Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H001905.705ON82824162e-54
Kpol_YGOB_1043.725.705ON88823233e-40
TDEL0B021505.705ON91823094e-38
TBLA0G010305.705ON89813016e-37
YKR095W-A (PCC1)5.705ON88812903e-35
Suva_11.3325.705ON111802881e-34
NCAS0A031805.705ON88812843e-34
Smik_11.3595.705ON88822817e-34
Skud_11.3355.705ON94882773e-33
SAKL0E14982g5.705ON89822731e-32
KLTH0E00990g5.705ON89812721e-32
Kwal_YGOB_Anc_5.7055.705ON88822713e-32
ZYRO0B16368g5.705ON85802694e-32
KLLA0A00539g5.705ON87812661e-31
KNAG0C066205.705ON101792644e-31
TPHA0E002005.705ON85742582e-30
NDAI0E050605.705ON86842513e-29
Ecym_40165.705ON125742292e-25
AFR289W5.705ON81791992e-21
CAGL0G02535g5.705ON140541683e-16
ACL136W5.121ON44658621.5
TPHA0E032501.194ON36040594.5
CAGL0B01617g8.306ON70894585.2
TBLA0J003708.642ON47150585.2
TPHA0O016902.56ON82271585.4
KAFR0J020802.154ON46739578.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00190
         (82 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   164   2e-54
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   129   3e-40
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   123   4e-38
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   120   6e-37
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   116   3e-35
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   115   1e-34
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   114   3e-34
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   112   7e-34
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   111   3e-33
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   109   1e-32
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   109   1e-32
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   108   3e-32
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   108   4e-32
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   107   1e-31
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   106   4e-31
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   103   2e-30
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   101   3e-29
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    93   2e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    81   2e-21
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    69   3e-16
ACL136W Chr3 (113467..114807) [1341 bp, 446 aa] {ON} Syntenic ho...    28   1.5  
TPHA0E03250 Chr5 complement(690693..691775) [1083 bp, 360 aa] {O...    27   4.5  
CAGL0B01617g Chr2 complement(148808..150934) [2127 bp, 708 aa] {...    27   5.2  
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    27   5.2  
TPHA0O01690 Chr15 (337788..340256) [2469 bp, 822 aa] {ON} Anc_2....    27   5.4  
KAFR0J02080 Chr10 complement(399123..400526) [1404 bp, 467 aa] {...    27   8.5  

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  164 bits (416), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 82/82 (100%), Positives = 82/82 (100%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVSNVIDSLKTIIETMDELS
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  129 bits (323), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 72/82 (87%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          + +DHTL  EIPFE A+QA IAV VLKPDPIL+PQDFQVSY + DN+ + +F+SIDDRVL
Sbjct: 7  IEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVL 66

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVS+VIDS+KTIIETMDELS
Sbjct: 67 RVGVSSVIDSVKTIIETMDELS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  123 bits (309), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 59/82 (71%), Positives = 69/82 (84%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          M+L+H+LKLEIPF+ A QANIA  VL PDPIL+PQDFQV Y   DNV V  F+SIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVS+VIDS+KTI+ET+DEL 
Sbjct: 61 RVGVSSVIDSIKTIVETIDELG 82

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  120 bits (301), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (82%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          M ++HTL L IPF  +KQA+IA  VL+PDPILRPQDFQV Y ++ N  V EF+SIDDRVL
Sbjct: 8  MQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVL 67

Query: 61 RVGVSNVIDSLKTIIETMDEL 81
          RVGVS+VIDS+KTIIET DEL
Sbjct: 68 RVGVSSVIDSVKTIIETFDEL 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  116 bits (290), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61
          +LDHTL+L+IPFE  +QA IA  VL PDPIL+PQDFQV Y +  NV + +F SIDDRVLR
Sbjct: 8  SLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLR 67

Query: 62 VGVSNVIDSLKTIIETMDELS 82
          VGVS++IDS+KTI+E MD LS
Sbjct: 68 VGVSSIIDSIKTIVEAMDVLS 88

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  115 bits (288), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 3   LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62
             +T +L+IPFE  KQANIA  VL PDPIL+PQDFQ  Y + +NV +A F SIDDRVLRV
Sbjct: 32  FQNTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRV 91

Query: 63  GVSNVIDSLKTIIETMDELS 82
           GVS+VIDS+KTIIETMDELS
Sbjct: 92  GVSSVIDSIKTIIETMDELS 111

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  114 bits (284), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 65/81 (80%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          M+LD+ L LEIPF  ++QA IA  VL PDPIL+PQDFQV Y ++DN+    F  IDDRVL
Sbjct: 7  MSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVL 66

Query: 61 RVGVSNVIDSLKTIIETMDEL 81
          RVGVS+VIDS+KTIIET+DEL
Sbjct: 67 RVGVSSVIDSIKTIIETIDEL 87

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  112 bits (281), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          M L HTL+L++PF+  +QA IA  VL PDPIL+PQDFQ+ Y +  NV + +F SIDDRVL
Sbjct: 7  MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVL 66

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVS+VIDS+KT++E MDELS
Sbjct: 67 RVGVSSVIDSIKTVVEAMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  111 bits (277), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 68/88 (77%), Gaps = 6/88 (6%)

Query: 1  MNLDHTL------KLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFES 54
          M+LD+TL      +L+IPFE   QA+IA  VL PDPIL+PQDFQV Y +  N+ +  F S
Sbjct: 7  MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRS 66

Query: 55 IDDRVLRVGVSNVIDSLKTIIETMDELS 82
          IDDRVLRVGVS+VIDS+KTI+ET+DELS
Sbjct: 67 IDDRVLRVGVSSVIDSIKTIVETIDELS 94

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 53/82 (64%), Positives = 62/82 (75%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          M+LDH L LEIP E   QA IA+  LKPDP+L+P+DFQV Y A D      F+SIDDRVL
Sbjct: 7  MSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVL 66

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVS+VI+S+KTIIETMDE  
Sbjct: 67 RVGVSSVIESVKTIIETMDEFG 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  109 bits (272), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61
          +L +TL LE+PF+ AKQA  AV VLKPDPIL+PQDF V Y ++ +     FE +DDRVLR
Sbjct: 8  DLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLR 67

Query: 62 VGVSNVIDSLKTIIETMDELS 82
          VGVS+VI+S+KTIIET+DE S
Sbjct: 68 VGVSSVIESIKTIIETIDEFS 88

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%)

Query: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60
          +NL +TL LE+PF++ KQA  AV VLKPDPIL+PQDF V Y +  N     FE +DDRVL
Sbjct: 7  LNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVL 66

Query: 61 RVGVSNVIDSLKTIIETMDELS 82
          RVGVS+VI+S+KTI+ET+DE S
Sbjct: 67 RVGVSSVIESIKTIVETIDEFS 88

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  108 bits (269), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 67/80 (83%)

Query: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61
          +LDH L L IPF + + + +AV VL+PDPILRP+DFQV YK++ N+   +F+S+DDRVLR
Sbjct: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62

Query: 62 VGVSNVIDSLKTIIETMDEL 81
          VGVS+VIDS+KTI+ET+DEL
Sbjct: 63 VGVSSVIDSVKTIVETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  107 bits (266), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 46/81 (56%), Positives = 67/81 (82%)

Query: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61
          + +H+L LEIPFE  KQA++A  VL PDPI++P+DFQV+Y  +D   + +FES+D+R+LR
Sbjct: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILR 66

Query: 62 VGVSNVIDSLKTIIETMDELS 82
          VGV++VI+S+KTI+ET+DEL 
Sbjct: 67 VGVNSVIESIKTIVETIDELC 87

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  106 bits (264), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 60/79 (75%)

Query: 3  LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62
          LDHTL L +PFE  +QA IA  VL+PDPIL+PQDF VSY A+     A F   D RVLRV
Sbjct: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70

Query: 63 GVSNVIDSLKTIIETMDEL 81
          GVS+VIDSLKTIIE++DEL
Sbjct: 71 GVSSVIDSLKTIIESLDEL 89

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  103 bits (258), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 62/74 (83%)

Query: 8  KLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRVGVSNV 67
          KL IPFE +KQA+IA  VLKPDP LRP++F+V Y ++ +  V  F+S+DDRVLRVGVSNV
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 68 IDSLKTIIETMDEL 81
          IDS+KTIIET+DEL
Sbjct: 69 IDSIKTIIETIDEL 82

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 4/84 (4%)

Query: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSY----KARDNVFVAEFESIDD 57
           LD+TL++ IPF + + A IA  VL PDPIL+P+DFQV Y       +NV + +F+SID+
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 58 RVLRVGVSNVIDSLKTIIETMDEL 81
          RVLRVGVS+V+DS+KTI+ETMDEL
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (75%)

Query: 9   LEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRVGVSNVI 68
           LE+PFE+ KQA IA +VL  DP+LRP+DF+V Y  +    +  F SID R LRVGVS+VI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 69  DSLKTIIETMDELS 82
           +S+KT++ETMDE S
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 81.3 bits (199), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%)

Query: 3  LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62
          +DHTL L +PFE A+ A+IA   L PDP+LRP++  VS+ +       +  +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 63 GVSNVIDSLKTIIETMDEL 81
            +++ ++LKT++ET DEL
Sbjct: 61 ATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 69.3 bits (168), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 9  LEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62
          L +PFE A+ A IA  VL+PDPILRP+DFQV Y+A+  V    F++IDDRVLR 
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84

>ACL136W Chr3 (113467..114807) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR210C
          Length = 446

 Score = 28.5 bits (62), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 10/58 (17%)

Query: 23  VDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL-RVGVSNVIDSLKTIIETMD 79
           VD  + DP LRP D ++S++          E++ D +L R G + V+  L+    T+D
Sbjct: 317 VDTAEDDPALRPLDEKLSHR---------IENVRDLILYRFGSTGVMQVLQAAAATLD 365

>TPHA0E03250 Chr5 complement(690693..691775) [1083 bp, 360 aa] {ON}
           Anc_1.194 YKR066C
          Length = 360

 Score = 27.3 bits (59), Expect = 4.5,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 41  YKARDNVFVAEFESIDDRVLRVGVSNVIDSLKTIIETMDE 80
           Y A  +VF  +F ++  R+L  G++   D    I +T+DE
Sbjct: 319 YAANQDVFFKDFSNVFARLLENGITFPKDQKPFIFKTLDE 358

>CAGL0B01617g Chr2 complement(148808..150934) [2127 bp, 708 aa] {ON}
           some similarities with uniprot|P17629 Saccharomyces
           cerevisiae YDR138w HPR1
          Length = 708

 Score = 26.9 bits (58), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 19/94 (20%)

Query: 3   LDHTLKLEIPF-----EDAKQANIAVDVLKPDPIL--RPQDFQVSYKARDNVF------- 48
           +D+ L+LE  F     ++ K+ NI  + L PD  +  +PQ+    Y     +F       
Sbjct: 302 IDNILELEEVFYNKIKKELKEINIINNKLNPDYFIPSKPQEGLPEYLRTSKLFEELNSSS 361

Query: 49  VAEFESIDDRVLRVGVSNVIDSLKTIIETMDELS 82
           ++EF+SI D++  + V N +D     + T DE S
Sbjct: 362 MSEFQSIYDKIKHLPVPNPLD-----MSTTDEYS 390

>TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON}
           Anc_8.642 YPL133C
          Length = 471

 Score = 26.9 bits (58), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 28/50 (56%)

Query: 31  ILRPQDFQVSYKARDNVFVAEFESIDDRVLRVGVSNVIDSLKTIIETMDE 80
           +L+P D Q+SYK   N    + E+++D   +  +   I+++K  ++ + E
Sbjct: 283 LLQPYDHQLSYKKFLNYLSEDEEALNDEESKNRIIKAINTVKPALQAITE 332

>TPHA0O01690 Chr15 (337788..340256) [2469 bp, 822 aa] {ON} Anc_2.56
           YDL220C
          Length = 822

 Score = 26.9 bits (58), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 1/71 (1%)

Query: 3   LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQD-FQVSYKARDNVFVAEFESIDDRVLR 61
             H   + + F D  + NI    +  + ++  +D     Y  R NVF  +FE  D +V  
Sbjct: 525 FSHRAFVTLLFTDFTKNNINQKFIFSNYLIEKEDKLNEKYYYRVNVFHNDFEKFDLKVYN 584

Query: 62  VGVSNVIDSLK 72
           +  S++ D LK
Sbjct: 585 IYGSHIKDMLK 595

>KAFR0J02080 Chr10 complement(399123..400526) [1404 bp, 467 aa] {ON}
           Anc_2.154 YNL119W
          Length = 467

 Score = 26.6 bits (57), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 35  QDFQVSYKARDNVFVAEFESIDD--RVLRVGVSNVIDSL 71
           + F V+YKA+D + +A+ E  DD   V+++  +  ID L
Sbjct: 284 ESFTVNYKAKDTLLLAKSEKFDDSKSVMKLPKNMTIDEL 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,152,950
Number of extensions: 283344
Number of successful extensions: 727
Number of sequences better than 10.0: 27
Number of HSP's gapped: 726
Number of HSP's successfully gapped: 27
Length of query: 82
Length of database: 53,481,399
Length adjustment: 54
Effective length of query: 28
Effective length of database: 47,289,435
Effective search space: 1324104180
Effective search space used: 1324104180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)