQSSFE 547

Query: 1197 KEKSSLLSQQEQEIEKLTD 1215
            +    +L+ + + I+++TD
Sbjct: 548  ETSKDILNGETKNIKQVTD 566

>KNAG0H02160 Chr8 (388161..389849) [1689 bp, 562 aa] {ON} Anc_2.267
           YNL047C
          Length = 562

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 170 QNVMENLTAIDNELRMTNGKNA-----ELFKRNEELSKDLRGKISEIKSLENSLKTSNGD 224
           QNV   L A    L   + K A     E+  R EEL +DL  KI EIK L++  K S   
Sbjct: 159 QNVPSVLNAYHGALAAVSSKGAKELNNEVIPRLEELRRDLLVKIKEIKQLQSDFKNSCTK 218

Query: 225 FLS-EKQLQDQLINALQ 240
            LS  KQ   Q  NAL+
Sbjct: 219 ELSITKQELKQYWNALK 235

>NCAS0E01100 Chr5 complement(206838..210164) [3327 bp, 1108 aa] {ON}
           Anc_3.438
          Length = 1108

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 193 LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLS----EKQLQDQLINALQNQIKTLQE 248
           L  + EEL KDLR KI EIK +        GDF S      +L +QL+N   N I+ +  
Sbjct: 322 LIPKLEELRKDLRVKIQEIKDIH-------GDFKSNISHHVKLTNQLLNKYNNSIRIMNH 374

Query: 249 QLES 252
           Q  S
Sbjct: 375 QSHS 378

>Skud_14.284 Chr14 complement(523897..525867) [1971 bp, 656 aa] {ON}
           YNL047C (REAL)
          Length = 656

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 16/88 (18%)

Query: 191 AELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQL 250
           +E+  R E+L +DL  KI EIK+L++  + S G     K+LQ         Q K L +  
Sbjct: 267 SEIIPRLEDLRRDLLVKIKEIKALQSDFRNSCG-----KELQ---------QTKNLMKIF 312

Query: 251 -ESLSDEKFDDPGTQK-LDKHELLRQIK 276
            ESL D KF  P +   L K +L +QIK
Sbjct: 313 NESLKDCKFGTPKSDPFLVKLQLEKQIK 340

>Smik_16.126 Chr16 complement(224488..228138) [3651 bp, 1216 aa]
           {ON} YPL110C (REAL)
          Length = 1216

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 833 LEKELSEVKSQLEKSNLEVKEYENVI-STSKRSFENKSIQYEDRIKALASKLDSE--LRE 889
           + K+LS +K+  E+  L+V  YENV+ S S  +  N ++++ + I     + DS+  +RE
Sbjct: 227 ISKDLSLLKTIWEQVTLKVNAYENVVRSCSPNTNVNDNMEFFNIISVFIEEDDSKGLIRE 286

Query: 890 RTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKE 939
              L   LS +  R+++       N   +SE     D++L    +  D E
Sbjct: 287 LINLYSELSLIPTRIMIN----VLNKAAVSESLACIDAILQVIPSLNDPE 332

>YGR097W Chr7 (678695..682135) [3441 bp, 1146 aa] {ON}
           ASK10Component of RNA polymerase II holoenzyme,
           phosphorylated in response to oxidative stress; has a
           role in destruction of Ssn8p; proposed to function in
           activation of the glycerol channel Fps1p; paralogous to
           Rgc1p
          Length = 1146

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 142 KQKQHTESEYLSKEKHFESYKDRKELEYQNVME--NLTAIDNELRMTNGKNAELFKRNEE 199
           K  Q TES+  S    F  +      + Q +++  +L+  + + +++    + +  + EE
Sbjct: 230 KPVQTTESDNTSAASGFVKFGSGSIQDIQVILKKYHLSLANQQFKISKEITSTVIPKLEE 289

Query: 200 LSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLI 236
           L KDLR KI+EIK L    KT+ G  +   QL  QL+
Sbjct: 290 LRKDLRYKITEIKDLHGDFKTNIGAHI---QLTSQLL 323

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 451 LGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLK 510
           LG  LAAN    ++              NV  +  R M  +Q+   L +  +K +KVN  
Sbjct: 224 LGDLLAANIQPELTHPN--------SGYNVLNIYYRKM--VQIVGLLKNSTDKSKKVNYI 273

Query: 511 QISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAV-QKKEKTEKESISAMSKIED 569
             ++  D  I+D  +   V+Q Y+Q +  Q +   D + +  K E+ ++   S MSK ED
Sbjct: 274 IQTNYNDTNISDIDDNRKVIQIYAQHITPQKRNYDDHVNILTKGEQIQQTDKSVMSKPED 333

>Smik_6.183 Chr6 (302111..305551) [3441 bp, 1146 aa] {ON} YGR097W
           (REAL)
          Length = 1146

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 198 EELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLI 236
           EEL KDLR KI+EIK L    KT+ G  +   QL  QL+
Sbjct: 290 EELRKDLRYKIAEIKDLHGDFKTNIGAHI---QLTSQLL 325

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 33.5 bits (75), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%)

Query: 369 RSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVL 422
           R T L KEL ++  LLE  KKEN  K AEL + +S    L+ S+ +  F+  +L
Sbjct: 423 RITMLRKELATNEPLLERAKKENEVKRAELSENKSHVERLQESLTASGFKPELL 476

>ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some
           similarities with uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 684

 Score = 33.1 bits (74), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 153 SKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGK 189
           SK +H      +KEL Y+NV   L A D+ L  TNGK
Sbjct: 9   SKYRHVYGQPPKKELWYENVKVTLNAWDSNLIKTNGK 45

>Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W
           (REAL)
          Length = 876

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 64/119 (53%), Gaps = 14/119 (11%)

Query: 149 SEYLSKEKHFESYK--------------DRKELEYQNVMENLTAIDNELRMTNGKNAELF 194
           SEY  + KH ES +                KE +Y+++++ + A + E+   +GK   L 
Sbjct: 497 SEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKIEAKNIEISQISGKEQSLT 556

Query: 195 KRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESL 253
           ++NE LS +L+    ++  + N   T+  ++ ++   Q++++ AL ++ +TL+++++ L
Sbjct: 557 EKNESLSNELKTVQGQLDKINNLNITTKSNYENKISSQNEIVKALTSENETLKQRIQQL 615

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 53/89 (59%)

Query: 165 KELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGD 224
           KE +Y+++++ L A + E+    GK   L ++NE LS +L+    ++  + N   T+  +
Sbjct: 528 KEAQYEDLLKKLEAKNIEISQIFGKEQSLIEKNESLSNELKKAQDQLDKITNLNTTTKSN 587

Query: 225 FLSEKQLQDQLINALQNQIKTLQEQLESL 253
           + ++   Q++++ AL ++  TL+++++ L
Sbjct: 588 YENKISSQNEIVKALTSENDTLKQRIQQL 616

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 3/89 (3%)

Query: 182 ELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQN 241
           +L+++   N  L  R E+L +DL+ KI EIK L    +T+  + ++   +  QL+N   +
Sbjct: 280 QLKISKEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVA---ITGQLLNRYIS 336

Query: 242 QIKTLQEQLESLSDEKFDDPGTQKLDKHE 270
            +K +   +      K    GTQ   KH+
Sbjct: 337 SVKYMTTNVADSDSIKLQKKGTQIKPKHD 365

>Suva_10.36 Chr10 complement(71147..72661) [1515 bp, 504 aa] {ON}
            YLL036C (REAL)
          Length = 504

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 78/179 (43%), Gaps = 44/179 (24%)

Query: 841  KSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLSTL 900
            K+  EKS LE    + V  T K    NK +  E+ I+ + S   + L E T    N +TL
Sbjct: 20   KTVFEKSLLE----QYVRDTGKDPITNKPLSLEEIIEIVPSAQQASLIEST----NSATL 71

Query: 901  QARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSK-- 958
            +A   +         N L+ L+  +D+++LE   FK     LRS +       DSL+K  
Sbjct: 72   KANYSIP--------NLLTSLQNEWDAIMLEN--FK-----LRSTL-------DSLTKKL 109

Query: 959  ---SYER---------IMQENSELSKVVELLREEVKNRTSNGEKEGDLEDTESIIKKGQ 1005
               +YER         +M EN E S+ +    E+    T     +G L+ +   + +G+
Sbjct: 110  STVTYERDAAKLVAAQVMMENDEFSRGLSKSPEQPVAVTREAFLQGLLQSSRDFVARGK 168

>Suva_7.380 Chr7 (654400..657834) [3435 bp, 1144 aa] {ON} YGR097W
           (REAL)
          Length = 1144

 Score = 33.1 bits (74), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 198 EELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLI 236
           EEL KDLR KI+EIK +    KT+ G  +   QL  QL+
Sbjct: 288 EELRKDLRYKITEIKDIHGDFKTNIGAHI---QLTSQLL 323

>TBLA0H00380 Chr8 complement(73665..73883) [219 bp, 72 aa] {ON}
           Anc_2.426 YKL138C-A
          Length = 72

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 3/47 (6%)

Query: 165 KELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEI 211
           KE +YQ++ + L  + N L++TNG   EL K N  ++K++  +I +I
Sbjct: 5   KERQYQHLAQQLETLQNNLKITNG---ELVKLNNSVNKNMIDQIGKI 48

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
           ZIP1Transverse filament protein of the synaptonemal
           complex; required for normal levels of meiotic
           recombination and pairing between homologous chromosome
           during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 55/89 (61%)

Query: 165 KELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGD 224
           KE +Y+++++ L A + E+   +GK   L ++NE LS +L+    +++ L N   T+  +
Sbjct: 527 KEAQYEDLVKKLEAKNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSN 586

Query: 225 FLSEKQLQDQLINALQNQIKTLQEQLESL 253
           + ++   Q++++ AL ++  TL+++++ L
Sbjct: 587 YENKISSQNEIVKALVSENDTLKQRIQQL 615

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]
           {ON} Anc_3.455 YPR122W
          Length = 1197

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 837 LSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRI----KALASKLDSELRERTT 892
           L E+ S++ K  LE+  +EN+ S S+  FE+ +I+Y + +    + L+S   SEL E   
Sbjct: 391 LREIISKVFKGTLELVRWENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTE--L 448

Query: 893 LQENLST 899
           LQ +L T
Sbjct: 449 LQHSLRT 455

>Kwal_23.3864 s23 (465097..466368) [1272 bp, 423 aa] {ON} YBR130C
            (SHE3) - involved in cell polarity [contig 255] FULL
          Length = 423

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 46/72 (63%), Gaps = 7/72 (9%)

Query: 1163 KIQDLEEQLNGAKN-LETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIE----KLTDNE 1217
            +++DLE+QL   KN  E  ++++ ++ Q+++ + ++E  S+L  Q Q+++     L D +
Sbjct: 118  RVRDLEQQLAQLKNSYEEAAVDNKNMRQQLQSSDQRE--SVLENQFQQLQVQYDALLDGQ 175

Query: 1218 RKLREFYEEEIQ 1229
             + RE YE+EIQ
Sbjct: 176  SRYREKYEQEIQ 187

>Smik_8.157 Chr8 complement(238878..239039,239120..239230) [273 bp,
           91 aa] {ON} YHR079C-A (REAL)
          Length = 91

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 837 LSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYE--DRIKALASKLDSELRERTTLQ 894
           +S +KSQL K   ++KEY+N+  +  ++FE  S+  E  +  K +ASK   EL+E   L+
Sbjct: 1   MSYLKSQLNKKQEQIKEYQNMNGSLIKTFEVLSVNKESNETPKEVASKYIKELKEYNELR 60

Query: 895 E 895
           +
Sbjct: 61  D 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.311 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,114,627
Number of extensions: 5676404
Number of successful extensions: 52109
Number of sequences better than 10.0: 2608
Number of HSP's gapped: 46662
Number of HSP's successfully gapped: 6191
Length of query: 1454
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1332
Effective length of database: 39,492,147
Effective search space: 52603539804
Effective search space used: 52603539804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 72 (32.3 bits)