Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H001805.706ON1241124159310.0
KNAG0C066305.706ON1281102132650.0
ZYRO0B16412g5.706ON137299329590.0
TDEL0B021405.706ON114797128980.0
NCAS0A031705.706ON1319104828880.0
Smik_11.3605.706ON118097627390.0
Suva_11.3335.706ON118797427000.0
Kpol_1043.735.706ON126097426770.0
CAGL0G02541g5.706ON129597226740.0
Skud_11.3365.706ON118897726620.0
SAKL0E15004g5.706ON119697726490.0
YKR096W5.706ON119597626430.0
KLTH0E00968g5.706ON114898025760.0
Kwal_55.196785.706ON117898725550.0
YIL151C5.706ON111898224920.0
Smik_9.185.706ON111898024750.0
Skud_9.175.706ON111898124740.0
TPHA0E001905.706ON136198424620.0
Suva_9.375.706ON111797724620.0
CAGL0H06611g5.706ON1282103423580.0
AFR290W5.706ON121798223500.0
Ecym_40155.706ON125798323390.0
KLLA0A00528g5.706ON122998122660.0
NDAI0E050705.706ON155638212941e-154
TBLA0E017105.706ON152641310701e-122
TPHA0D046405.706ON9622021802e-12
YHR206W (SKN7)4.385ON62241781.7
Suva_15.4124.385ON61741781.8
Skud_8.2734.385ON62341781.8
Smik_8.2964.385ON62541781.9
NCAS0A064504.385ON60941744.8
TDEL0D003204.385ON54740745.5
ZYRO0G00484g4.385ON64740736.5
KAFR0B069904.385ON54540737.5
Ecym_74744.385ON49640728.1
ADL388W4.385ON48241729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00180
         (1241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  2289   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1262   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1144   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1120   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1117   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1059   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1044   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1035   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1034   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1030   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1025   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1022   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   996   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   988   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   964   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   957   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   957   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   952   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   952   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   912   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   909   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   905   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   877   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   503   e-154
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   416   e-122
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    74   2e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    35   1.7  
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    35   1.8  
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    35   1.8  
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    35   1.9  
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    33   4.8  
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    33   5.5  
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    33   6.5  
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    33   7.5  
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    32   8.1  
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    32   9.0  

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 2289 bits (5931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1129/1241 (90%), Positives = 1129/1241 (90%)

Query: 1    MPQISIQTPFDIITNSFTAMHSSETQDNNNNIDIFRPISPSAALRQKRHGSNSYIYKNQK 60
            MPQISIQTPFDIITNSFTAMHSSETQDNNNNIDIFRPISPSAALRQKRHGSNSYIYKNQK
Sbjct: 1    MPQISIQTPFDIITNSFTAMHSSETQDNNNNIDIFRPISPSAALRQKRHGSNSYIYKNQK 60

Query: 61   RIARPDDKILNANININYIDHNSIVNENATPVKSVLSRRPSLSKKSNNVTPQPSFLVTEP 120
            RIARPDDKILNANININYIDHNSIVNENATPVKSVLSRRPSLSKKSNNVTPQPSFLVTEP
Sbjct: 61   RIARPDDKILNANININYIDHNSIVNENATPVKSVLSRRPSLSKKSNNVTPQPSFLVTEP 120

Query: 121  PKSPFYVTNQSYTNIDVALSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVLPG 180
            PKSPFYVTNQSYTNIDVALSA                                  AVLPG
Sbjct: 121  PKSPFYVTNQSYTNIDVALSANNNGITNNNNQYTNMNTYNSINNNYNNIEGYSGNAVLPG 180

Query: 181  NDDMFINTQSNKYRNNSTSTAIINDVSDNFVNNMNTDIQQNENIYQDQNFNDDTGXXXXX 240
            NDDMFINTQSNKYRNNSTSTAIINDVSDNFVNNMNTDIQQNENIYQDQNFNDDTG     
Sbjct: 181  NDDMFINTQSNKYRNNSTSTAIINDVSDNFVNNMNTDIQQNENIYQDQNFNDDTGNNNAE 240

Query: 241  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEETSVTKKTSRVLIEKLQNIYKIIVKQEM 300
                                          VEETSVTKKTSRVLIEKLQNIYKIIVKQEM
Sbjct: 241  SDNNQNNSNDESNNQNSEDNNDNPNNNNNNVEETSVTKKTSRVLIEKLQNIYKIIVKQEM 300

Query: 301  ELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALLPSQSLQDIQXXXXXXXX 360
            ELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALLPSQSLQDIQ        
Sbjct: 301  ELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALLPSQSLQDIQIGEEIVEI 360

Query: 361  XXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSTMLIDLPPKHSIPWLQR 420
                  LWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSTMLIDLPPKHSIPWLQR
Sbjct: 361  YRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLSTMLIDLPPKHSIPWLQR 420

Query: 421  LGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGK 480
            LGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct: 421  LGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGK 480

Query: 481  SVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLIDYLKHSEVMLLPSFLENE 540
            SVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLIDYLKHSEVMLLPSFLENE
Sbjct: 481  SVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLIDYLKHSEVMLLPSFLENE 540

Query: 541  DLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGFGN 600
            DLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGFGN
Sbjct: 541  DLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGFGN 600

Query: 601  PKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMSIDTNDSRGPILNTSAYVNEGNIV 660
            PKNPFALLFDLPNFL                 ISTMSIDTNDSRGPILNTSAYVNEGNIV
Sbjct: 601  PKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMSIDTNDSRGPILNTSAYVNEGNIV 660

Query: 661  TEYFDNIDSLRLPIDHPNILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWT 720
            TEYFDNIDSLRLPIDHPNILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWT
Sbjct: 661  TEYFDNIDSLRLPIDHPNILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWT 720

Query: 721  YFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLC 780
            YFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLC
Sbjct: 721  YFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLC 780

Query: 781  ETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLD 840
            ETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLD
Sbjct: 781  ETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLD 840

Query: 841  FPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHI 900
            FPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHI
Sbjct: 841  FPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHI 900

Query: 901  LKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVG 960
            LKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVG
Sbjct: 901  LKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVG 960

Query: 961  YKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXX 1020
            YKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMT           
Sbjct: 961  YKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQ 1020

Query: 1021 XNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQASIWTTANDEINRNITYFVFDATSW 1080
             NFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQASIWTTANDEINRNITYFVFDATSW
Sbjct: 1021 QNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQASIWTTANDEINRNITYFVFDATSW 1080

Query: 1081 LRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLL 1140
            LRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLL
Sbjct: 1081 LRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLL 1140

Query: 1141 PLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVV 1200
            PLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVV
Sbjct: 1141 PLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVV 1200

Query: 1201 LVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241
            LVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN
Sbjct: 1201 LVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1262 bits (3265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1021 (61%), Positives = 756/1021 (74%), Gaps = 67/1021 (6%)

Query: 271  VEETSVTKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDL 330
             + TSVT+K+S+ L++KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTTELKNLW+IYK+NTDL
Sbjct: 278  AQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDL 337

Query: 331  INNYITFITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEV 390
            INNY TFITTALLPSQ  QDI               LWVYGTITFLDVLKNFSNFMDPEV
Sbjct: 338  INNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 397

Query: 391  CSQFITHVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA 450
            CSQFITHVFISLS +LID+PPKH+IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA
Sbjct: 398  CSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA 457

Query: 451  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR 510
            MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR
Sbjct: 458  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR 517

Query: 511  NKNGNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570
            N  GN RN DLIDYLKHSEVMLLPSFL ++DLQQVVLNYF DRFG+DY++NNIF+TQDMF
Sbjct: 518  NTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMF 577

Query: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXX 630
            FQ P+ LRF+FRHAPAFAESHILQLVGFGNPKNPFALLF+LP +L               
Sbjct: 578  FQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSK-- 635

Query: 631  XXISTMSIDTNDSRGPILNTSAY--VNEGN----------IVTEYFDNIDSLRLPIDHPN 678
               ST + D + +    ++  A   VNEG              EY DNI++L+  I+ P+
Sbjct: 636  ---STSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPD 692

Query: 679  ILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSS 738
            I  W+KSL+ +NMTSLKCS+IVL+KFL GPLLIALPH LPWT FIIA  +K    +N  +
Sbjct: 693  ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKN 752

Query: 739  VKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNR 798
             KFW I+M+RI PW+T+TSFLNVLLAY+LDN+  T  I +LC  YS+ +   ++L +FN+
Sbjct: 753  YKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMD-LDDMLAHFNK 811

Query: 799  NENLPEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENF 858
            +E+LPE+WKCWGTLW+D I NK +++ADTF G GI DHMFLDFP+DGI FD  DETG  F
Sbjct: 812  SEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKF 871

Query: 859  WNRALRIVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSG 918
            W RALR++FLFKGI++    GL++S  A V+CR +    +  L+ F+FK+E +DE +   
Sbjct: 872  WKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKA-ADSPLRRFTFKLESYDEPTS-- 928

Query: 919  QPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELV 978
               S  N+ +PL E +   N D  A P LSVV+GENIFEY+GY+ L L+ +SFD+NGE+V
Sbjct: 929  ---SKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIV 985

Query: 979  SSSIYTAWVID------------NDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXX----- 1021
            SSSIYT+W+ID            ++N+++  QG+   +   ++                 
Sbjct: 986  SSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDD 1045

Query: 1022 -------NFQMRNFASNEDTED-DFNFELYMNPEKLNKNMDQASIWTTANDEINRNITYF 1073
                   N   + F S  D  D +    +      L KN+     W ++ DE++R  T+F
Sbjct: 1046 QDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNL-----WESSVDELDRLKTFF 1100

Query: 1074 VFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQL 1133
            +FDATSWLRHFAHIYK++TN VL F VCLTTFQELRFLRKSKDENVV AAARAIITMRQL
Sbjct: 1101 IFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQL 1160

Query: 1134 YSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANES---- 1189
            Y E +LLPLRFTGNVA DIEEHLEFEEQITWRSHVDEFVIEAV+KAQ+KF +A E+    
Sbjct: 1161 YRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPE 1220

Query: 1190 --------VTL-RKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCT 1240
                    V L  K F++V LVT+D NMKRKAQ+QGIKTF+T F+FS+C KLG+  ++CT
Sbjct: 1221 EEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCT 1280

Query: 1241 N 1241
            N
Sbjct: 1281 N 1281

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/993 (58%), Positives = 706/993 (71%), Gaps = 58/993 (5%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            +K++S+ L++KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTTELKNLW+IYK+N+DLINNY+T
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            F+TTALLPSQ+ QDI               LWVYGTITFLD+ KNFSNFMDPEVC QFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVFIS+S ML D+PPK+ IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR FV+RN NGN 
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERN-NGNH 648

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RN+ LI+YLKHSEVMLLPSFLE+ DLQQVVL YF  +FG D N+ NIF+T+ MF Q P  
Sbjct: 649  RNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDY 708

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXIST- 635
            LR++FRHAPAFAESHILQLVGFG+PKNPFALLF+LP FL                   T 
Sbjct: 709  LRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETS 768

Query: 636  --MSID-TNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNM 691
              M+ID   D +   ++T     EG     +F NI++LR P   P N+ +W +SL ++NM
Sbjct: 769  STMAIDDLEDEQSDRMSTP----EG-----FFGNIETLRFPYSVPSNLEIWNESLNYINM 819

Query: 692  TSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILP 751
            TSLKCS++VL+KFL+GPL++ALPH +PWTYFII+   K +   + SS KFW   + RI P
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 752  WNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGT 811
            WNT+ SFLNVL+AY+LDN +++  +  LC  YS+     +LLDYFN NE LPE+WKCWGT
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSM-GLEDLLDYFNNNEVLPEVWKCWGT 938

Query: 812  LWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKG 871
            LWFD I NK   + +    +GI++HMFLD P+DGI FD  DE+GENFW RA RI+FLFKG
Sbjct: 939  LWFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKG 998

Query: 872  IAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSY----SGQPFST---- 923
            +AEN   G+ +S  APV+CRR+D+ P HILKSFSFK+    +S        QP +T    
Sbjct: 999  LAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDL 1058

Query: 924  --INKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSS 981
              +   L +FE     N+  D  PMLSV++GE+IF+Y GY++L  +  S+D+NGE +S+S
Sbjct: 1059 DHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSAS 1118

Query: 982  IYTAWVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFE 1041
            +YT+W  +N N+ N      + S++                         +  ++   F 
Sbjct: 1119 LYTSWYANN-NTNNTGVIPAHGSDVDSQRDAV------------------QSVQEMHIFN 1159

Query: 1042 LYMNPEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVC 1101
              M P       D   +        + + TYFV D T+WLRHF HIYKL+++ VL FA+C
Sbjct: 1160 QIMEPGYCGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAIC 1219

Query: 1102 LTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQ 1161
            LTTF ELRFLRK KDENVV AA RAIIT+RQLYSEGKLLPLRFTGNVAT IEEHLEFEE+
Sbjct: 1220 LTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEK 1279

Query: 1162 ITWRSHVDEFVIEAVVKAQNKFISANESVTL-------------RKGFNHVVLVTDDINM 1208
            ITWRSHVDEFVIEAV KAQ+KF   N+                 R G   VVLVTDD NM
Sbjct: 1280 ITWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNM 1339

Query: 1209 KRKAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241
            ++KAQ+Q ++TF+T F+FS+C  +G++  +CTN
Sbjct: 1340 RKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/971 (57%), Positives = 693/971 (71%), Gaps = 62/971 (6%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            +KK+S+ L++KLQ+IYK+IVKQE+ELQ+RCSQLT SQTTELK LW IYK+N+DLINNY+T
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLP QS QD+               LWVYGTITFLDVLKNFSNFMDPEVC+QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVFIS+S ML D+P +++IPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR FV+RN NGN 
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERN-NGNH 471

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RNS LI+YLKHSEVMLLPSFLE+ DLQQVVL YF D+FG+D N+NNIF+T+ MF Q P  
Sbjct: 472  RNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQ 531

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTM 636
            L+++FRHAPAFAESHILQLVGFG+PKNPFALLF+LP  L                  +  
Sbjct: 532  LKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRK-------TKS 584

Query: 637  SIDTNDSRGPILNTSAYVNE----GNIVTEYFDNIDSLRLP-IDHPNILVWLKSLEHLNM 691
            S+ T  S    ++   Y++     G  V ++FDNIDSL  P +  P++ VW  SL++LN+
Sbjct: 585  SVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNI 644

Query: 692  TSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILP 751
            TSL CS+IVL+KFL GP+++ALPH+LPW YFIIA   K Q   + +S +FW  ++ RI P
Sbjct: 645  TSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFP 704

Query: 752  WNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGT 811
            WNT+ +FLNVL+AY LDN + +  I  LCE  S      +L+++FN NE+LPE+WKCWG 
Sbjct: 705  WNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTM-GLDQLVEHFNNNEDLPEVWKCWGL 763

Query: 812  LWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKG 871
            LWFD I +K  +  D++   GI+DHMFLD P+DGIGFD  DE+G  FW RA R++FLFK 
Sbjct: 764  LWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKR 823

Query: 872  IAENLQTGLRVSRTAPVHCRRDDIDP-NHILKSFSFKMEGFDESSYSGQPFSTINKLLPL 930
            IAEN QT L VS  A VHCRR   DP NH+LKSF FK+    ++ Y+    S +   + +
Sbjct: 824  IAENFQTRLVVSSQAQVHCRR--TDPMNHVLKSFCFKLR---DTFYNSN--SVLQNTIEV 876

Query: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990
            FE   + N D    P LSV++ E+IF YVGYK+L  +   +DR GE VS+S+YT+W    
Sbjct: 877  FEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---- 932

Query: 991  DNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLN 1050
                    GN+ + N                         +E T+     E  +  E +N
Sbjct: 933  --------GNETSKN---------------------EIPQSEPTQQQTANEADLFIEGIN 963

Query: 1051 KNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRF 1110
             ++ + +I      ++N   T+FV DATSWLRHFAH+YKL++N VL FA+CLTTFQELRF
Sbjct: 964  TSLTEFNI-DFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRF 1022

Query: 1111 LRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDE 1170
            LRKSKDENVV AA RA+IT+RQLY+E ++LPLRFTGNVAT IEEHLEFEEQITWRSHVDE
Sbjct: 1023 LRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDE 1082

Query: 1171 FVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVCR 1230
            FV EA+ KAQ +    N      + F+HVVLVTDD NM+RKAQ+  I T +T F+F+ C 
Sbjct: 1083 FVFEAIKKAQARLSQEN------RDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCN 1136

Query: 1231 KLGIQDNVCTN 1241
             +G +  +CTN
Sbjct: 1137 AVGNRLKICTN 1147

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 16/104 (15%)

Query: 40  PSAALRQKRHGSNSYIYKN----QKRIARPDDKILNANININYIDHNSIVNENATPVKS- 94
           P++A RQKRH SN Y        ++R+A  DD I        ++D+ +I N   TP K  
Sbjct: 40  PASAGRQKRHSSNPYNSAESTGVKRRVANHDDGI------TQFLDNGAIPN---TPCKEP 90

Query: 95  VLSRRPSLSKKSNNVTPQPSF-LVTEPPKSPF-YVTNQSYTNID 136
           V SRRPS ++++ N TP+ +   V +   SP+ Y  N S   ID
Sbjct: 91  VSSRRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRID 134

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1048 (56%), Positives = 713/1048 (68%), Gaps = 106/1048 (10%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            KKT   L+ KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTT+LKNLW+IYK+N DLINNY+TF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTALL SQS QD+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VFISLSTML D+P K+SIPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN NGN R
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNNR 532

Query: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGV---------------DYNDN- 561
            N  LI+YLKHSEVMLLP+FLEN +LQQVVL YF ++FG+                 N+N 
Sbjct: 533  NLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNT 592

Query: 562  ---NIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXX 618
               ++F ++DMF Q P  L+++FRHAPAFAESHILQLVGFG+PKNPFALLF+LP +L   
Sbjct: 593  RTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKER 652

Query: 619  XXXXXXXXXXXXXXI------------STMSIDTNDSRGPILNTSAYVNEGNIVT--EYF 664
                                       S MSID ++     +N     N  N VT  E+F
Sbjct: 653  KDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFF 712

Query: 665  DNIDSLRLPIDHPNIL-VWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFI 723
             NI+ LR     PN L +W+ SL H+N+ SLKCS+IVL+KFL GPLLIALPH+LPW YFI
Sbjct: 713  QNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFI 772

Query: 724  IATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNF-YQTES------- 775
            I+  LK +   +  S  FW  +++ I PWN + +FLNVLL Y LDN    T S       
Sbjct: 773  ISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQ 832

Query: 776  ------IAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNADTFN 829
                  I  LC  YS    F +LL +FN NE+LPE+WKCWGTLWFD ISNK  ++AD+F 
Sbjct: 833  KDMNVFILDLCNKYSTM-GFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFE 891

Query: 830  GLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQT-GLRVSRTAPV 888
             LGI+DHMFLDFP+DGIG+   DETGENFW R LRI+FLFKGIAEN  + GL+VS  A  
Sbjct: 892  NLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGT 951

Query: 889  HCRRDDIDPNHILKSFSFKMEG----------FDE-SSYSGQPFSTINKLLPLFENIDET 937
              R +++  ++ILK FSFK  G           DE   Y+    + I + + + E I ET
Sbjct: 952  EYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHET 1011

Query: 938  NLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNS 997
            NL+F+  P+ S++  E+IF+Y GYKKL  N+ SFD+NGE  S SIYTAW +D D      
Sbjct: 1012 NLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYD------ 1065

Query: 998  QGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQAS 1057
                     Q+             + +M +  +   + D+ +F     PE  +K+   +S
Sbjct: 1066 ---------QLILAQNNNNNTNATD-EMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSS 1115

Query: 1058 IWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDE 1117
               T+ +  NR  TYFVFDATSWLRHFAHIYKL++N+VL FAVCLTTFQELRFLRKSKD 
Sbjct: 1116 ---TSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDA 1172

Query: 1118 NVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVV 1177
            NVV A+ RAIITMRQLYS+G LLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAV+
Sbjct: 1173 NVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVM 1232

Query: 1178 KAQNKFISANESVTLRKG------------------------FNHVVLVTDDINMKRKAQ 1213
            KAQ KF+ + ++V   +G                        F +VVL+TDD +M+ KAQ
Sbjct: 1233 KAQEKFVKS-KTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQ 1291

Query: 1214 EQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241
             +GI TF T  +FSVC  +GI + VCTN
Sbjct: 1292 LKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 64/101 (63%), Gaps = 10/101 (9%)

Query: 44  LRQKRHGSNSYI-YKN----QKRIARPDDKILNANININY----IDHNSIVNENATPVKS 94
           +RQKRH SNSY   KN    ++RIA+P++  L    N+ Y      +NSI+ +  TP K 
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKG 111

Query: 95  VLSRRPSLSKKSNNVTPQP-SFLVTEPPKSPFYVTNQSYTN 134
            LSRRPSL KK  N TPQP S++V+E P SPFY+   S++N
Sbjct: 112 TLSRRPSLIKKQMNSTPQPMSYVVSEVPASPFYLPANSFSN 152

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/976 (55%), Positives = 678/976 (69%), Gaps = 57/976 (5%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            K++   LI+KLQ +Y++IVKQE+ELQ+RCSQLT SQTTELK+LW+IYK+NT+L+NNY+TF
Sbjct: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTALLPSQ   D+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VFISLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+H
Sbjct: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 488

Query: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548

Query: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMS 637
            +++FRH P+FA+SHILQ+VGFG PKNPFA+LF+LP +L                   T S
Sbjct: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTES 608

Query: 638  IDTNDSRG-----PILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLEHL 689
               N   G       ++++  +++ +++ E+F++ID+LR PI  P++L    WL++L+ L
Sbjct: 609  STGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFL 667

Query: 690  NMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRI 749
            NMTSLKC +IVLRKFL GPL +ALPHVLPW YFII+  LK+    +  S +FW ++++R+
Sbjct: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727

Query: 750  LPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCW 809
             PW+T+ +F+NVL+AY+LDN      I  LC  YS   N  ELL+ FN NE+LPEIW CW
Sbjct: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKL-NLSELLNSFNENEDLPEIWGCW 786

Query: 810  GTLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIV 866
            GTLWFD I  K      + D F  +GI D+M LD P DGI FD+ DE GE FW RA RI+
Sbjct: 787  GTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRII 846

Query: 867  FLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINK 926
            FLF+ ++ +   G+ V     V+C    +  N+IL+   +K+E       S    ST+  
Sbjct: 847  FLFREVSRSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLES 904

Query: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986
            +  + E   E N D  A P LSV+ G+NIF YVGYKKL  +   FD+NGE +S+S+YT+W
Sbjct: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964

Query: 987  VIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDF-NFELYMN 1045
             + N N  NN + N                          ++A+  + E  F      ++
Sbjct: 965  YVPNCN--NNLETNI-------------------------SYANERENEALFLECMKSVH 997

Query: 1046 PEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTF 1105
            PE              A  EI+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTTF
Sbjct: 998  PE-------------IAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTF 1044

Query: 1106 QELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWR 1165
            QELRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR
Sbjct: 1045 QELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWR 1104

Query: 1166 SHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFI 1225
            +HVDEFVIE+++KAQ K  +A +       FN+VVL++DD  MK+KA+E+ I+T +T F+
Sbjct: 1105 THVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFV 1164

Query: 1226 FSVCRKLGIQDNVCTN 1241
            FS+C KLG Q ++CT+
Sbjct: 1165 FSLCTKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/974 (55%), Positives = 679/974 (69%), Gaps = 58/974 (5%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            KK+S  LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IY++NT+L+NNY+TF
Sbjct: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTALLPSQ   D+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 500

Query: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560

Query: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMS 637
            +++FRHAP+FA+SHILQ+VGFG PKNPFA+LF+LP  L                   T S
Sbjct: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620

Query: 638  I-----DTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL--VWLKSLEHLN 690
                  + ND    I++++  ++E + + E+F++ID+LR PI    +    WL+SL+ LN
Sbjct: 621  STSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLN 680

Query: 691  MTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRIL 750
            MTSLKC +IVLRKFL GPL IALPH LPW YFII+  LK+    +  S +FW ++++RI 
Sbjct: 681  MTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIF 740

Query: 751  PWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWG 810
            PW+T+ +F+N+L+A +LDN   +  I  LC+ YS+  N  ELLD F   E LPEIW CWG
Sbjct: 741  PWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDL-NLAELLDVFKEKEELPEIWGCWG 799

Query: 811  TLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVF 867
            TLWFD I  K      + D F  +GI+D+M LD P+DGI FD  DE GE FW RA R +F
Sbjct: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859

Query: 868  LFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKL 927
            LF+ ++ + Q G+ ++  + ++  R  +  N+IL + S+K+E       S    +T+  +
Sbjct: 860  LFRELSRSFQIGVIINNESSIN--RSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917

Query: 928  LPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWV 987
            + +FE   E N+D  A P LSV+KG +IF Y GYKKL  N   FD+NGE +S+S+YT+W 
Sbjct: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977

Query: 988  IDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPE 1047
            + N +  NN +                            N  SN + E++  F       
Sbjct: 978  VPNGS--NNPET---------------------------NINSNCEKENEGQF------- 1001

Query: 1048 KLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQE 1107
                         + + EI+ N TYFVFDATSWLRH A I+KL+ N +L FA+CLTTFQE
Sbjct: 1002 --------LECLKSDDREIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQE 1053

Query: 1108 LRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSH 1167
            LRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+H
Sbjct: 1054 LRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTH 1113

Query: 1168 VDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFS 1227
            VDEFVIE+++KAQ K  +AN+       FN+V+L++DD  MK+KA+E+ IKT +T F+FS
Sbjct: 1114 VDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFS 1173

Query: 1228 VCRKLGIQDNVCTN 1241
            +C KLG Q ++CT+
Sbjct: 1174 LCTKLGEQRHLCTD 1187

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/974 (55%), Positives = 682/974 (70%), Gaps = 57/974 (5%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            +K+S+ L++KLQ+IYKII+KQE+ELQ+RCSQLT SQTTE+KNLW IYKLN DLINNY+TF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTAL PSQS  D+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VFIS+S+ML D+P K++IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQY+QLVIDNIYQR F DRN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 518  NSDL-IDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNI--FETQDMFFQVP 574
            N  L +DYLKHSEVMLLP+F+E+ DLQQVVL YF ++FG+DYN+NN+  F+ + MF Q  
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 575  ASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXIS 634
              L+FYFRHA AFAE+ ILQLVG+GNPKNPFALLF LP +L                   
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGE 671

Query: 635  TMSIDTNDSRGPI---LNTSAYVNEGNIVTEYFDNIDSLRLPIDHPN-ILVWLKSLEHLN 690
              S  T  S   +   +N    V  G+   ++F+NID L +    PN I +W  SL++ N
Sbjct: 672  DGSSTTFSSVSGMEYMVNMETNVFLGS--EDFFNNIDKLAINNFMPNSISLWNDSLKYHN 729

Query: 691  MTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRIL 750
             T+ KCS+IVL+KFL GPL++ALPH+LPW YF+I+  L+ +  ++T+ ++FW   ++RI 
Sbjct: 730  FTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIF 789

Query: 751  PWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWG 810
            PWN++  FLNVLLAY++DN +    + +LC+ Y +  N  ELL  FN NE+LPE+WKC G
Sbjct: 790  PWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSL-NLEELLRNFNANEDLPEVWKCRG 848

Query: 811  TLWFDVISNKR-ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLF 869
            +LWFD+I  KR + N D++   GI+D+ FLDFP+DGI FDE DE G  FW R++R++FLF
Sbjct: 849  SLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLF 908

Query: 870  KGIAENLQT--GLRVSRTAPVHCRRDDIDPNHILKSFSFK-MEGFDESSYSGQPFSTINK 926
            +GI E       L +S  APV  RR  +  N  L  +SFK M   D+  +        + 
Sbjct: 909  RGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFD-------DM 960

Query: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986
            L+  FE ID  N DF+A P+LS++ GENIFEYVGYK++  + +SFD+NG+L+S+S Y  W
Sbjct: 961  LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020

Query: 987  VIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDF-NFELYMN 1045
             I+ D  +N   G   ++N   +             F  + F    D+ D+F N E+Y  
Sbjct: 1021 SINQDTGVN---GGPLSNNSSSSNAASSDPMNEKELFN-KCFDPEYDSVDEFWNKEIY-- 1074

Query: 1046 PEKLNKNMDQASIWTTANDEINRNI-------TYFVFDATSWLRHFAHIYKLSTNNVLNF 1098
                              D+I R         TYF+ DATSWLRHFAH+YK++TN++L F
Sbjct: 1075 ------------------DDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKF 1116

Query: 1099 AVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEF 1158
            ++CLTTFQELRFLRKSKDENVV AA RAIIT+RQL+SEGKLLPLRFTGNVAT IEEHLEF
Sbjct: 1117 SICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEF 1176

Query: 1159 EEQITWRSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIK 1218
            EEQITWRSHVDEFVIEAV+KA+ K     + +   KGF  +VLVTDD NMK KA E+G K
Sbjct: 1177 EEQITWRSHVDEFVIEAVIKAETK--RKEQEMHNMKGF-QIVLVTDDSNMKNKALEKGSK 1233

Query: 1219 TFTTHFIFSVCRKL 1232
            TF+T F+F++   L
Sbjct: 1234 TFSTRFVFAISNYL 1247

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (51%), Gaps = 15/106 (14%)

Query: 44  LRQKRHGSNSY-IYKN--QKRIARPDDKILNANININYIDHNS-----IVNENATPVKSV 95
           L QKRHGS+SY I  N  +KR+A+        N    ++D  S     I N+ +     +
Sbjct: 63  LGQKRHGSSSYYITPNYIKKRVAKNSYNSATGN----FLDSGSNGGGDISNQTSLQNTPL 118

Query: 96  LSRRPSLSKKS---NNVTPQPSFLVTEPPKSPFYVTNQSYTNIDVA 138
            S +PS++K +    + TPQP+++  +   SPF + +   +N+D+ 
Sbjct: 119 ASPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLNSNLPSNLDIV 164

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/972 (54%), Positives = 691/972 (71%), Gaps = 46/972 (4%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + K ++ L++KLQ+IYK IV+QE+ELQ++C+QLT+SQTT+L ++WSIY++N +L+ NY+T
Sbjct: 363  SNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVT 422

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FI+TALL SQS  D+               LWVYGTITFLDVLKNFS+FMDPEVCSQFIT
Sbjct: 423  FISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFIT 482

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVFIS+STML D+P K+SIPW+QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A+K+TY 
Sbjct: 483  HVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYG 542

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            +GKLYYHMST+QQNTLEAFVNLGKSVFCQDTF PS QYMQLVIDNIYQR F++R  N N 
Sbjct: 543  YGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSN-NT 601

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RNS LI+YLKHSEVMLLP+F+ NE+LQ+VV+ YF  +FG D +D NIF+ +D+F Q P +
Sbjct: 602  RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPEN 661

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXI--- 633
            L+++FRHAPAFAESHILQ VGFG+ KNPFALLFDLP FL                     
Sbjct: 662  LKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSN 721

Query: 634  -STMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLP-IDHPNILVWLKSLEHLNM 691
             S MS+D        ++T + ++      +YF N++S++ P +  P   +WLKSL +LN+
Sbjct: 722  ESVMSLDN-------ISTDSLISSD----QYFSNLESMQHPYLPPPRYDIWLKSLSYLNL 770

Query: 692  TSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILP 751
            T+++C VIVLRKFL GP ++ALPH++ WTYFII+  LK+++  +  S  FW+  MRR+LP
Sbjct: 771  TAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLP 830

Query: 752  WNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGT 811
             N++ SFLNVL+AY LDN Y +  I+ + E   + +   ELL  FN NE LPE+WKCWGT
Sbjct: 831  LNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMD-LQELLTKFNNNEELPEVWKCWGT 889

Query: 812  LWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKG 871
            LWFD I++K   + +++  +G+ DH+F D P+DGI FD  DE GE FW RALRI+FLFK 
Sbjct: 890  LWFDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKK 949

Query: 872  IAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEG--FDESSYSGQPFSTINKLLP 929
            IAE    G+ +S TAPV+CRRDD++ NHIL SFSFK+E    + ++   +  + +  ++ 
Sbjct: 950  IAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIE 1009

Query: 930  LFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVID 989
            + E  +E N+  DA P +S+ + ENIFEY GYK++     +FD+NGEL S++ YT+W   
Sbjct: 1010 MTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW--- 1066

Query: 990  NDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKL 1049
                        Y++   +             +   R+F S +D E++  F ++ N E+ 
Sbjct: 1067 ------------YSAQEIVPKSAASPENSVAGSSPGRSFQS-QDVEENI-FSVFTNEEEN 1112

Query: 1050 NKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELR 1109
            +         T+  D +N   T FV DATSWLRH AHIYKL++N+ L F++CLTTFQELR
Sbjct: 1113 S---------TSLLDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELR 1163

Query: 1110 FLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVD 1169
            FLRKSKDENV+ AAARAII +RQLYS+GK++PLRFTGN+AT IEEHLEFEEQITWRSHVD
Sbjct: 1164 FLRKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVD 1223

Query: 1170 EFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVC 1229
            EFVIE++ KAQ KF+       +       VLV+DD NMKRKA E+ I+TFTT F+F++C
Sbjct: 1224 EFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALC 1283

Query: 1230 RKLGIQDNVCTN 1241
             ++G    +CTN
Sbjct: 1284 SEMGKGRLICTN 1295

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/977 (54%), Positives = 677/977 (69%), Gaps = 62/977 (6%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            +K++S  LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IY++NT+LINNY+T
Sbjct: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLPSQ L D+               LWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+
Sbjct: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNL 500

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RNS LI+YLKHSE MLLPSFLE+ DLQ VV++YF ++FG+D N  NIF  +DMF Q P  
Sbjct: 501  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDF 560

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTM 636
             +++FRHAP+FA+SHILQ+VGFG PKNPFA+LF+LP +L                   T 
Sbjct: 561  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTE 620

Query: 637  SIDTNDSR------GPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLE 687
            S  T +SR        I++++A +++ + + E+F++ID+LR PI  P++L    WL++L+
Sbjct: 621  S-STGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLK 678

Query: 688  HLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMR 747
             LNMTSLKC +IVLRKFL GPL IALPH+LPW YFIIAT LK+    + +S  FW I+++
Sbjct: 679  FLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVK 738

Query: 748  RILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWK 807
            R+ PW+T+ +F+NVL+AY+LDN      I +LC  Y    N   LL+ FN +E LPEIW 
Sbjct: 739  RVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTL-NLAGLLESFNESEELPEIWN 797

Query: 808  CWGTLWFDVISNKRALNA---DTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALR 864
            CWGTLWFD I  K A +    D F  +GI+D+M LD P DGI FD+ DE+GE FW RA R
Sbjct: 798  CWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACR 857

Query: 865  IVFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTI 924
            I+FLF+ ++     G+ VS    + C       + IL++  +K+E       +    + +
Sbjct: 858  IIFLFRELSRTFPIGVIVSNDPLIKCSSS--QSSIILRNLVYKLEPLSNIRSNTPILTAL 915

Query: 925  NKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYT 984
               + + E   + N+D  A P LSV  G+NIF Y GYKKL  +   FDRNGE +S+S+YT
Sbjct: 916  ENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT 975

Query: 985  AWVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYM 1044
             W + N N+++ +  N                            +  E  ++D   E  M
Sbjct: 976  RWYLPNGNNISEALVN----------------------------SDIEKGDEDLFLEC-M 1006

Query: 1045 NPEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTT 1104
             P+                  I+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTT
Sbjct: 1007 KPDCPG---------------IDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTT 1051

Query: 1105 FQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITW 1164
            FQELRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITW
Sbjct: 1052 FQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITW 1111

Query: 1165 RSHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHF 1224
            R+HVDEFVIE++ KAQ K  +A +     +  N+VVL++DD  MK+KA+E+ IKT +T F
Sbjct: 1112 RTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKF 1171

Query: 1225 IFSVCRKLGIQDNVCTN 1241
            +FS+C KLG + ++CT+
Sbjct: 1172 VFSLCTKLGEKRHLCTD 1188

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/977 (53%), Positives = 671/977 (68%), Gaps = 33/977 (3%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            K TS+ L++KLQ+IY+ IVKQE+ELQ+RCSQLT SQTT++KNLW IYK+N +LINNYI+F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTALLPSQ  QD+               LWVYGTITFLDVLKNFSNFMDPEVC QFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VF+S+S ML D+PP++SIPWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +TY H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR F +R+  G+ R
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERS-GGSSR 478

Query: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577
            N  +++YLKHSEVMLLPSFLE+ +LQ+VVL +F  RFGV  N+ + F+ + +F Q    L
Sbjct: 479  NFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKL 538

Query: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMS 637
            R++F HAPAFAESHILQLVGFG+P+NPFA+LF+LP FL                 + T  
Sbjct: 539  RYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNL 598

Query: 638  IDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKC 696
             D N S                V  YF+NIDS R+P   P +I +W +SL +LN+TS++C
Sbjct: 599  DDGNGS------------SSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMEC 646

Query: 697  SVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLT 756
            S+ VL+KFL  PLL ALPH+LPW +F+++  ++  S  + +  KFW + MRRI PWN+L 
Sbjct: 647  SMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLV 706

Query: 757  SFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDV 816
            SFLN L+A++LDN     S+ KLCE Y N  + + L+++F  +E LPE+WKCWGTLWFD 
Sbjct: 707  SFLNTLMAFLLDNSRNMSSVEKLCEEY-NKMDLHTLVEHFTNSEELPEVWKCWGTLWFDT 765

Query: 817  ISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENL 876
            ISNK  L A +    GI DH+FLD P+DGI FD+ DE+G  FW RA R++F+FKG+A+  
Sbjct: 766  ISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF 825

Query: 877  QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDE 936
              G+RVS T P+  RR D+   H LK FSFK E   +  +  + F   +  + +FE I  
Sbjct: 826  HYGIRVSDT-PISTRR-DVTTLHALKRFSFKFEELPQ-EWDNEVFLQSDNFIKVFEPISP 882

Query: 937  TNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNN 996
             N +F+A P LS++ GE+IFE+ GY++++ + + F++NG+L++ S+YT+ +++    +  
Sbjct: 883  INSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER---VAI 939

Query: 997  SQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQA 1056
              G+ +     +             +   R   +  +  +     + M+P  +    D  
Sbjct: 940  QGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSR 999

Query: 1057 SIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKD 1116
                      + N+TYFV DATSWLRHFAH+YKL+TNNVL FA+CLTTFQELRFLRKSKD
Sbjct: 1000 FPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKD 1059

Query: 1117 ENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAV 1176
            E+VV AA RA+IT RQLY E KLLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEAV
Sbjct: 1060 ESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAV 1119

Query: 1177 VKAQNKFISANESVTLRK------------GFNHVVLVTDDINMKRKAQEQGIKTFTTHF 1224
             K+Q KF   N     +              FN VVLVTDD+NM+ KA+   I  F++ F
Sbjct: 1120 YKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRF 1179

Query: 1225 IFSVCRKLGIQDNVCTN 1241
            +F+ C +LG    VC N
Sbjct: 1180 MFAFCNQLGYNQKVCIN 1196

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 50/98 (51%), Gaps = 6/98 (6%)

Query: 44  LRQKRHGSNSYIYKNQKRIARPDDKILNANININ---YIDHNSIVNENATPVKSVLSRRP 100
           L QKRH SNSY Y +     R  +  L+ N++ N          ++ N TP K      P
Sbjct: 30  LHQKRHNSNSYDYYDSGYAKRRPN-TLSQNVSQNDELAASAACFLDSNLTPSKH-QECTP 87

Query: 101 SLSKKSNNVTPQPSFLVTEPPKSPFYVTNQSYTNIDVA 138
           S  +++ + TPQP F   + P+SPFY+   S +N++ A
Sbjct: 88  SSFQRATDETPQP-FYPADTPQSPFYLPTTSSSNLEAA 124

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/976 (55%), Positives = 673/976 (68%), Gaps = 61/976 (6%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            K++   LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IYK+NTDL+NNY+TF
Sbjct: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTALLPSQ   D+               LWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 507

Query: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 508  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFF 567

Query: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMS 637
            +++FRH P+FA+SHILQ+VGFG PKNPFA+LF+LP +L                   T S
Sbjct: 568  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTES 627

Query: 638  IDTNDSRG------PILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLEH 688
              T +SR        I++++  +++ +++ E+F++ID+LR PI  P++L    WL++L+ 
Sbjct: 628  -STGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKF 685

Query: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748
            LNMTSLKC +IVLRKFL GPL IALPH+LPW YFII+  LK+    +  S +FW I+++R
Sbjct: 686  LNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKR 745

Query: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808
              PW+T+ +F+NVL+ Y+LDN      I  LC+ Y    +  ELL+ FN  E LPEI  C
Sbjct: 746  AFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDK-LSLSELLELFNEGEELPEILGC 804

Query: 809  WGTLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRI 865
            WGTLWFD I  K      + D F  +GI+D+M LD P DGI FDE DE GE FW RA R 
Sbjct: 805  WGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRT 864

Query: 866  VFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTIN 925
            +FLF+ ++ +   G+ + R  P+   R      +IL S  FK+E       +      + 
Sbjct: 865  IFLFRELSRSFPIGV-IIRNDPL-IYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALE 922

Query: 926  KLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTA 985
             ++ + E   E N D  A P LSV +G+NIF YVGYKKL  +   FD+NGE +S+S+YT 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 986  WVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMN 1045
            W + N N                                      N + ED+ N+    N
Sbjct: 983  WYVPNSN--------------------------------------NTNIEDNINY----N 1000

Query: 1046 PEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTF 1105
             EK N+ +    I  +   EI+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTTF
Sbjct: 1001 SEKENEGLFLECI-KSDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTF 1059

Query: 1106 QELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWR 1165
            QELRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR
Sbjct: 1060 QELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWR 1119

Query: 1166 SHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFI 1225
            +HVDEFVIE+V+KAQ K  SA+E     + FN+VVL++DD  MK+KA+E+ IKT +T F+
Sbjct: 1120 THVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFV 1179

Query: 1226 FSVCRKLGIQDNVCTN 1241
            FS+C KLG Q ++CT+
Sbjct: 1180 FSLCTKLGEQRHLCTD 1195

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/980 (51%), Positives = 678/980 (69%), Gaps = 53/980 (5%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + +TS+ L++KLQ+IY+ IVKQE+ELQ+RCSQLT SQTT+LKNLW IYK+NT+LINNY+ 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLPSQ  QD+               LWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVFIS+S ML D+P K + PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN  GN 
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQ 445

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RNS +++YLKHSEVMLL SFLE+ +LQ+VVL++F ++FG+  N+ + F  Q +F Q    
Sbjct: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTM 636
             +++FRHAPAFAESHILQ+VGFGNPKNPFALLF+LP FL                  ++M
Sbjct: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSM 565

Query: 637  SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLK 695
               +  S  PI              EY +++DS R   + P ++ +W +SL H+N TS+K
Sbjct: 566  EAPSPTS--PI--------------EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIK 609

Query: 696  CSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTL 755
            CS +VL+KFL GPL+ A  H+LPW YF+++  ++     +     FW  + R++ PWN++
Sbjct: 610  CSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSI 669

Query: 756  TSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFD 815
             +FLN+++A+ LDN ++T SI  LCE + + +    L+D+F++NE+LPE+WKCWG LWFD
Sbjct: 670  VNFLNMIIAFALDNAWKTSSIDNLCEQFDSVD-VRTLVDHFSQNEDLPEVWKCWGALWFD 728

Query: 816  VISNKRAL--NADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIA 873
            VIS+K  +     T+N   ++DHMF D P+DGI FDE DETG  FW RA R+VF+FKGIA
Sbjct: 729  VISDKSDVVDEGATYN--SVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIA 786

Query: 874  ENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFEN 933
            +    GL ++ + P+  RR  +   H L++F FK   F++     + ++ I+  +P FEN
Sbjct: 787  QEFNMGLTLA-SVPLQSRR-SLAAGHPLQNFCFK---FEDPPVDSESYALISTQMPAFEN 841

Query: 934  IDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDND-- 991
            I E NLD +A P  S+++G+++FE  GY++L  ++  F++ G L++ S+YT+  ++    
Sbjct: 842  ISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI 901

Query: 992  NSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLNK 1051
            +  ++    +Y+ + ++             N Q++      D  +    +  MNPE + +
Sbjct: 902  HGGDDFNTERYSRSDELN---------KADNPQIKEL----DKMERMWLDTCMNPEFIEQ 948

Query: 1052 NMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFL 1111
              D    +   +   +  ++YFV DATSWLRHFAH+YKL+TN VL FA+CLTTFQELRFL
Sbjct: 949  TYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFL 1008

Query: 1112 RKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1171
            RKSKDE+VV AA RA+IT+RQLYSE +LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEF
Sbjct: 1009 RKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEF 1068

Query: 1172 VIEAVVKAQNKFISANESV----------TLRKGFNHVVLVTDDINMKRKAQEQGIKTFT 1221
            VIEAV KAQNKF + N             T  + F+ + LV+DD NM+ KA  Q I+TF+
Sbjct: 1069 VIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFS 1128

Query: 1222 THFIFSVCRKLGIQDNVCTN 1241
            + F+F+VC ++G+  + CTN
Sbjct: 1129 SRFMFAVCNQIGLAHHACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/987 (52%), Positives = 668/987 (67%), Gaps = 67/987 (6%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            +  TS+ L++KLQ+IY+ IVKQE+ELQ+RC+QLTTSQTT+LKNLW IYK+N +LINNY+ 
Sbjct: 237  SSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVA 296

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLPSQ  QD+               LWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 297  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 356

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            HVFIS+STML D+P K S PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 357  HVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFG 416

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PS QYMQLVIDNIYQR F +RN  GN 
Sbjct: 417  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN-GGNH 475

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RNS +++YLKHSEVMLL SFLE+ +LQ+VVL++F  +FGV  ++ + F  +DMF Q    
Sbjct: 476  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGER 535

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTM 636
            ++++FRHAPAFAESHILQ VGFG+PKNPFALLF+LP FL                  S  
Sbjct: 536  VKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSH--SFT 593

Query: 637  SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLK 695
            SI+T     P              +EY +N+DS R   + P ++ +W +SL H+N+TS +
Sbjct: 594  SIETTSHLSP--------------SEYLENVDSPRYAYEFPEDLAIWRESLSHINITSAR 639

Query: 696  CSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTL 755
            CS IV +KFLRGPL++A+ H+LPW+YF+++  LK  S  +     FW  ++R+I PWN++
Sbjct: 640  CSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSI 699

Query: 756  TSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFD 815
              FLN+L+A++LDN ++T  I  LCE   + +    L+++F+ +E+LPEIW+CWG LWFD
Sbjct: 700  VDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDA-RSLVEHFSEHEDLPEIWRCWGALWFD 758

Query: 816  VISNKR-ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAE 874
            VI++K    + D  N  G +DH F D P DGI FDE DE GE FW RA R++F+FKGIA+
Sbjct: 759  VIADKSNGEDGDVINS-GSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817

Query: 875  NLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFENI 934
                GL +S  AP    R  +   H L++FSF    F+E     Q  S +   +PLFE I
Sbjct: 818  EFSLGLTLSAFAPQ--SRRPMTAGHPLQNFSFN---FEEIPAQSQIQSFVRNQIPLFEEI 872

Query: 935  DETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVID----- 989
               NLD + RP  S+++GE+IF++ GY++++ +   F+++G L+S S+YT+  ++     
Sbjct: 873  ATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQ 932

Query: 990  -----NDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYM 1044
                 N      S+ +    N Q+T                      E  E D+  +  M
Sbjct: 933  GGDDFNTERYGRSEDSNKPENAQITEL--------------------ERLERDW-LDNCM 971

Query: 1045 NPEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTT 1104
            NPE + +  +    +   +   +  ++YFV DATSWLRHFAH++KL+TNNVL F +CLTT
Sbjct: 972  NPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTT 1031

Query: 1105 FQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITW 1164
            FQELRFLRKSKDE+VV AA RA+IT+RQLYS+ KLLPLRFTGNVAT +EEHLEFEEQITW
Sbjct: 1032 FQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITW 1091

Query: 1165 RSHVDEFVIEAVVKAQNKFISANE----------SVTLRKGFNHVVLVTDDINMKRKAQE 1214
            RSHVDEFVIEAV KAQ KF + N           + T  + F+ V LV+DD NM+ KA  
Sbjct: 1092 RSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHT 1151

Query: 1215 QGIKTFTTHFIFSVCRKLGIQDNVCTN 1241
            Q I+TF+T F+F+VC ++G+    CTN
Sbjct: 1152 QRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/982 (52%), Positives = 652/982 (66%), Gaps = 80/982 (8%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FI TALL +Q + D+               LWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            + FIS+S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNK---N 513
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR+    N
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439

Query: 514  GNV---RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570
             N    RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N++F+T+DMF
Sbjct: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499

Query: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXX 630
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF LP +L               
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYL--------------- 544

Query: 631  XXISTMSIDTNDSRGPILNTSAYVNEGNI---VTEYFDNIDSLRLPI-DHP-NILVWLKS 685
                         R     TS+Y +  ++      YF NID+L     D P N+ +WL S
Sbjct: 545  ---KLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDS 601

Query: 686  LEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIV 745
            L H+NMTS++CS+ VL KFL  PL++ALPH L W +FI+A   K +   +   V FW   
Sbjct: 602  LNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHF 661

Query: 746  MRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEI 805
            +RR +PWN++ +  NVL+ Y+LDN +    + K  E + + E   +L++Y+N NENLPEI
Sbjct: 662  LRRTMPWNSIVTLGNVLVCYMLDNLHPF--LKKELEKFYSLE-LDDLIEYYNENENLPEI 718

Query: 806  WKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRI 865
            WKCWGTLWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R 
Sbjct: 719  WKCWGTLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRA 773

Query: 866  VFLFKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYS-GQPFST 923
            V L KGIA+     GL+VS  A V CRR+DI P++ LK+ +FK++ +DE +Y+       
Sbjct: 774  VLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDD 833

Query: 924  INKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIY 983
            +   + + E I+  N+D  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IY
Sbjct: 834  LYDTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY 893

Query: 984  TAWVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELY 1043
            + W         ++ GN  T ++                       S E   D  N  L 
Sbjct: 894  SQW---------SNVGNGVTLDV-----------------------SGESIYDVANNNLS 921

Query: 1044 MNPEKLNKNMDQASIWTTANDEINRNIT-YFVFDATSWLRHFAHIYKLSTNNVLNFAVCL 1102
            ++ EK+    D+ +  +  +DE N N T YFV DATSWLRHFAHI+KL+ NN L FA+CL
Sbjct: 922  LHWEKI--FFDKIAAASKGSDE-NYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICL 978

Query: 1103 TTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQI 1162
            TTFQELR+LR SKD+ VV AA R++IT+RQLY E K++P+RFTGN+AT +EE+LEFEEQI
Sbjct: 979  TTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQI 1038

Query: 1163 TWRSHVDEFVIEAVVKAQNKFISANESVT---LRKGFNHVVLVTDDINMKRKAQEQGIKT 1219
            TW++HVDEFVI+A+ K   +F +  E +T     KG    VLVTDD NM +KA+++ IKT
Sbjct: 1039 TWKTHVDEFVIDAIAKLNQRFQA--ERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKT 1096

Query: 1220 FTTHFIFSVCRKLGIQDNVCTN 1241
              T ++FS+  KLGI   +CTN
Sbjct: 1097 CNTKYLFSLGSKLGINSGLCTN 1118

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 25  TQDNNNNIDIFRPISPSAA--LRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH- 81
           ++ NNN+  I   + P++A  L QKRH S+S+    +   A+     +   +   +ID  
Sbjct: 19  SRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVDPVGKGFIDGI 78

Query: 82  -NSIVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYV 127
            NS ++   TP K+   SRRPS+S+K    TPQ    S    + PKSP+YV
Sbjct: 79  TNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTMDVPKSPYYV 129

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/980 (51%), Positives = 651/980 (66%), Gaps = 76/980 (7%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FI TALL +Q + D+               LWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            + FIS+S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN- 515
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR  +G  
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439

Query: 516  -----VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570
                  +NS LIDYLKH+EVMLLPSFLEN DLQ VVL YF ++FG D+N N++F+T+DMF
Sbjct: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499

Query: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXX 630
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF LP +L               
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKK----- 554

Query: 631  XXISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDH--PNILVWLKSLEH 688
                + + +T   R P  +  +          YF NID+L    D    N+ +WL+SL H
Sbjct: 555  ---RSSATETPQYRDPFHDKKS-------PESYFQNIDALSSNFDDIPTNLNIWLESLNH 604

Query: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748
            +NMTS++CS+ VL KFL  P +IALPH L W YF++A   + ++  +   + FW   +RR
Sbjct: 605  INMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRR 664

Query: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808
             +PWN++ S  NVL+ Y+LDN +    + K  E++ +FE   +L+++FN NENLPEIWKC
Sbjct: 665  TMPWNSMVSLANVLVCYMLDNLHPF--LKKELESFYSFE-LDDLIEHFNENENLPEIWKC 721

Query: 809  WGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFL 868
            WG+LWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R + L
Sbjct: 722  WGSLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISL 776

Query: 869  FKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTIN-K 926
             KGIA+     GL+V+  APV CRR+DI  ++ L+ F+FK++ +DE + +         +
Sbjct: 777  LKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYE 836

Query: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986
             + + E ID  NLD  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IY+ W
Sbjct: 837  TIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896

Query: 987  VIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNP 1046
                     ++ GN    ++                       SNE   D  + +L ++ 
Sbjct: 897  ---------SNVGNGVPIDV-----------------------SNEPIYDVTDNDLSLHW 924

Query: 1047 EKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQ 1106
            EK+    D+ +      DE +    YFV DATSWLRHFAHI+KL+ N++L+FA+CLTTFQ
Sbjct: 925  EKI--FFDRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQ 982

Query: 1107 ELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRS 1166
            ELR+LR SKD+NVV AA R++IT+RQLY E K++P+RFTGN+AT +EE+LEFEEQITW++
Sbjct: 983  ELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKT 1042

Query: 1167 HVDEFVIEAVVKAQNKF-----ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFT 1221
            HVDEFVI+A+ K    F     I+ N++    K     VLVTDD NM +KA+++ IKT  
Sbjct: 1043 HVDEFVIDAIAKLNQNFQTERMIAENKN----KNKQFAVLVTDDDNMNKKAKDKMIKTCN 1098

Query: 1222 THFIFSVCRKLGIQDNVCTN 1241
            T ++FS+  KLGI   +CTN
Sbjct: 1099 TKYLFSLGSKLGINSGLCTN 1118

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 36  RPISPSAALRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH--NSIVNENATPVK 93
           RP + +A L QKRH S+S+    +   A+     +   +   +ID   N  ++   TP K
Sbjct: 33  RPTT-TAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQNTPSK 91

Query: 94  -SVLSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYV 127
              +SRRPS+S+K    TPQ    S    + PKSP+YV
Sbjct: 92  VDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYV 129

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/981 (51%), Positives = 648/981 (66%), Gaps = 78/981 (7%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + + ++  I+KLQ IY+IIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FI TALL +Q + D+               LWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            + FIS+S+ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN- 515
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR+  G  
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439

Query: 516  -----VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570
                  RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N+IF+T+DMF
Sbjct: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499

Query: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXX 630
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF LP +L               
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKK----- 554

Query: 631  XXISTMSIDTNDSRGPILNTSAYVNEGNIVTE-YFDNIDSLRLPIDH--PNILVWLKSLE 687
                + + +    R P         +  I +E YF NIDSL    D    N+ +WL SL 
Sbjct: 555  ---KSGATEVPQYRDPF--------DDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLN 603

Query: 688  HLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMR 747
            H+NMTS++CS+ VL KFL  PL++ALPH L W +FI+A   K ++  + +   FW   +R
Sbjct: 604  HINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLR 663

Query: 748  RILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWK 807
            R +PWN++ +  NVL+ Y+LDN +    + +  E + + E   +L++YFN NENLPEIWK
Sbjct: 664  RTMPWNSMVNLANVLVCYMLDNIHPF--LERELERFYSLE-LDDLIEYFNENENLPEIWK 720

Query: 808  CWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVF 867
            CWG+LWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R + 
Sbjct: 721  CWGSLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775

Query: 868  LFKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYS-GQPFSTIN 925
            + KG+A+     GL+V+  APV CRR+DI P++ LK+F+FK++ ++E+ ++       + 
Sbjct: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELY 835

Query: 926  KLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTA 985
              + + E I+  N D  A P LSVV GENIFEY GY +L  + H FD+NG   S+ IY+ 
Sbjct: 836  DTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895

Query: 986  WVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMN 1045
            W         ++ GN    ++                       S+E   D  N  L  +
Sbjct: 896  W---------SNVGNGMVLDV-----------------------SSESMYDAANNNLSPH 923

Query: 1046 PEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTF 1105
             EK+    D+ +      D+      YFV DATSWLRHFAHI+KL+ NN+L FA+CLTTF
Sbjct: 924  WEKI--FFDRITTAGHNGDKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTF 981

Query: 1106 QELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWR 1165
            QELR+LR SKD+NVV AA R++IT+RQLY E K++PLRFTGN+AT++EE+LEFEEQITW 
Sbjct: 982  QELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWE 1041

Query: 1166 SHVDEFVIEAVVKAQNKF-----ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTF 1220
            +HVDEFVI+A+ K    F     I  N++    K   + VLVTDD NM  KA+++ IKT 
Sbjct: 1042 THVDEFVIDAIAKLNQNFQTERLIDKNKN----KNNAYAVLVTDDDNMDGKAKDKMIKTC 1097

Query: 1221 TTHFIFSVCRKLGIQDNVCTN 1241
             T ++FS+  K+GI   +CTN
Sbjct: 1098 NTKYLFSLGSKIGINSGLCTN 1118

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (50%), Gaps = 9/120 (7%)

Query: 28  NNNNIDIFRPISPS--AALRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH--NS 83
           N++N  +   + P+  A L QKRH S+S+    +    +     +   +   +ID   + 
Sbjct: 22  NDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASG 81

Query: 84  IVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYVTNQSYT-NIDVA 138
            V+   TP K+  +SRRPS+S+K+   TP+    S    + PKSP+Y+   + T N++V 
Sbjct: 82  QVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVV 141

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/984 (51%), Positives = 648/984 (65%), Gaps = 48/984 (4%)

Query: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
            +K+S+VL++KLQ+IYK IVKQE+ELQ+RC +LT SQTTELKNLW+IY++N++L++NYITF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 338  ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
            ITTA+ P+Q   D Q              LWVYGTITFLD+LKNFSNFMDPEVC QFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
            VFIS+S ML D+P K+ + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517
            GKLYYHMSTVQQNTLEAFVNLGKS+FC++TF PSQQY+QLVI NIYQR + D N + N R
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 518  NSDL-IDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYND--NNIFETQDMFFQVP 574
            N  L +DY+KH EV LLP+F E+++LQQVVL YF D+FGVDYN+  NN+F ++ MF Q  
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 575  ASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXIS 634
               + ++R++ AFAES ILQ+VG+GN K+PF+LLF+LP +L                 + 
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 635  -TMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPN-ILVWLKSLEHLNMT 692
             T     +   G  L T    N      E+F+NID++  P   PN + +W  SL++ N  
Sbjct: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHV 797

Query: 693  SLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPW 752
            S+KCS+IV +KFL  P +IALPH LPW YFII+  L+    KN +  +FW   +RRI PW
Sbjct: 798  SIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPW 857

Query: 753  NTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTL 812
            N++  FLNVLLAY++DN ++   + +LC  Y N  +  ELL YFN NE LPE+WKC G+L
Sbjct: 858  NSIVKFLNVLLAYMVDNCWEQSILNELCPFY-NSMSLDELLTYFNENEELPEVWKCRGSL 916

Query: 813  WFDVISNKRALNADT--------------FNGLGIEDHMFLDFPLDGIGFDELDETGENF 858
            WFD I  K  LN D               + G G++D+ F DFP+DG  FDE DE GE F
Sbjct: 917  WFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERF 976

Query: 859  WNRALRIVFLFKGIAENLQT--GLRVSRTAPVHCRR-DDIDPNHI---LKSFSFKMEGFD 912
            W RA R++FLFK +AE+     GL +S  APV  RR D+   N +   L  FSFK+    
Sbjct: 977  WKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASS 1036

Query: 913  ESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFD 972
            +          ++ ++  FE  DE N D    PMLS+V G++IF+YVGYK++  N +SFD
Sbjct: 1037 DGV-------MLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFD 1089

Query: 973  RNGELVSSSIYTAWVIDN-DNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASN 1031
            +NG+ +S+S + +W I N  N L+ +  +  T +   +            N  M      
Sbjct: 1090 KNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNELLV- 1148

Query: 1032 EDTEDDFNFELYMNPEKLNKNMDQASIWTTANDEIN-RNITYFVFDATSWLRHFAHIYKL 1090
                  FN E +    K  +      I+  +   I+ +  TYF+ DATSWLRHFAHIYK+
Sbjct: 1149 ------FN-ECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKI 1201

Query: 1091 STNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVAT 1150
            +T+ +L FA+CLTTFQELR+LRKSKD NVV AA RAIIT+RQLY E  LLPLRFTGNVAT
Sbjct: 1202 ATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVAT 1261

Query: 1151 DIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESVTL-----RKGFNHVVLVTDD 1205
             IEEHLEFEEQITWRSHVDEFVIEAV+KA+ K       + +      K    ++LVTDD
Sbjct: 1262 HIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDD 1321

Query: 1206 INMKRKAQEQGIKTFTTHFIFSVC 1229
            I MK KA ++ IKTF+T FIFS+ 
Sbjct: 1322 ITMKNKAMDRKIKTFSTRFIFSMA 1345

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/977 (51%), Positives = 645/977 (66%), Gaps = 70/977 (7%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IYKLNT+LI NYI 
Sbjct: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FI TALL +Q + D+               LWVYG ITFLDVLK+FSNFMDPEVC QFIT
Sbjct: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            + FI +S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDR---NKN 513
             GKLYYH++T+QQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR   N N
Sbjct: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438

Query: 514  GNV---RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570
             N    RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N++F T+DMF
Sbjct: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498

Query: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXX 630
             Q P SLR+YFRHAPAFAES ILQL+GFGNPKNPFALLF LP  L               
Sbjct: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKK----- 553

Query: 631  XXISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP--NILVWLKSLEH 688
                + + +    R P      + ++G+    YF NID+L    + P  NI +WL SL +
Sbjct: 554  ---KSGAAEIPHYRDP------FDDQGS-SESYFQNIDTLNSDFNDPPTNIGIWLDSLNY 603

Query: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748
            +NMTS++CS+ VL KFL  PL +ALPH L W +FIIA   K ++  +     FW   +RR
Sbjct: 604  INMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRR 663

Query: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808
             +PWN++ +F NVL+ Y+LDN +    + K  E + + E   +L++YFN NENLPE+WKC
Sbjct: 664  TMPWNSMVTFSNVLVCYMLDNLHPF--LEKQLEKFYSLE-LDDLIEYFNENENLPEVWKC 720

Query: 809  WGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFL 868
            WG+LWFD +        D     G++DH+F D PLDGI FD+ DE GE FW R++R +  
Sbjct: 721  WGSLWFDAVK-----KCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILT 775

Query: 869  FKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYS-GQPFSTINK 926
             KGIA+     GL+V+  A V CRR+DI P++ LK+ +FK++ ++E +++       +  
Sbjct: 776  LKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYD 835

Query: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986
             + + E I+  N+D  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IYT W
Sbjct: 836  TIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW 895

Query: 987  VIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNP 1046
                     ++ GN  T ++                       S+E   D    +L ++ 
Sbjct: 896  ---------SNVGNGVTLDV-----------------------SSESLYDSTTNDLSLHW 923

Query: 1047 EKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQ 1106
             K+    D+        D+      YFV DATSWLRHFAHI+KL+ NN+L FA+CLTTFQ
Sbjct: 924  AKI--LFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQ 981

Query: 1107 ELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRS 1166
            ELR+LR SKD+NVV AA R++IT+RQLY E K++P+RFTGN+AT IEE+LEFEEQITW++
Sbjct: 982  ELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKT 1041

Query: 1167 HVDEFVIEAVVKAQNKFISANESVTLRKGFNH--VVLVTDDINMKRKAQEQGIKTFTTHF 1224
            HVDEFVI+A+ K    F     ++   KG +    VLVTDD NM +KA+++ IKT  T +
Sbjct: 1042 HVDEFVIDAIAKLNQNF-QTERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKY 1100

Query: 1225 IFSVCRKLGIQDNVCTN 1241
            +FS+  KLGI   +CTN
Sbjct: 1101 LFSLGSKLGINSGLCTN 1117

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query: 25  TQDNNNNIDIFRPISPSAA--LRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH- 81
           ++ +NN   +   + P+ A  L QKRH S+S+    +   A+     +   +   +ID  
Sbjct: 19  SRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGI 78

Query: 82  -NSIVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYVTNQSYT-NI 135
             S ++    P K+  +SRRPS+S+K+   TPQ    S    + PKSP+YV   + T N+
Sbjct: 79  TTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNM 138

Query: 136 DVA 138
           +V 
Sbjct: 139 EVV 141

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1034 (47%), Positives = 655/1034 (63%), Gaps = 93/1034 (8%)

Query: 279  KTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFI 338
            ++++ LI KLQ+IYK I+ QE+ELQ  CS +T+SQTT+LK +W +YK+N +L+NNY+ FI
Sbjct: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330

Query: 339  TTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 398
            TTALLPSQS  D+               LWVYGTITFLDVLK+FSNFMDPE+C QFI HV
Sbjct: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390

Query: 399  FISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 458
            FIS++ M   +P K SIPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  G
Sbjct: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450

Query: 459  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRN 518
            KLYYHM+TVQQN+L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQR ++ R +  +  N
Sbjct: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS-SN 509

Query: 519  SDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLR 578
              ++DYLKH+E+M+LP+F+EN +LQ++   YF+++FG D+  NN F+T+ MF Q   S++
Sbjct: 510  VQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVK 569

Query: 579  FYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMSI 638
            FYFRH+P FA++HILQ+VG+GN  N FALL++LP F+                 +  MSI
Sbjct: 570  FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI--KDNEISRQRKKSKTGVDNMSI 627

Query: 639  DTNDSRGPILNTSAYVNEGNIVTEYF---DNIDS-LRLPIDHPNILVWLKSLEHLNMTSL 694
            DT       L+     NE + V EYF   +NID    LP   PN+ +W++SL++ N T +
Sbjct: 628  DT-------LSFQVSGNEIHDVGEYFNSLENIDKEFTLP---PNVDIWIQSLQYTNTTGI 677

Query: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754
             C ++VL+KFL+GP + ALPH+LPW YF+I+   K ++ ++T+S  FW + +RRI PWNT
Sbjct: 678  FCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNT 737

Query: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWF 814
            + +FLNVL+A++ DN      + +LCETYS   +  E+L  F+ NE LPE+W CWG+LWF
Sbjct: 738  IINFLNVLIAFLKDNSDSCSLVNQLCETYSQL-SLDEILTNFSENEELPEVWNCWGSLWF 796

Query: 815  DVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAE 874
            D I NK   +       GI+D  FLD P DGI FDE D+ G  FW RA RI+FLFKG AE
Sbjct: 797  DTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE 856

Query: 875  NLQTGLRVSRTAPVHCRRDDIDPNHILK---SFSFKME------GFDESSYSG-QPFSTI 924
                GLR++    ++   ++I      K    F FK +        DE+S    Q +S  
Sbjct: 857  KFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLF 916

Query: 925  NKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYT 984
             + LP FE+I E N+  DA P LSV+ GE+IF+YVGYKKL    + +D+NG +   +IY+
Sbjct: 917  TEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYS 976

Query: 985  AWVIDNDNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRN---FA-------SNEDT 1034
             W         N  GN     M+              NF++R    FA       S E +
Sbjct: 977  NW------EAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESS 1030

Query: 1035 EDDFNFE----------LYMNPEKLNK----NMDQASIWTTANDEINRNI------TYFV 1074
            +     E             N  K++K      D  +I+ T   +IN  +      TYF+
Sbjct: 1031 DHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTI--KINGEMRVAYYSTYFI 1088

Query: 1075 FDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLY 1134
            FDAT+WLRHFAHIYK++ + +LNF +CLTTFQELRFLR+S+DENV+ AA RA+I +R LY
Sbjct: 1089 FDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLY 1148

Query: 1135 SEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFI---------- 1184
               K++PLRF G +A+ IEEHLEFEEQITWRSHV+EFVIEAV K+Q   +          
Sbjct: 1149 KLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAK 1208

Query: 1185 ---------SANESVTLRKGFNHV--------VLVTDDINMKRKAQEQGIKTFTTHFIFS 1227
                     +A+ + T ++G ++         VLVTDD NM  KA+E+GI+T +T FIFS
Sbjct: 1209 ADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFS 1268

Query: 1228 VCRKLGIQDNVCTN 1241
            +C +LG++  +CTN
Sbjct: 1269 ICSQLGMKYGICTN 1282

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/982 (49%), Positives = 637/982 (64%), Gaps = 59/982 (6%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
             K++S+ L+EKLQ IY+ IV+QE ELQQRCSQLTTSQTT+LKNLW IYK+N +LI+NY  
Sbjct: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLP+Q   D+               LWVYGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            +VFIS+S ML D+PPK SI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+T+ 
Sbjct: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN +G+ 
Sbjct: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-SGHH 516

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            RN+ L++YLKH+EVMLLPSFLE+ +LQ VVL +F  +FGV  N  + F+ + +F Q    
Sbjct: 517  RNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSER 575

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTM 636
            L+ +FRHA  +AESH+LQLVGFG+P+NPFALLF+LP  L                  ++ 
Sbjct: 576  LKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS---TST 632

Query: 637  SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLK 695
              DT+     I +  A+       +E+F+ IDS +     P +I +W +SL + N+T++K
Sbjct: 633  QYDTS-----IDDDCAFAAP----SEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMK 683

Query: 696  CSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTL 755
            CS+IVLRKFL GPLL ALPH+LPW YF+ AT  +  +       +FW  ++R++ P+NT+
Sbjct: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743

Query: 756  TSFLNVLLAYILDNFYQTESIAKLCETYSNF--ENFYELLDYFNRNENLPEIWKCWGTLW 813
             +FLNVLL Y+ +   QT++     E +  F   +  +L+ YF  NE LPE+W+CWGTLW
Sbjct: 744  ITFLNVLLLYMNN---QTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLW 800

Query: 814  FDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIA 873
            FD ++ K   N    N  G++DHMF+D P+DGI FD  DE+GE FW R  R++ LF+ +A
Sbjct: 801  FDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALA 860

Query: 874  ENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFEN 933
                 GLR            +I      +S  FK E    S +          +   FE 
Sbjct: 861  LECPVGLR------------EISGGRNWRSLVFKFEE-PPSEWCDMYLEPFTLVFDTFEQ 907

Query: 934  IDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDND-- 991
            I   NLD  A P   +    +I    GY+ L  + + F+RNG++++ S+YT   +++   
Sbjct: 908  ISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGI 967

Query: 992  NSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLNK 1051
            +  ++  G +   N ++               + R++ S  D E+    + ++       
Sbjct: 968  HGGDDFNGKRLLENGELVST------------ERRDYNSLIDREEQPIMDEFLRHTHCKN 1015

Query: 1052 NMDQASIWTTANDEI--NRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELR 1109
            ++    +    +     + ++TYFV DAT+WLRHF H+YKL+ NN+L FA+CLTTFQELR
Sbjct: 1016 DVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELR 1075

Query: 1110 FLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVD 1169
            FLRKSKDE+V+ AA RA+IT+RQLY E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVD
Sbjct: 1076 FLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVD 1135

Query: 1170 EFVIEAVVKAQNKFISANESVTLR----------KGFNHVVLVTDDINMKRKAQEQGIKT 1219
            EFVIEA+ KAQ+KF + N+               + FN + LVTDD+NM+ KA  Q IK 
Sbjct: 1136 EFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKA 1195

Query: 1220 FTTHFIFSVCRKLGIQDNVCTN 1241
            F+T F+FSVC +LG   NVCTN
Sbjct: 1196 FSTRFMFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/983 (49%), Positives = 641/983 (65%), Gaps = 59/983 (6%)

Query: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
            +K +S+ L+EKLQ IYK IVKQE ELQ+RCSQLTTSQTT+LKNLW IYKLN +LI+NY T
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 337  FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
            FITTALLP+Q   D+               LW+YGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
            +VFIS+S +L ++PP  S+ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + 
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN +G+ 
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-SGHH 554

Query: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576
            R S +++YLKH+EVMLLPSFLEN + Q VVL +F+ +FG      N F+   +F Q    
Sbjct: 555  RYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGAT-GSANFFDPSLIFVQDCER 613

Query: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXX-IST 635
            L+ +FRHA  +AESHILQLVGFG+P+NPFALLF+LP  +                   S 
Sbjct: 614  LKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSD 673

Query: 636  MSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL-VWLKSLEHLNMTSL 694
            MSID      P+              ++F+ ++S +        L +W +SL ++N TS+
Sbjct: 674  MSIDDTFLGDPV--------------QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSM 719

Query: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754
            +CS++VLRKFL   LL ALPH+LPW YF++A  L+  + +N  S +FW + +R+I PW +
Sbjct: 720  RCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWES 779

Query: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFEN--FYELLDYFNRNENLPEIWKCWGTL 812
            +T+FLNVLL YI D   Q  +   + E  +N+ N    ELL+YF  NE+LPE+W CWGTL
Sbjct: 780  ITNFLNVLLLYIND---QKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTL 836

Query: 813  WFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGI 872
            WFDVI++K   N    +  G++DHMFLD P+DGI FD  DE+GE FW R +R++ LF+GI
Sbjct: 837  WFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGI 896

Query: 873  AENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDE--SSYSGQPFSTINKLLPL 930
            A     G              + + +   KS  FK   F+E  + +  Q   + +K    
Sbjct: 897  AYQFPFGF------------TEFNGSDDWKSLVFK---FNEPPAEWKEQYLGSFSKEYGE 941

Query: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990
            FE+I   N D  + P   +V G +I    GYK+L  +   F++NG+L++ S+YT+ + + 
Sbjct: 942  FESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001

Query: 991  DNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTE--DDFNFELYMNPEK 1048
             + + N   +  ++   +             N    N    E+T   D+F   L      
Sbjct: 1002 GSGVPNDSEDFGSTKRLLENELLVTSERRDYN----NLLDKEETPIIDEF---LKWRYSS 1054

Query: 1049 LNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQEL 1108
             N   +Q           + ++TYFV DAT+WLRHF H+YKL+T+N+L FA+CLTTFQEL
Sbjct: 1055 TNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQEL 1114

Query: 1109 RFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHV 1168
            RFLRKSKDE+V+ AA RA+IT+RQLY E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHV
Sbjct: 1115 RFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHV 1174

Query: 1169 DEFVIEAVVKAQNKF--------ISANESV-TLRKG-FNHVVLVTDDINMKRKAQEQGIK 1218
            DEFVIEA+ KAQ+KF         S  ES+ T+  G FN + LVTDDINM+ KA+ Q I+
Sbjct: 1175 DEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIR 1234

Query: 1219 TFTTHFIFSVCRKLGIQDNVCTN 1241
             F+T F+F++C ++G+   VCT+
Sbjct: 1235 AFSTKFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/981 (48%), Positives = 629/981 (64%), Gaps = 58/981 (5%)

Query: 284  LIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTALL 343
            L+EKLQ IYK IVKQE ELQ+RCS LTT QTT+LKNLW  YK+N +LI+NYI FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 344  PSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFISLS 403
            PSQS   +               LWVYGTITFLDVLKNFSNFMDPEVC QFI +VFI+LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 404  TMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 463
             ML DLPPK+SIPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 464  MSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDLID 523
            MSTVQQNTLEAFVNLGKSVFC+D F PS QYMQLVIDNIYQR F +R+ +GN R + ++D
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGN-RTNHIVD 522

Query: 524  YLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYFRH 583
            YLKH+EVMLLPSFLE+ +LQ VV++YF  +FGV  +  N F+   +F Q    L+ +FRH
Sbjct: 523  YLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVS-SSGNFFDPNLIFIQDAERLKHFFRH 581

Query: 584  APAFAESHILQLVGFGNPKNPFALLFDLPNFLXXXXXXXXXXXXXXXXXISTMSIDTNDS 643
            +  F++SHILQL GFG+PKNPFA+LF+L   L                  ST S     S
Sbjct: 582  SSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKK-------STKST----S 630

Query: 644  RGPILNTSAYVNEGNIVTE-YFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKCSVIVL 701
             G  L+   + ++    TE +F  IDS ++P + P ++ VW +SL ++N+TS+KC +IVL
Sbjct: 631  EGS-LDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVL 689

Query: 702  RKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNV 761
            R+FL GP++ ALPHVLPW  FII+  ++     + +  KFW + +RRI PW++L +F+N 
Sbjct: 690  RRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNT 749

Query: 762  LLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKR 821
            L+ Y +    +   I     TY    N  ELL     NENLPE W CWG+LWF+ IS K 
Sbjct: 750  LIHYCMVTGTKNFDIDAHMSTYLPM-NREELLTSICENENLPECWSCWGSLWFNTISKKS 808

Query: 822  ALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQTGLR 881
             L+  T    G+ D +FLD P +GI FD+ DE G  +W R  R + LF     N+ T   
Sbjct: 809  DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLF-----NIITEWE 863

Query: 882  VSRTAPVHCRRDDIDPNHI-LKSFSFKMEGFDESSYSGQPFSTINKLLPL--FENID--- 935
                    C++  ++P     K+  F+         S + +   N+  P   FE I    
Sbjct: 864  ACDGYGHGCKK--LNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLN 921

Query: 936  -ETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSL 994
               NL   ++ M+  V  EN+    G+K ++ +   F++NG+L+++S+YT   ++   + 
Sbjct: 922  CSDNLQDGSKSMIPGVSIENL---QGFKLMYPDYFCFNKNGDLITASLYTKGPLE---TA 975

Query: 995  NNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMD 1054
            N   G+ + +N  +                   ++S  D  +    E +MNP+   + + 
Sbjct: 976  NIQGGDDFNANKILDNGRLVVQDRL-------EYSSAIDKLEQPWLEAFMNPDFRQRELL 1028

Query: 1055 QASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKS 1114
              S     N + + N+T+FV DAT+WLRHFAHIYKL+T++VL FA+CLTTFQELRFLRKS
Sbjct: 1029 NRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKS 1088

Query: 1115 KDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIE 1174
            KDE+V+ AA RA+I +RQLY E KLL LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+
Sbjct: 1089 KDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVID 1148

Query: 1175 AVVKAQNKF--------------ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTF 1220
            A+ KAQ+KF              I  +E     + FN V LVTDD NM+ KAQ+ GI+TF
Sbjct: 1149 AIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTF 1208

Query: 1221 TTHFIFSVCRKLGIQDNVCTN 1241
            +T F+F++CR+LG +  VCTN
Sbjct: 1209 STRFVFAICRELGRETGVCTN 1229

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 18/116 (15%)

Query: 38  ISPSAALRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDHNSIVNENATPVKSVL- 96
           ++  + L QKRH SNS  Y +   I R     +  N++I+  +   I  E    + + L 
Sbjct: 8   MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAE---IPQEPCQYLDTSLL 64

Query: 97  ---------SRRPSLSKKSN---NVTPQPSFLVT--EPPKSPFYVTNQSYTNIDVA 138
                     + PS++K        TPQP  + T  E P+SPFY+   S TN + A
Sbjct: 65  TSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA 120

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  503 bits (1294), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 251/382 (65%), Positives = 287/382 (75%), Gaps = 44/382 (11%)

Query: 277 TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336
           TK +S+ LI+KLQ+IYK+IVKQE++LQ RCSQLTTSQTT+LKNLW+IYK+N DLINNYI 
Sbjct: 391 TKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYIN 450

Query: 337 FITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396
           FIT ALLP+QS  D+               LWVYGTITFLDVLK+FSNFMDPEVC QFI+
Sbjct: 451 FITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFIS 510

Query: 397 HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456
           HVFI++S +L D+P K+SI WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYS
Sbjct: 511 HVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYS 570

Query: 457 HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516
           HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN NGN 
Sbjct: 571 HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNH 629

Query: 517 RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGV-------------------- 556
           RN  LI+YLKH+EVMLLP+FLE+ DLQ VVL YF  +FG+                    
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 557 -----------------------DYNDNNIFETQDMFFQVPASLRFYFRHAPAFAESHIL 593
                                   +   +IF  QDMF Q P  L+++FRH+  FA+SHIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 594 QLVGFGNPKNPFALLFDLPNFL 615
           QLVGFG+PKNPFALLF+LP FL
Sbjct: 750 QLVGFGDPKNPFALLFELPKFL 771

 Score =  473 bits (1218), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 271/597 (45%), Positives = 357/597 (59%), Gaps = 80/597 (13%)

Query: 655  NEGNIVTE-YFDNIDSLRLPIDHPN-ILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIA 712
            N  NI+ E +F+NID L+ P   P  I +WL+SL+++N+ SLKCS+IVL+KFL GP+LIA
Sbjct: 859  NYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIA 918

Query: 713  LPHVLPWTYFIIATFLKAQSSKNTSSVK-FWTIVMRRILPWNTLTSFLNVLLAYILDNFY 771
            LPH+L W +FII+  LK ++S   +  K FW   ++ I+PWN++ +FLNVL+ Y+LDN  
Sbjct: 919  LPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNIN 978

Query: 772  QT--ESIAKLCETYSNF--ENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNAD- 826
                + I  L   Y++    +  E+L +FN+NENLPEIWKCWGTLWFDVI NK  +N+D 
Sbjct: 979  DENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN-INSDT 1037

Query: 827  ------------------------------TFNGLGIEDHMFLDFPLDGIGFDELDETGE 856
                                          T   +GIEDH  LD PLDGIGF   DE G 
Sbjct: 1038 TFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGI 1097

Query: 857  NFWNRALRIVFLFKGIAENLQT-GLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGF---- 911
            NF+ R++R++FL K + E     GL++S     +CR   I  N IL +F+FK+       
Sbjct: 1098 NFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPS 1157

Query: 912  -------------------DESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKG 952
                               D+  ++    S I +   + E I+E NL+   +P LS++ G
Sbjct: 1158 LIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGG 1217

Query: 953  -ENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMTXX 1011
             ENIF Y+GYK+L  N  SF  NGE++S SIY++W ID +      Q  Q   ++     
Sbjct: 1218 NENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHL----- 1272

Query: 1012 XXXXXXXXXXNFQMRNFASNEDTEDDFNFELYMNPE---KLNKNMDQASIWTT--ANDEI 1066
                        +  N    + T +D +F+ +M      KL+   + +    T      I
Sbjct: 1273 ------VNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSI 1326

Query: 1067 NRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARA 1126
            N++ T+FVFDATSWLRHFAHIYKLS N  L FAVCLTTFQELRFLRKSKD NVV A+ RA
Sbjct: 1327 NKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRA 1386

Query: 1127 IITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKF 1183
            IITMRQLY EGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEA++++Q +F
Sbjct: 1387 IITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 8/49 (16%)

Query: 89  ATPVKSVLSRRPSLSKKSNNVTPQPSFL--VTEPPKSPFYVTNQSYTNI 135
           AT +KS     PS +  S N+TPQ S     +EPP SP+Y+T  SY+N+
Sbjct: 192 ATTIKS-----PS-NHTSVNITPQASNYDPASEPPNSPYYLTTNSYSNM 234

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  416 bits (1070), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 270/413 (65%), Gaps = 75/413 (18%)

Query: 278 KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337
           KK+++ LI+KLQNIYK+IV QE+ELQ +C++L+TSQ+T+LK LWSIYKLN DLINNYI F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 338 ITTALLPSQSLQDIQXXXXXXXXXXXXXXLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397
           I T+L PSQS+ D                LW+YGTITFLD+LKNF+NFMDPE+ SQFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 398 VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457
           VF S+S M+ DLP     PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SH
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 458 GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKN---- 513
           GKLYYH+STVQQN LEAFVNLGKSVFC DTF PSQ+YMQLVIDNIYQR F++RN N    
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 514 ------------------GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFG 555
                              N +   LI+YLKHSEVMLLP+FLEN+ L+ VVLNYF + FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 556 VDY---------------------------------NDNNIFETQDMF----FQVPASLR 578
                                               N +NI  + ++      Q+ A   
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 579 FYFR----------------HAPAFAESHILQLVGFGNPKNPFALLFDLPNFL 615
           F FR                ++  FAESHILQL+GFG+PKNPFALLF LP +L
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  264 bits (675), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 202/335 (60%), Gaps = 36/335 (10%)

Query: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990
            FE     N D +  P LS+++ E++FEY GYK+   +  +FD+NGEL+S+S+YT+ +ID 
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIID- 1208

Query: 991  DNSLNNSQGNQYTSNMQMTXXXXXXXXXXXXNFQMRNFASNEDTEDDFNFELY-MNPEKL 1049
              ++N S  N    N                    +N  S+  T +  N EL+ M  E  
Sbjct: 1209 --TINGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIF 1266

Query: 1050 NKNMDQA-----SIWTTA---NDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVC 1101
            NK +D        IW      +  I  + TYFV DATSWLRHFAH+YKL+TN +L FA+C
Sbjct: 1267 NKILDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAIC 1326

Query: 1102 LTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQ 1161
            LTTFQELRFLRKSKDENV+ AA RAIIT+RQLYSE +LLPLRFTGN+AT IEEHLEFEEQ
Sbjct: 1327 LTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQ 1386

Query: 1162 ITWRSHVDEFVIEAVVKAQNKFI----SANESVTLRKGFNHV----------------VL 1201
            ITWRSHVDEFVIEA+ +AQ K        + +VT       +                VL
Sbjct: 1387 ITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVL 1446

Query: 1202 VTDDINMKRKAQEQ----GIKTFTTHFIFSVCRKL 1232
            VTDDI+M +K QE+     I TF+T F+FS+C  L
Sbjct: 1447 VTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  248 bits (633), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 175/252 (69%), Gaps = 6/252 (2%)

Query: 662  EYFDNIDSLRLPIDHPNIL-VWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWT 720
            ++F+N++SL+L    PN L +W +SL+++N+ SL CS+IVL+KFL GPL ++LPH+LPW+
Sbjct: 790  DFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPWS 849

Query: 721  YFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLC 780
            YFII+  L+ +S +N  S  FW   +R+I PWN++ S+LNV+++ +LDN Y+   I KL 
Sbjct: 850  YFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITKLI 909

Query: 781  ETYSNFENFYELLDYFNRNE-NLPEIWKCWGTLWFDVIS-NKRALNADTFNGLGIEDHMF 838
              YSN +N  ELL  FN NE  LPE+WKC+G+LWFDVI+ N +  + D    + ++D   
Sbjct: 910  NNYSN-KNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTKC 968

Query: 839  LDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENLQ--TGLRVSRTAPVHCRRDDID 896
            L++P+DG+ FDE++E G NFW R+ R++FLFK +        GL +S    V+C R DI 
Sbjct: 969  LNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIP 1028

Query: 897  PNHILKSFSFKM 908
             NHIL++F+FK+
Sbjct: 1029 NNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 99/202 (49%), Gaps = 2/202 (0%)

Query: 682 WLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKF 741
           W   +E ++ T L  + ++ +KFL   + I+ P +LPW  F I+   +  +  +   +  
Sbjct: 481 WKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLL 540

Query: 742 WTIVMRRILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNEN 801
           W  +++ +LPW+ + ++LN  +  +  +   ++++  L +   +  + Y+LL Y     N
Sbjct: 541 WKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSC-SLYDLLYYMMYESN 599

Query: 802 LPEIWKCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNR 861
             EI  C G +WFD +++K    + T N   ++   + +   D + +D+ D+     W R
Sbjct: 600 FQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSY-NASEDSLIYDDDDQVYTKMWTR 658

Query: 862 ALRIVFLFKGIAENLQTGLRVS 883
           AL I+ L K +  +    + VS
Sbjct: 659 ALLIILLIKNVINDYPELIDVS 680

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 72/170 (42%), Gaps = 29/170 (17%)

Query: 1072 YFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRK-SKDENVVGAAARAIITM 1130
            YF+ D  +WL+H   + +      +   + ++   +L  L+  S+ E+V  +A+R +I +
Sbjct: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862

Query: 1131 RQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFISANESV 1190
              LY+  ++  L+             EFE  I+    +       ++    KF   N+ +
Sbjct: 863  NYLYAMNQINILK-------------EFESPIS--KALKNIDGSQILNFNGKF--KNDLL 905

Query: 1191 TLRKG-----------FNHVVLVTDDINMKRKAQEQGIKTFTTHFIFSVC 1229
            T   G            ++VV+V+DD       +++G    +T  +FSV 
Sbjct: 906  TKENGPGQQLNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVA 955

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ N DLI YL+H    +L      +DL  +++ Y  DR 
Sbjct: 456 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRI 496

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ N DLI YL+H    +L      +DL  +++ Y  DR 
Sbjct: 457 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRI 497

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ N DLI YL+H    +L      +DL  +++ Y  DR 
Sbjct: 458 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRI 498

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ N DLI YL+H    +L      +DL  +++ Y  DR 
Sbjct: 458 GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRI 498

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ + DLI YL+H    +L      +DL  +++ Y  DR 
Sbjct: 460 GNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLKDRI 500

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDR 553
           GN+ + DLI YL+H    +L      +DL  +++ Y  DR
Sbjct: 413 GNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLKDR 452

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDR 553
           GN+ + DLI YL+H    +L      +DL  +++ Y  DR
Sbjct: 455 GNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLRDR 494

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDR 553
           GN+ + DLI YL+H    +L      +DL  +++ Y  DR
Sbjct: 432 GNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRYLKDR 471

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDR 553
           GN+ + DL+ YL+H    +L      +DL  +++ Y  DR
Sbjct: 408 GNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYLKDR 447

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 514 GNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRF 554
           GN+ + DL+ YL+H    +L      +DL  +++ Y  DR 
Sbjct: 397 GNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYLKDRI 437

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,864,162
Number of extensions: 6141653
Number of successful extensions: 27034
Number of sequences better than 10.0: 86
Number of HSP's gapped: 27538
Number of HSP's successfully gapped: 120
Length of query: 1241
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1120
Effective length of database: 39,606,813
Effective search space: 44359630560
Effective search space used: 44359630560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)