Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H002005.704ON38938920400.0
ZYRO0G06556g5.704ON3793747731e-99
SAKL0E14960g5.704ON3843847722e-99
TDEL0B021605.704ON3753297564e-97
NCAS0A031905.704ON3983887393e-94
TPHA0D046205.704ON4063607282e-92
KNAG0C066105.704ON3863457167e-91
KLTH0E01012g5.704ON3863856871e-86
CAGL0G02519g5.704ON3783586703e-84
KLLA0A00550g5.704ON3803656662e-83
Kwal_55.196885.704ON3933666541e-81
NDAI0E050505.704ON4513686416e-79
AFR288C5.704ON4653356071e-73
Kpol_YGOB_Anc_5.7045.704ON2072023185e-34
Ecym_31386.48ON588961000.001
NDAI0K028706.48ON66299980.002
CAGL0L04554g6.48ON56096940.005
SAKL0E02068g6.48ON558150930.006
CAGL0K05995g6.48ON79499930.006
KNAG0M011106.48ON598109860.043
KAFR0G026206.48ON60183840.073
Suva_8.2246.48ON624114840.081
KLTH0C10406g6.48ON553134830.11
Kpol_1037.376.48ON622149830.12
AGR256W6.48ON57999800.23
Skud_12.3406.48ON68099790.30
TBLA0C07240singletonON687165780.41
YLR260W (LCB5)6.48ON68799780.43
YOR171C (LCB4)6.48ON624121770.52
ZYRO0C07084g6.48ON647107770.55
NDAI0I023706.48ON76099751.0
Skud_15.3336.48ON62761751.1
NCAS0F002306.48ON60596741.2
Kpol_1042.16.48ON65360741.4
Suva_10.3586.48ON68099731.7
Smik_12.3356.48ON67899732.0
TPHA0J005306.48ON58958722.0
KNAG0B033005.598ON45074722.1
TDEL0G042206.48ON63258722.1
TBLA0G004306.48ON95458722.2
TPHA0F024906.48ON67758722.6
KNAG0E027306.48ON74858713.2
KNAG0G018008.228ON1476156713.4
TBLA0E031806.48ON69458704.4
KAFR0A052506.48ON71777704.4
KLLA0F20504g6.48ON56796695.2
NCAS0D025106.48ON64661695.8
Kwal_23.5488singletonOFF111259695.9
Smik_15.3496.48ON62558686.5
Kwal_YGOB_23.54885.259ON135559696.6
Kwal_56.225506.48ON553134677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00200
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      790   0.0  
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   302   1e-99
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   301   2e-99
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    295   4e-97
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    289   3e-94
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   285   2e-92
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   280   7e-91
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   269   1e-86
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   262   3e-84
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   261   2e-83
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   256   1e-81
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   251   6e-79
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   238   1e-73
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   127   5e-34
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    43   0.001
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    42   0.002
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    41   0.005
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    40   0.006
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    40   0.006
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    38   0.043
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    37   0.073
Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON...    37   0.081
KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {...    37   0.11 
Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON} (90148....    37   0.12 
AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic ...    35   0.23 
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    35   0.30 
TBLA0C07240 Chr3 (1759547..1761610) [2064 bp, 687 aa] {ON}             35   0.41 
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    35   0.43 
YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON} ...    34   0.52 
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    34   0.55 
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    33   1.0  
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    33   1.1  
NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48 ...    33   1.2  
Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..425...    33   1.4  
Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260...    33   1.7  
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    33   2.0  
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    32   2.0  
KNAG0B03300 Chr2 complement(639238..640590) [1353 bp, 450 aa] {O...    32   2.1  
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    32   2.1  
TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48 ...    32   2.2  
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    32   2.6  
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    32   3.2  
KNAG0G01800 Chr7 (396618..401048) [4431 bp, 1476 aa] {ON} Anc_8....    32   3.4  
TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.4...    32   4.4  
KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6...    32   4.4  
KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]...    31   5.2  
NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {O...    31   5.8  
Kwal_23.5488 s23 (1184186..1187521) [3336 bp, 1112 aa] {OFF} YJL...    31   5.9  
Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {...    31   6.5  
Kwal_YGOB_23.5488 s23 (1184186..1188253) [4068 bp, 1355 aa] {ON}...    31   6.6  
Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260...    30   7.8  

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MSQLATTIEPLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYENVVVIDS 60
           MSQLATTIEPLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYENVVVIDS
Sbjct: 1   MSQLATTIEPLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYENVVVIDS 60

Query: 61  VSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISG 120
           VSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISG
Sbjct: 61  VSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISG 120

Query: 121 DTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180
           DTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ
Sbjct: 121 DTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180

Query: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240
           PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY
Sbjct: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240

Query: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300
           DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL
Sbjct: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300

Query: 301 NYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCDGLLFNLRDML 360
           NYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCDGLLFNLRDML
Sbjct: 301 NYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCDGLLFNLRDML 360

Query: 361 PENPTKEDYVLKTNFKSRDSLPFEVQVLK 389
           PENPTKEDYVLKTNFKSRDSLPFEVQVLK
Sbjct: 361 PENPTKEDYVLKTNFKSRDSLPFEVQVLK 389

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  302 bits (773), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 236/374 (63%), Gaps = 10/374 (2%)

Query: 16  GSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYEN-VVVIDSVSSGTGRNKNNHFY 74
           G   + V   KDGSKY +F+L     K     S    ++ ++V+DS+ SG GR +NN FY
Sbjct: 11  GEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRASTRSDDSTLIVLDSLKSGIGRTENNDFY 70

Query: 75  NIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPL 134
           +IVI PI +     H+Y KTT   S+S +A+SLD  + Y +  ISGDT+ISEF NNLP  
Sbjct: 71  SIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNLPNK 130

Query: 135 LETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPNG 194
             T N L+    ILPLPMGTGNA+++S+G   PI    ++L++  +P   PLY    PNG
Sbjct: 131 KITRNPLR----ILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186

Query: 195 KTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELDLS 254
            ++IFF+I SLG HAN+LH CE DP+Y K G ERF++A + ++ +Y L++ + +  L  S
Sbjct: 187 YSIIFFMIFSLGFHANLLHACE-DPKYAKMGAERFQIAAQSILESYSLDLDISLDGLRRS 245

Query: 255 GAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDE 314
             ++YF LINTPNLE++Y PSP S+P   +L +LGYSSSL  ++L+  + QGY NK   +
Sbjct: 246 --YAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGD 303

Query: 315 LVESSNMVYKPISRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENPTKEDYVLKT 373
           L  + +M+YK I+ + ++VL +  E+S  +K++ICCDG+L NL D    +  K    ++ 
Sbjct: 304 LPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRF 363

Query: 374 NFKSRDSLPFEVQV 387
            F + D   F++QV
Sbjct: 364 QFLN-DYSGFQLQV 376

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  301 bits (772), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 242/384 (63%), Gaps = 13/384 (3%)

Query: 9   EPLCTVNGSQSFEVKITKDGSKYHAFKLVAKE---VKDDKPCSPPHYENVVVIDSVSSGT 65
           +PL  + GS  + V I KDGS Y +F L A++   V       P     ++++DSV SG 
Sbjct: 7   KPLLQI-GSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSLISLPSANSELIILDSVMSGI 65

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           GR     F   VIKPI +    +H   KT    SI+ +A+ ++ SKSYT+IF+SGDTSIS
Sbjct: 66  GRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSIS 125

Query: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFP 185
           EF+N++P   + SN  KH ++I P+PMGTGNA++SS+  KCP+++   FL N    S FP
Sbjct: 126 EFLNHIPT--QNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFP 182

Query: 186 LYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVR 245
           LY   FPNG + IFFIILS+G HAN+LHLC N  +YK  G ERFK A  ++   YDL  +
Sbjct: 183 LYRASFPNGYSTIFFIILSIGFHANLLHLC-NHSKYKVMGVERFKAASAQIFKNYDLKYK 241

Query: 246 LQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQ 305
           + IP   +SG ++YF +INTPNLE +Y PSPLSDP    LH+LG+ SSL + +L+  +T+
Sbjct: 242 VSIPN-RVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITR 300

Query: 306 GYSNKLGDELVESSNMVYKPISRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENP 364
           G + + GD++++ + ++Y+ + ++  IV+      S++ K++ICCDG L NL DM     
Sbjct: 301 GRTAQKGDDIMD-TGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEG 359

Query: 365 TKEDYVLKTNFKSRDSLPFEVQVL 388
           +  D  +K +F  +D  PF ++VL
Sbjct: 360 S-FDGTIKVSFL-QDYSPFNLKVL 381

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  295 bits (756), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 151/329 (45%), Positives = 220/329 (66%), Gaps = 13/329 (3%)

Query: 34  FKLV--AKEVKDDKPCSPPHYENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHY 91
           F+LV  A   +DD+     +  N++VIDSV SG GR   N  Y IV+KPIF+   I H  
Sbjct: 28  FQLVKTATTTEDDRTVQ--NQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRL 85

Query: 92  FKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLP 151
            KTT   +I++YA +LD+S+S+TV+F+SGDTSISEFINNLP    ++N     +SIL  P
Sbjct: 86  IKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFINNLPQGAPSAN-----LSILSFP 140

Query: 152 MGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANV 211
           MG+GNA++SS+G  CP++T   F+      S FPLY+ +FPNG +++FFIILS+G HAN+
Sbjct: 141 MGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANL 200

Query: 212 LHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELDLSGAFSYFILINTPNLESS 271
           +H CE  P+Y++ G E+F+LA   ++  Y+L++++ +    L+ ++SYF LINTPNLE +
Sbjct: 201 VHACER-PEYQRMGIEKFQLAGSVILKEYELDLKITVNS--LAASYSYFALINTPNLEPA 257

Query: 272 YIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVS 331
           Y PSP SDP  E+L++LGYSS L+ +  L  V +GY     D+L   S+ +Y P ++   
Sbjct: 258 YRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGPSDKLPLDSDTIYVPFTKGFD 317

Query: 332 IVLT-EDEESEKYKYDICCDGLLFNLRDM 359
           + L     ES +YK +ICCDG+L NL+D+
Sbjct: 318 VTLDFPLLESPRYKSEICCDGVLLNLQDL 346

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  289 bits (739), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 162/388 (41%), Positives = 235/388 (60%), Gaps = 26/388 (6%)

Query: 20  FEVKITKDGSKYHAFKLVAKEVKDDKPCSPPH---------YENVVVIDSVSSGTGRNKN 70
           + V+   +GS Y +F L+   ++D  P S               ++VIDS+ SG GR  +
Sbjct: 17  YYVETVLEGSAYKSFNLL---IEDSTPLSVDRKLQFVPLKDTAQLIVIDSIHSGGGRTSD 73

Query: 71  NHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINN 130
           N FY  V++PIF    + H   KTT   S+  +A  LDL+K Y + F+SGDT+ISEFIN 
Sbjct: 74  NDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFFLSGDTTISEFING 133

Query: 131 LPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVI 190
           LP      N  K+++SILP P GTGNA ++S+G  CP    S++L +    ++FPLY+ I
Sbjct: 134 LPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTSNYSINNFPLYKAI 193

Query: 191 FPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPE 250
           FPNG  ++FF+ILSLG HAN+LH CE  P YKK G ERF++A E ++  YDL++ + I  
Sbjct: 194 FPNGNEIVFFVILSLGFHANLLHCCE-APHYKKLGVERFRIASEDILANYDLDLNISIES 252

Query: 251 ------LDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVT 304
                 +  S  +SYF+++NTP LE+ YIPSP S+P   QLH++ YSSSL  ++L+  + 
Sbjct: 253 PRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSSSLPKDELMARIL 312

Query: 305 QGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEE-SEKYKYDICCDGLLFNLRDMLPEN 363
           +GY N +GD +V ++ + Y PI  N  I L   +E S   K+ +CCDGLLFNL D + +N
Sbjct: 313 KGYENNIGD-VVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGLLFNLNDFIHKN 371

Query: 364 ---PTKEDYVLKTNFKSRDSLPFEVQVL 388
              P K + +L   F S  S PF++ ++
Sbjct: 372 DNGPCKNNEIL-IEFLSTYS-PFQLSLM 397

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  285 bits (728), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 158/360 (43%), Positives = 216/360 (60%), Gaps = 17/360 (4%)

Query: 16  GSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY----ENVVVIDSVSSGTGRNKNN 71
           G   ++V   K GSKY +FKL + +  ++      H       +VVIDS+ SG GR   N
Sbjct: 17  GDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGRTGQN 76

Query: 72  HFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNL 131
            FYN V+KP+F     +H Y +T G  SI   A   + SK YT+IF+SGDTS+SEFINNL
Sbjct: 77  DFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEFINNL 136

Query: 132 PPLLE----TSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLY 187
             + +    + +  K  ++I  +P+GTGNA +SSI    P Q    FL+N      FPLY
Sbjct: 137 TKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLY 196

Query: 188 EVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQ 247
            V  PN KT+IFFII S+G HAN+LH C++D +Y+K G ERF  A E +   YDLN+ L 
Sbjct: 197 TVTLPNKKTIIFFIIFSMGFHANLLHACDSD-EYQKMGTERFAKASENIFKNYDLNIGLT 255

Query: 248 IP--ELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQ 305
                  +S  ++YF +INTPNLE +Y+PSP SD F  +LH+LGY +SL+ E L+N +  
Sbjct: 256 TKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMA 315

Query: 306 GYSNKLGDELVESSNMV-YKPIS---RNVSIVLTEDEES--EKYKYDICCDGLLFNLRDM 359
           GYS K  +++    N+  Y P++     + I+L  D +   EKYKYDICCDGLL NL D+
Sbjct: 316 GYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLLNLDDI 375

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  280 bits (716), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 213/345 (61%), Gaps = 11/345 (3%)

Query: 17  SQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY---ENVVVIDSVSSGTGRNKNNHF 73
            +   V+I KDGSKY  F L+++    +  C+PP     EN++V+DSV SGTGR   N  
Sbjct: 14  GERISVEIDKDGSKYTKFALLSEPCPQE--CAPPQLFTRENLIVLDSVHSGTGRTSGNDI 71

Query: 74  YNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPP 133
              VI+P+      ++   K+   KS++ +   LD ++SYT++F+SGDTS+SEF N +  
Sbjct: 72  TVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSGDTSVSEFFNGVGA 131

Query: 134 LLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPN 193
            + +    + +++ILP+ MGTGNA ++S+   CP++  +SFL      + FPLY  I P+
Sbjct: 132 GVPSP---RSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAEFPLYRAILPD 188

Query: 194 GKT-VIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD 252
           G+T V+FFI+LSLG HAN+LH  EN+ +YK  G ERF+ A   ++  Y L  ++ + +  
Sbjct: 189 GETSVVFFIVLSLGFHANLLHAAENE-KYKSMGVERFQEASGDILQNYKLQEQITLDKQG 247

Query: 253 LSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLG 312
           ++G+++YF L+N PNLE+SYIPSP SDPF  +LH+L YSSSLN + LL  +  GY N+ G
Sbjct: 248 VAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERIMAGYKNRRG 307

Query: 313 DELVESSNMVYKPISRNVSIVLTEDEES-EKYKYDICCDGLLFNL 356
           DEL       YK IS    I L   +E      +++C DG L+NL
Sbjct: 308 DELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNL 352

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  269 bits (687), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 153/385 (39%), Positives = 233/385 (60%), Gaps = 14/385 (3%)

Query: 10  PLCTVNGSQSFEVKITKDGSKYHAFKLVAK--EVKDDK--PCSPPHYENVVVIDSVSSGT 65
           PL +   +Q F   +  D +KY +F LV++  E  D    P      ++++++DS+ SGT
Sbjct: 8   PLVSTAKTQ-FWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVDSIKSGT 66

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTV-IFISGDTSI 124
           GR+  N+F   V++P+F +  I H   +T    +      +   S   T+ IF+SGDT+I
Sbjct: 67  GRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFLSGDTTI 126

Query: 125 SEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHF 184
           SEF+N L        GL+HT+S++PLP+GTGNA+++S+G +CP  +LS FL  +  P  F
Sbjct: 127 SEFLNGLNR--RVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLTPRKF 184

Query: 185 PLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNV 244
           PLY+  FPNG  +IFFIILS+G HAN+LHLC+   +++  G ERFK+A  +++  Y L  
Sbjct: 185 PLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQ-RFQSLGVERFKIASLEILQKYPLEY 243

Query: 245 RLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVT 304
           RLQ+  L  +  +SYF LINTPNLE+SY PSP S+    QLHVLGYSS L    L++ + 
Sbjct: 244 RLQVSGLP-TRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSKIM 302

Query: 305 QGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKY-DICCDGLLFNLRDMLPEN 363
           +GYSN+ GD+ +    ++Y+P +  + +V  +  E+    Y +ICCDG L N+  + P++
Sbjct: 303 KGYSNRAGDD-ISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQD 361

Query: 364 PTKEDYVLKTNFKSRDSLPFEVQVL 388
             K D  ++  F    S  FE+ V+
Sbjct: 362 -QKFDGRIRIQFLKNFS-SFELNVM 384

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  262 bits (670), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 218/358 (60%), Gaps = 10/358 (2%)

Query: 4   LATTIEPLCTVNGSQSFEVKITKDGSKYHAFKLV-AKEVKDDKPCSPPHYENVVVIDSVS 62
           +A  +E LC  NG + + V+I +   K  ++KL+ A +   D          ++VIDSV 
Sbjct: 1   MAAIVE-LCRNNGIK-YSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVK 58

Query: 63  SGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS--YTVIFISG 120
           SGT RN  +  Y +VI+P+F    +++ Y KT    SI  +A+         Y ++F+SG
Sbjct: 59  SGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSG 118

Query: 121 DTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180
           DTSISEFIN L   +  S   K+ ISILP+P+G+GNA ++S+G K P+Q L ++L++  +
Sbjct: 119 DTSISEFINALDTTILRS--AKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKK 176

Query: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240
            S  PLY+   PN  ++IFFIILSLG HAN+LH C  DP+YK  G ERF++A + V  +Y
Sbjct: 177 CSPLPLYDAQLPNSTSMIFFIILSLGFHANLLH-CAEDPKYKSMGVERFQVASKTVFESY 235

Query: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300
           DLNV + +  L  S ++SYF +I  PNLE +Y PSP S    ++LH+LGY + +  EDL 
Sbjct: 236 DLNVGIAVNGLQ-SQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQ 294

Query: 301 NYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCDGLLFNLRD 358
           + + +GY NK G+++ E    +Y+   +N+ + +     + KY+YD+C DG L NL D
Sbjct: 295 DKIMRGYHNKDGEDIQEIGT-IYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLED 351

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  261 bits (666), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 224/365 (61%), Gaps = 23/365 (6%)

Query: 6   TTIEPLCTVNG-SQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYE---NVVVIDSV 61
            T + L   NG S +   K+  +G+K  +++L +K + D+K  +   +E    ++++DSV
Sbjct: 10  VTKQELGIYNGVSFTIVTKLLAEGAK--SYQLGSKLLDDEKLLANKKFEYSGELLIVDSV 67

Query: 62  SSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGD 121
            SG+GR+K+  F   VI   F+   + +   KTT   S+   A S+D ++ YTV+F+SGD
Sbjct: 68  FSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYTVLFLSGD 127

Query: 122 TSISEFINNLPPLLETSNGLKH-TISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQ 180
           TSISEF+NNLP        L H  IS+LP PMGTGNA++SS+    P    S F++ +  
Sbjct: 128 TSISEFVNNLP--------LNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLS 179

Query: 181 PSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTY 240
            + FPLY   F NG  + FFIILSLG HAN+LHLCE D +Y+K G ERF++A ++++  Y
Sbjct: 180 CNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEED-EYQKMGIERFRVASQRILREY 238

Query: 241 DLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300
            L  R+ IP++ L G+FSYF LINT NLE +Y+PSP SDP   QLHVL Y SSL+  +  
Sbjct: 239 KLESRVSIPDI-LEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVEFQ 297

Query: 301 NYVTQGYSNKLGDELVESSNMVYKPI--SRNVSIVLTEDEESEKYKYDICCDGLLFNLRD 358
             V  GYSN     ++++    Y+P+    NV ++   D+ S+K  +++CCDG L NL +
Sbjct: 298 KRVFMGYSNTKHSNILQNGTF-YRPLPFCFNVEVL---DDPSQKSNFEVCCDGQLLNLLE 353

Query: 359 MLPEN 363
           +  +N
Sbjct: 354 LEGKN 358

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  256 bits (654), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/366 (39%), Positives = 220/366 (60%), Gaps = 14/366 (3%)

Query: 4   LATTIE-PLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHY-----ENVVV 57
           +A  +E PL   + +Q F V +  +GSK  +F L+            P        +++V
Sbjct: 1   MAQIVEVPLVCSHNTQ-FSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILV 59

Query: 58  IDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLD-LSKSYTVI 116
           +DS+ SGTGR+  N F   VI+P+F    + +   KT    S++   ++     ++ TVI
Sbjct: 60  VDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVI 119

Query: 117 FISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLH 176
           F+SGDTSISEF+NNL    E    ++ T+++L LP+GTGNA+++S+G +     L+ FL 
Sbjct: 120 FLSGDTSISEFVNNLTQ--EQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQ 177

Query: 177 NRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKV 236
              +P +FPLY+ IFPNG  ++FFIILS+G HAN+LHLC+  P++KK G ERF+LA +++
Sbjct: 178 GFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCD-QPRFKKLGVERFRLASKEI 236

Query: 237 MTTYDLNVRLQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNN 296
              Y L+  LQ+ +  L   +SYF LINTPNLE +Y PSP S+P   +LH+LGYSS L  
Sbjct: 237 FEDYILDYPLQVTQRPLE-HYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQ 295

Query: 297 EDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEE-SEKYKYDICCDGLLFN 355
             L+N + +GYSN+   ++ E   + Y+  S ++ +V  +D E   +  +DICCDG L N
Sbjct: 296 PMLINRIMKGYSNQPETDINEEG-VTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLN 354

Query: 356 LRDMLP 361
           +    P
Sbjct: 355 MLSQQP 360

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  251 bits (641), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 214/368 (58%), Gaps = 49/368 (13%)

Query: 55  VVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYA-----KSLDL 109
           +++IDS  SG GRNK N FY I+++PI     I+   FKTT   SI ++A     K+ D 
Sbjct: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143

Query: 110 SK-SYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPI 168
           +K  Y +IF+SGDT+ISEF NNLPP  +     K  ++IL +PMGT NA+S+S+   CPI
Sbjct: 144 TKIDYNLIFLSGDTTISEFFNNLPP--QQPQTSKINLNILTIPMGTANAWSNSLNLNCPI 201

Query: 169 QTLSSFLHNRTQPSHFPLYEVIFPN------------GK-TVIFFIILSLGLHANVLHLC 215
                FL N+   S FPLY +I P+            GK T+ FFI+LS+G HAN+LHLC
Sbjct: 202 DIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLC 261

Query: 216 ENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD------LSGAFSYFILINTPNLE 269
            ND +Y   G ERFKLA +++++ Y+LN+ + I   +      L+ +FSYF L+NTP LE
Sbjct: 262 SNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLE 321

Query: 270 SSYIPSPLSDPFLEQLHVLGYSSS-LNNEDLLNYVTQGYSNKLGD---ELVESSNMVYKP 325
            +YIPSPLSDP    LHVL Y S   N + L+  + +GYSN+LG    + ++   ++Y P
Sbjct: 322 YNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFP 381

Query: 326 IS-RNVSIVLTE-----DEESEKYKYDICCDGLLFNLRDMLPENPTKEDYVLKTNFKSRD 379
           I+ +   I L          S  + Y++CCDG+LFNL +             +TN   +D
Sbjct: 382 INDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNY------------QTNQGKQD 429

Query: 380 SLPFEVQV 387
            + FE++ 
Sbjct: 430 KISFEIEA 437

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  238 bits (607), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 195/335 (58%), Gaps = 17/335 (5%)

Query: 29  SKYHAFKLVAKEVKDDKPCSPPHYENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQ 88
            K  + +L  +E +  +  +P     +VV+DSV SG GR     FY  V+ P+  +  ++
Sbjct: 113 GKLRSVELAVREGRGAEARAPGG--PLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVE 170

Query: 89  HHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISIL 148
           H Y +T+   S+   A++   +   TV+ +SGDT+ISEF+N L        G    +++ 
Sbjct: 171 HEYVRTSSAASVRELAETFPRTSETTVLVMSGDTTISEFVNAL--------GSGAGVTVY 222

Query: 149 PLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLH 208
            LP+GT NA++ S+G   P + L +F+  R     FPLY   FP+G ++ FFI+LS G H
Sbjct: 223 ALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFH 282

Query: 209 ANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD----LSGAFSYFILIN 264
           AN+LHLC ND +Y++ G ERF+ A  +++  Y L   +++   D    L+G ++YF L+N
Sbjct: 283 ANLLHLC-NDERYQRLGVERFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLN 341

Query: 265 TPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDELVESSNMVYK 324
           TP+LE +Y+PSPLSDP L+QLHVL + + L+ + L   +  GYS   G  L  +  +VY+
Sbjct: 342 TPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAGYSTIRGSAL-SAPGLVYR 400

Query: 325 PISRNVSIVLTEDEESEKYKYDICCDGLLFNLRDM 359
            +  + ++ + E+  S++   ++C DG L NL D+
Sbjct: 401 NLGDSFTLSI-ENGASDRVANELCVDGHLLNLVDL 434

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  127 bits (318), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 119/202 (58%), Gaps = 10/202 (4%)

Query: 191 FPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPE 250
           FP+   + FFIILSLG HA +LH C   P+  K G ERF+LA ++++ TYDL++ +++ +
Sbjct: 4   FPDDSRIYFFIILSLGFHATLLHACSR-PELLKMGTERFQLAAKEILETYDLDLNIKVNK 62

Query: 251 LDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNK 310
              +  ++YF +INT NLE +Y PSP S+     L +LGYSS L+  +L++ + +GY  +
Sbjct: 63  S--TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 311 LGDELVESSNMVYKPI---SRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENPTK 366
            GD +       Y+ +      + I++ E    S  +K++ICCDGLL    D++ ++  +
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLL---DLMEKSKGR 177

Query: 367 EDYVLKTNFKSRDSLPFEVQVL 388
            D +       +D L F++QVL
Sbjct: 178 TDNLTIHINSVKDYLSFDLQVL 199

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           GR + N  Y    KPI          F+T+ P+     A+++D+ K   +   SGD    
Sbjct: 212 GRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDIDKYDVIACASGDGIPY 271

Query: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E +N L    + +    + +++  LP G+GNA S S
Sbjct: 272 EVLNGLYRREDRAKAF-NKVAVTQLPCGSGNAMSVS 306

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K +  +N   KPI      +     TT     +  AKSLD+SK   +   SGD    
Sbjct: 272 GKGKASKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISKYDIIACASGDGIPY 331

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L   P  ++  N L    +I  +P G+GNA S S
Sbjct: 332 EVINGLYQRPDRVDAFNKL----TITQIPCGSGNAMSIS 366

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K  H +   I+PI    +      +T   +  +  A+ +DL +  T+   SGD    
Sbjct: 179 GKGKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIACASGDGVPY 238

Query: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L  + E      + I++  LP G+GNA S S
Sbjct: 239 EVINGL-YMREDKVDAFNKITVTQLPCGSGNAMSIS 273

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 62/150 (41%), Gaps = 16/150 (10%)

Query: 37  VAKEVKDDKPCSPPHYENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTG 96
           V +E+ D    S    ++++VI +   G GR   N  Y    KPI    +      +TT 
Sbjct: 164 VVEEILDRSYKSTKRNKSILVIINPHGGKGRA--NKLYVSKAKPILIASQCTVEILETTY 221

Query: 97  PKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGN 156
            +     A+++D+ K   +   SGD    E +N L    + +    + ++I  LP G+GN
Sbjct: 222 HRHAIDIAQNIDIDKYDVIACASGDGIPHEVLNGLYRRADRAKAF-NKVAITQLPCGSGN 280

Query: 157 AFSSSIGHKCPIQTLSSFLHNRTQPSHFPL 186
           A S S              H  + PSH  L
Sbjct: 281 AMSVS-------------CHGTSNPSHAAL 297

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KP+    +       T  P+     A+ +D+SK  T++  SGD    
Sbjct: 412 GKGKAKKLFMTKAKPLLSASRSTVEIKYTKYPQEAIDIAREMDISKYDTIVCASGDGIPY 471

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L   P  +E  N L    +I  LP G+GNA S S
Sbjct: 472 EVINGLYRRPDRVEAFNKL----AITQLPCGSGNAMSVS 506

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 3/109 (2%)

Query: 53  ENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS 112
           + ++VI +   G G+ KN  F      PI D     +    T   +     A+SLD+ K 
Sbjct: 190 KKMLVIINPFGGKGQAKNLFFQRAA--PILDASGSDYDIAYTERSRHAVEIAESLDIDKY 247

Query: 113 YTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
            T++  SGD    E +N L   ++      + I +  LP G+GNA S S
Sbjct: 248 DTIVCASGDGIPYEVLNGLYRRIDRVAAF-NKIVVTQLPCGSGNAMSIS 295

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 14/83 (16%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIG 163
           A+ LDL K  T++  SGD    E IN L    + SN   + + +  LP G+GNA S S  
Sbjct: 276 ARKLDLDKFDTIVCASGDGIPYEVINGLYQRTDRSNAF-NKLCVTQLPCGSGNAMSIS-- 332

Query: 164 HKCPIQTLSSFLHNRTQPSHFPL 186
                       H    PSH  L
Sbjct: 333 -----------CHGTGNPSHATL 344

>Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON}
           YOR171C (REAL)
          Length = 624

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 52/114 (45%), Gaps = 13/114 (11%)

Query: 53  ENVVVIDSVSSGTGRNKNNHFYNIVIKPIF--DIFKIQHHYFKTTGPKSISTYAKSLDLS 110
            NV+VI +   G G+ K    +    +PI      KI+  Y K    +     AK LD+S
Sbjct: 232 RNVLVIINPYGGKGKAKT--LFLTKARPILLESGCKIEIAYTKYA--RHAIDIAKDLDIS 287

Query: 111 KSYTVIFISGDTSISEFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           K  T+   SGD    E IN L   P  +E  N L    ++  LP G+GNA S S
Sbjct: 288 KYDTIACASGDGIPYEVINGLYRRPDRVEAFNKL----AVTQLPCGSGNAMSIS 337

>KLTH0C10406g Chr3 complement(862020..863681) [1662 bp, 553 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of long-
           chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 553

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 52/134 (38%), Gaps = 16/134 (11%)

Query: 53  ENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS 112
           + ++VI +   G G  K    Y   +KPI           +TT     +  AK++D  K 
Sbjct: 178 KTILVIMNPHGGKGHAKK--LYLSKVKPILAASNCTVETVETTYHGHATDLAKTVDADKF 235

Query: 113 YTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLS 172
             +   SGD    E +N L    + ++     I I  LP G+GNA S S           
Sbjct: 236 DIIACASGDGIPHEVLNGLFQRPDRADAFNKLI-ITQLPCGSGNAMSVS----------- 283

Query: 173 SFLHNRTQPSHFPL 186
              H  T PSH  L
Sbjct: 284 --CHGTTNPSHAAL 295

>Kpol_1037.37 s1037 (90148..92016) [1869 bp, 622 aa] {ON}
           (90148..92016) [1869 nt, 623 aa]
          Length = 622

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (44%), Gaps = 19/149 (12%)

Query: 19  SFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYENVVVIDSVSSGTGRNKN---NHFYN 75
           S  + IT  G+K      V +E+ D          +++V+ +   G G+ K    N  ++
Sbjct: 213 SLSIDITTIGAKGD----VVQEILDRSYKDAKRNRSILVVINPYGGKGKAKKLYLNKCHD 268

Query: 76  IVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNL---P 132
           I+I+    +  +  +Y    G  +I    + LD+SK  T+   SGD    E +N L   P
Sbjct: 269 ILIQSKCKVDIVYTNY----GGHAIDI-GRELDISKYDTIACASGDGIPYEILNGLYQRP 323

Query: 133 PLLETSNGLKHTISILPLPMGTGNAFSSS 161
             +E  N L    +I  LP G+GNA S S
Sbjct: 324 DRVEAFNKL----AITQLPCGSGNAMSIS 348

>AGR256W Chr7 (1223989..1225728) [1740 bp, 579 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR260W (LCB5) and
           YOR171C (LCB4)
          Length = 579

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K +  Y    KPI      Q    +T      +  A ++D++K   +   SGD    
Sbjct: 205 GKGKAHKLYVTKAKPILVASDCQIDVVETKYSSHAAEIAATMDINKYDVIACASGDGIPH 264

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E +N L   P  +   N L    +I  LP G+GNA S S
Sbjct: 265 EVLNGLFTRPDRVAAFNKL----AITQLPCGSGNAMSIS 299

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KP+    +       T  P      A+ +D+ K  T+   SGD    
Sbjct: 271 GKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPH 330

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L   P  ++  N L    +I  +P G+GNA S S
Sbjct: 331 EVINGLYRRPDRVKAFNQL----AITEIPCGSGNAMSVS 365

>TBLA0C07240 Chr3 (1759547..1761610) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 71/165 (43%), Gaps = 24/165 (14%)

Query: 161 SIGHKCPIQTLSSFLH--NRTQPSHFPLYEVIF----PNGKTVIFFIILSLGLHANVLHL 214
           S+ H+ P  T +   H   R      PL +       P    ++F +IL + +H +    
Sbjct: 47  SLSHQSPTNTCARISHALRRMANVKNPLMKKFLHFKGPIAILLLFSVILGISVHPH---- 102

Query: 215 CENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELDLSGAFSYFILINTPNLESSYIP 274
            ++ P  K Y  + FK       +  +++ + ++  LDL+ +  Y       NLE S I 
Sbjct: 103 -KSIPTAKNYILQTFK-------SVKEVSSKRELAALDLTSSIKY-----NNNLEKSAIN 149

Query: 275 SPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQGYSNKLGDELVESS 319
           S + +   +   + GY S+LN + LLN   Q    K G  L +S+
Sbjct: 150 SRIINQHYDDFKIKGYISNLNIDKLLNE-KQSKVEKAGSTLKDSN 193

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KP+    +       T  P      A+ +D+ K  T+   SGD    
Sbjct: 280 GKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPH 339

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L   P  ++  N     I+I  +P G+GNA S S
Sbjct: 340 EVINGLYQRPDHVKAFNN----IAITEIPCGSGNAMSVS 374

>YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON}
           LCB4Sphingoid long-chain base kinase, responsible for
           synthesis of long-chain base phosphates, which function
           as signaling molecules, regulates synthesis of ceramide
           from exogenous long-chain bases, localizes to the Golgi
           and late endosomes
          Length = 624

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 54/121 (44%), Gaps = 19/121 (15%)

Query: 52  YEN------VVVIDSVSSGTGRNKNNHFYNIVIKPIF--DIFKIQHHYFKTTGPKSISTY 103
           YEN      ++VI +   G G  KN   +    +PI      KI+  Y K    +     
Sbjct: 220 YENSKRNRSILVIINPHGGKGTAKN--LFLTKARPILVESGCKIEIAYTKYA--RHAIDI 275

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSS 160
           AK LD+SK  T+   SGD    E IN L   P  ++  N L    ++  LP G+GNA S 
Sbjct: 276 AKDLDISKYDTIACASGDGIPYEVINGLYRRPDRVDAFNKL----AVTQLPCGSGNAMSI 331

Query: 161 S 161
           S
Sbjct: 332 S 332

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 3/107 (2%)

Query: 53  ENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS 112
            +V+VI +   G G+ K    +    +PI    +       T   +     A+ +DL+K 
Sbjct: 260 RSVLVIINPHGGQGKAKK--LFMTKCRPILLASRCPIEIAYTKYGRHAVDIAREVDLNKY 317

Query: 113 YTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFS 159
            T+   SGD    E IN L    + +    + +SI  LP G+GNA S
Sbjct: 318 DTIACASGDGIPYEVINGLYQRKDRAAAF-NKLSITQLPCGSGNAMS 363

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIF---DIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDT 122
           G+ K    +    +P+    D F ++ HY K  G       AK +D+ K  T+   SGD 
Sbjct: 363 GKRKAKKLFMTKARPLLLASDCF-LEVHYTKYVG--HAIEIAKEMDIDKFDTIACASGDG 419

Query: 123 SISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
              E IN L    +      + ++I  +P G+GNA S S
Sbjct: 420 IPHEVINGLYRREDRVKAF-NKLTITQIPCGSGNAMSVS 457

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSS 160
           A+ LD+SK  T+   SGD    E IN L   P  ++  N     +++  LP G+GNA S 
Sbjct: 280 ARDLDISKYDTIACASGDGIPYEVINGLFRRPDRVDAFN----KVAVTQLPCGSGNAMSI 335

Query: 161 S 161
           S
Sbjct: 336 S 336

>NCAS0F00230 Chr6 (35422..37239) [1818 bp, 605 aa] {ON} Anc_6.48
           YLR260W
          Length = 605

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 1/96 (1%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KPI            T   +     AK LD++K   +   SGD    
Sbjct: 231 GKGKAKLLFEKKAKPILIASNCSLEIIHTKYSRHALDIAKDLDITKYDVIACASGDGIPY 290

Query: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L    + ++   + ++I  +P G+GNA S S
Sbjct: 291 EVINGLYQRPDRADAF-NKLTITQVPCGSGNAMSIS 325

>Kpol_1042.1 s1042 (2298..4259) [1962 bp, 653 aa] {ON} (2298..4259)
           [1962 nt, 654 aa]
          Length = 653

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 102 TYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           T A++LD++K  T+   SGD    E IN L    +      + ++I  LP G+GNA S S
Sbjct: 317 TLAEALDINKYDTIACASGDGIPYEVINGLYRRKDRVEAF-NKLTITQLPCGSGNAMSVS 375

>Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KP+    +       T  P      A+ +++ K  TV+  SGD    
Sbjct: 271 GKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHAVEIAEDMNIDKYDTVVCASGDGIPH 330

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E +N L   P  ++  N L    +I  +P G+GNA S S
Sbjct: 331 EVMNGLYRRPDHVKAFNKL----AITQIPCGSGNAMSVS 365

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K    +    KP+    +       T  P      A+ +D+ +  T+   SGD    
Sbjct: 271 GKGKAKKLFMTKAKPLLLASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIPH 330

Query: 126 EFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E IN L   P  ++  N L    +I  +P G+GNA S S
Sbjct: 331 EVINGLYRRPDHVKAFNKL----AITEIPCGSGNAMSVS 365

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           A+ +DLSK  T+   SGD    E IN L    +  +   + +++  +P G+GNA S S
Sbjct: 250 AREVDLSKYDTIACASGDGIPYEVINGLNQRSDRVDAF-NKLAVTQIPCGSGNAMSVS 306

>KNAG0B03300 Chr2 complement(639238..640590) [1353 bp, 450 aa] {ON}
           Anc_5.598 YHR011W
          Length = 450

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 201 IILSLGLHANVLHLCEND---PQYKKYGEERF---KLAFEKVMTTYDLN----VRLQIPE 250
           II SLGLHA VL++  ND   P YKKY  E +   K  F +V +  +       RL    
Sbjct: 336 IIESLGLHAKVLNMPANDLGNPAYKKYDIEVWMPGKGTFGEVSSASNCRDFQAFRLNTKF 395

Query: 251 LDLSGAFSYFILIN 264
            D +GA  Y   +N
Sbjct: 396 KDENGASQYAYTLN 409

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           A+ +DL K  T+   SGD    E IN L    + +      ++I  LP G+GNA S S
Sbjct: 292 AREIDLDKYDTIACASGDGIPYEVINGLYQRPDRAEAFTK-LAITQLPCGSGNAMSVS 348

>TBLA0G00430 Chr7 (86333..89197) [2865 bp, 954 aa] {ON} Anc_6.48
           YOR171C
          Length = 954

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
            K LD+ K  T++  SGD    E IN L    + +   +  ++I  LP G+GNA S S
Sbjct: 626 GKHLDIDKYDTILCASGDGIPYEIINGLYQRPDRAKAFEK-LAITELPCGSGNAMSVS 682

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           AK +D++K  T++  SGD    E IN L    + +      ++I  LP G+ NA S S
Sbjct: 338 AKEMDINKYDTIVCASGDGIPYEIINGLYQRKDRAAAFSK-LAITQLPCGSANAMSVS 394

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           AK++D+ K  T+   SGD    E IN L    +      + ++I  +P G+GNA S S
Sbjct: 403 AKNMDIEKYDTIACASGDGIPHEVINGLYRRHDRVRAF-NKLAITEIPCGSGNAMSVS 459

>KNAG0G01800 Chr7 (396618..401048) [4431 bp, 1476 aa] {ON} Anc_8.228
           YER164W
          Length = 1476

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 68/156 (43%), Gaps = 21/156 (13%)

Query: 158 FSSSIGHKCPIQTLSSFLHNRTQPSHFPLYEVIFPN-----------GKTVIFFIILSLG 206
           F S    +  +Q ++   H   Q +H  +Y ++  +            K ++ + I+SLG
Sbjct: 793 FDSDWNPQADLQAMAR-AHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLG 851

Query: 207 LHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD--LSGAFSYFILIN 264
           +     +  +N+P  K+   E  K     + T  D   +L+   LD  L+ A  +   + 
Sbjct: 852 VTDGNKYTKKNEPNAKELS-EILKFGAGNMFTATDNQKKLEDLNLDEVLNHAEDH---VT 907

Query: 265 TPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLL 300
           TP L  S++     + FL+Q  V  Y + ++ +D++
Sbjct: 908 TPELGESHLG---GEEFLKQFEVTDYKADVDWDDII 940

>TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.48
           YOR171C
          Length = 694

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           A+ L++ K  T++  SGD    E +N L    + +      + I  LP G+GNA S S
Sbjct: 368 ARDLNIDKYDTIVCASGDGIPHEVLNGLYQRKDRAKAFD-KLCITQLPCGSGNAMSVS 424

>KAFR0A05250 Chr1 (1038486..1040639) [2154 bp, 717 aa] {ON} Anc_6.48
           YOR171C
          Length = 717

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 85  FKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHT 144
           FKI   Y K +G       A+ +D+ K  T+   SGD    E IN L    +      + 
Sbjct: 348 FKIDVKYTKYSG--HAVQIAQGIDIHKYDTICCASGDGIPHEVINGLYRRKDRVAAF-NK 404

Query: 145 ISILPLPMGTGNAFSSS 161
           ++I  +P G+GNA S S
Sbjct: 405 LTITQIPCGSGNAMSVS 421

>KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 567

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125
           G+ K N  +    KPI      +    +TT        AK+LD+ +   V   SGD    
Sbjct: 188 GKGKANKLFLSKAKPILLASGCKIVVKETTYHLHAVDIAKNLDIDEYDVVACASGDGIPH 247

Query: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           E +N L    + +   +  ++I  LP G+GNA S S
Sbjct: 248 EIMNGLFLRSDRAKAFQK-LAITQLPCGSGNAMSIS 282

>NCAS0D02510 Chr4 complement(474974..476914) [1941 bp, 646 aa] {ON}
           Anc_6.48 YLR260W
          Length = 646

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNL---PPLLETSNGLKHTISILPLPMGTGNAFSS 160
           A+ LD+ K  T+   SGD    E +N L   P  ++  N L    +I  +P G+GNA S 
Sbjct: 302 AQELDIDKYDTIACASGDGIPHEIMNGLYRRPDRVKAFNKL----AITQIPCGSGNAMSV 357

Query: 161 S 161
           S
Sbjct: 358 S 358

>Kwal_23.5488 s23 (1184186..1187521) [3336 bp, 1112 aa] {OFF}
           YJL042W (MHP1) - Putative microtubule-associated protein
           (MAP) [contig 10] PARTIAL
          Length = 1112

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 257 FSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSL------NNEDLLNYVTQGYSN 309
           F YF L +T NLE S   +P +D FL+ + VL Y   L      NN  L  YVT   +N
Sbjct: 825 FKYFSLSST-NLEVSEDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTN 882

>Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {ON}
           YOR171C (REAL)
          Length = 625

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 104 AKSLDLSKSYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSS 161
           AK LD+ K  T+   SGD    E IN L    +      + +++  LP G+GNA S S
Sbjct: 278 AKDLDIRKYDTIACASGDGIPYEVINGLYRRSDRVEAF-NKLAVTQLPCGSGNAMSIS 334

>Kwal_YGOB_23.5488 s23 (1184186..1188253) [4068 bp, 1355 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 1355

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 257 FSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSL------NNEDLLNYVTQGYSN 309
           F YF L +T NLE S   +P +D FL+ + VL Y   L      NN  L  YVT   +N
Sbjct: 825 FKYFSLSST-NLEVSEDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPYVTSHLTN 882

>Kwal_56.22550 s56 (176751..178412) [1662 bp, 553 aa] {ON} YLR260W
           (LCB5) - sphingoid long chain base (LCB) kinase [contig
           185] FULL
          Length = 553

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 52/134 (38%), Gaps = 16/134 (11%)

Query: 53  ENVVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKS 112
           +++++I +   G G  K    Y   +KPI           +TT        AK++++ K 
Sbjct: 176 KSILIIMNPHGGKGHAKK--LYLSKVKPILTASPSFVEAIETTYHGHAIELAKNINIDKY 233

Query: 113 YTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLS 172
             +   SGD    E +N L    + +      + I  LP G+GNA S S           
Sbjct: 234 DVIACASGDGIPHEVLNGLYQRPDRAAAFNKLV-ITQLPCGSGNAMSVS----------- 281

Query: 173 SFLHNRTQPSHFPL 186
              H  T PSH  L
Sbjct: 282 --CHGTTNPSHAAL 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,133,393
Number of extensions: 2247289
Number of successful extensions: 6995
Number of sequences better than 10.0: 76
Number of HSP's gapped: 7207
Number of HSP's successfully gapped: 76
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)