Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H00170singletonON56556529020.0
TBLA0A053601.73ON60654818930.0
CAGL0J08294g1.73ON59753918480.0
NCAS0A005501.73ON60556318410.0
KNAG0F004301.73ON63455318400.0
Smik_14.621.73ON57654318090.0
TPHA0B045701.73ON57152818040.0
SAKL0C02376g1.73ON55552218020.0
NDAI0F042601.73ON63355918030.0
KAFR0D039901.73ON58555617930.0
TDEL0C062901.73ON56951017850.0
Suva_14.671.73ON57553517850.0
Skud_14.651.73ON57654417710.0
ZYRO0F16918g1.73ON59353217610.0
KLLA0C02123g1.73ON55952817510.0
YNL275W (BOR1)1.73ON57652617370.0
KLTH0F02156g1.73ON55853617290.0
Ecym_10781.73ON55353415930.0
Kwal_33.13346singletonOFF45746015460.0
AFR677C1.73ON54651915430.0
Kwal_33.133441.73ON92401483e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00170
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00170 Chr8 (18821..20518) [1698 bp, 565 aa] {ON} Anc_1.73 ...  1122   0.0  
TBLA0A05360 Chr1 (1313503..1315323) [1821 bp, 606 aa] {ON} Anc_1...   733   0.0  
CAGL0J08294g Chr10 complement(823820..825613) [1794 bp, 597 aa] ...   716   0.0  
NCAS0A00550 Chr1 (92249..94066) [1818 bp, 605 aa] {ON} Anc_1.73 ...   713   0.0  
KNAG0F00430 Chr6 (55719..57623) [1905 bp, 634 aa] {ON} Anc_1.73 ...   713   0.0  
Smik_14.62 Chr14 (98199..99929) [1731 bp, 576 aa] {ON} YNL275W (...   701   0.0  
TPHA0B04570 Chr2 complement(1077406..1079121) [1716 bp, 571 aa] ...   699   0.0  
SAKL0C02376g Chr3 (214343..216010) [1668 bp, 555 aa] {ON} simila...   698   0.0  
NDAI0F04260 Chr6 complement(1039927..1041828) [1902 bp, 633 aa] ...   699   0.0  
KAFR0D03990 Chr4 complement(785167..786924) [1758 bp, 585 aa] {O...   695   0.0  
TDEL0C06290 Chr3 complement(1147901..1149610) [1710 bp, 569 aa] ...   692   0.0  
Suva_14.67 Chr14 (113780..115507) [1728 bp, 575 aa] {ON} YNL275W...   692   0.0  
Skud_14.65 Chr14 (107762..109492) [1731 bp, 576 aa] {ON} YNL275W...   686   0.0  
ZYRO0F16918g Chr6 complement(1405769..1407550) [1782 bp, 593 aa]...   682   0.0  
KLLA0C02123g Chr3 (173935..175614) [1680 bp, 559 aa] {ON} simila...   679   0.0  
YNL275W Chr14 (119268..120998) [1731 bp, 576 aa] {ON}  BOR1Boron...   673   0.0  
KLTH0F02156g Chr6 (173860..175536) [1677 bp, 558 aa] {ON} simila...   670   0.0  
Ecym_1078 Chr1 (149412..151073) [1662 bp, 553 aa] {ON} similar t...   618   0.0  
Kwal_33.13346 s33 (179660..181033) [1374 bp, 457 aa] {OFF} YNL27...   600   0.0  
AFR677C Chr6 complement(1685714..1687354) [1641 bp, 546 aa] {ON}...   598   0.0  
Kwal_33.13344 s33 (179389..179667) [279 bp, 92 aa] {ON} YNL275W ...    62   3e-11

>KAFR0H00170 Chr8 (18821..20518) [1698 bp, 565 aa] {ON} Anc_1.73
           YNL275W
          Length = 565

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/565 (97%), Positives = 553/565 (97%)

Query: 1   MKKSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIA 60
           MKKSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIA
Sbjct: 1   MKKSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIA 60

Query: 61  TYFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIF 120
           TYFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIF
Sbjct: 61  TYFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIF 120

Query: 121 NYTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXX 180
           NYTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLF    
Sbjct: 121 NYTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFINII 180

Query: 181 XXXXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFIS 240
                   LTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFIS
Sbjct: 181 YIQKGIQILTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFIS 240

Query: 241 DYSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNV 300
           DYSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNV
Sbjct: 241 DYSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNV 300

Query: 301 FLALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAP 360
           FLALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAP
Sbjct: 301 FLALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAP 360

Query: 361 NGLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVL 420
           NGLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVL
Sbjct: 361 NGLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVL 420

Query: 421 SGLFFIMGFEGLMGNAIISRIVWIFTDSNTKADSKLSYLSYKKIALFVSFSMIGFTAEFA 480
           SGLFFIMGFEGLMGNAIISRIVWIFTDSNTKADSKLSYLSYKKIALFVSFSMIGFTAEFA
Sbjct: 421 SGLFFIMGFEGLMGNAIISRIVWIFTDSNTKADSKLSYLSYKKIALFVSFSMIGFTAEFA 480

Query: 481 ITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEI 540
           ITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEI
Sbjct: 481 ITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEI 540

Query: 541 DNDEDILAATDTAHDNIVRTTAYEQ 565
           DNDEDILAATDTAHDNIVRTTAYEQ
Sbjct: 541 DNDEDILAATDTAHDNIVRTTAYEQ 565

>TBLA0A05360 Chr1 (1313503..1315323) [1821 bp, 606 aa] {ON} Anc_1.73
           YNL275W
          Length = 606

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/548 (65%), Positives = 434/548 (79%), Gaps = 7/548 (1%)

Query: 23  RIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDMFDRTDN 82
           +IP IG GI+LD++DRLP YW+DW DS+DYRVIPS+I TYF NLLPAIAFAQDMFDRTDN
Sbjct: 50  QIPVIGKGIWLDIQDRLPYYWSDWTDSVDYRVIPSVIETYFNNLLPAIAFAQDMFDRTDN 109

Query: 83  SYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYFGFMFWI 142
           SYGVNE+LLSSA+AGI+FGILSGQPLCIVGVTGPI+IFNYTVYEIIKPL  NYFGFMFWI
Sbjct: 110 SYGVNEVLLSSALAGIVFGILSGQPLCIVGVTGPISIFNYTVYEIIKPLNTNYFGFMFWI 169

Query: 143 SIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQF----NDDTS 198
            IW+M+LHLI+A  N V   QYVTTFPCDIFGLF            L  QF    N++ +
Sbjct: 170 YIWSMILHLILAFGNSVMLFQYVTTFPCDIFGLFINVIYIQKGIQILLRQFHLKINENET 229

Query: 199 SNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIHFG 258
              +++GFA++TVAL+M +FG +FK   + P+LT ++R  ISDYSTALSVLFWSAFI+FG
Sbjct: 230 ITDVSAGFASITVALIMTVFGASFKMFTRTPLLTHKLRTLISDYSTALSVLFWSAFINFG 289

Query: 259 GDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYFDH 318
           G + ++HF KLPITK+F PT+    RDRSTWLAYE+I   +VFLALPFGII+TILFYFDH
Sbjct: 290 GFLKDIHFQKLPITKAFYPTSGT-FRDRSTWLAYEAISTRDVFLALPFGIIVTILFYFDH 348

Query: 319 NVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLVYG 378
           NVSSLMAQ+ +YKL KPS FH+DF LLGITTGI+GVLG+PAPNGLIPQAPLHT+SLLVY 
Sbjct: 349 NVSSLMAQSYQYKLKKPSTFHYDFALLGITTGIAGVLGIPAPNGLIPQAPLHTQSLLVYN 408

Query: 379 SSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNAII 438
           S G+VI+CVEQRFTNTVQG+++LATMARPFLICLGQIPQAVLSGLFF+MG +GL+GN II
Sbjct: 409 SKGDVIRCVEQRFTNTVQGLMILATMARPFLICLGQIPQAVLSGLFFMMGIQGLLGNTII 468

Query: 439 SRIVWIFTDSNTKAD-SKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVLLLT 497
            +I+W+F+D + K   S L  ++ K I +F+ FS+ GFT EFAITNT  AIGFP++LLL+
Sbjct: 469 QKIIWVFSDPDRKDQTSPLINVTTKSIIIFLIFSLAGFTGEFAITNTIAAIGFPLILLLS 528

Query: 498 VIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEIDNDEDILAATDTAHDNI 557
           VI +F+ P    + +LD L  +VA++FTIKNLLL  L  N E  N+EDI   T   + N 
Sbjct: 529 VIASFIMPYFIPKHDLDILQENVAERFTIKNLLLTNLCPNHE-SNEEDIEITTYETYPNH 587

Query: 558 VRTTAYEQ 565
                Y  
Sbjct: 588 SENRCYNN 595

>CAGL0J08294g Chr10 complement(823820..825613) [1794 bp, 597 aa]
           {ON} similar to uniprot|P53838 Saccharomyces cerevisiae
           YNL275w
          Length = 597

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/539 (64%), Positives = 419/539 (77%), Gaps = 4/539 (0%)

Query: 17  SVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDM 76
           S   K R P+ G GI+LDL+DRLP YW DW DS DYRVIPS++ TYF NLLPAIAFAQDM
Sbjct: 58  SHKSKRRFPKPGIGIWLDLKDRLPWYWQDWTDSWDYRVIPSVVETYFNNLLPAIAFAQDM 117

Query: 77  FDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYF 136
           FDRTDN+YGVNE+LL+SAM GI+FG LSGQPLCIVGVTGPI+IFNYTVY+IIKPL  NYF
Sbjct: 118 FDRTDNAYGVNEVLLASAMGGIVFGALSGQPLCIVGVTGPISIFNYTVYDIIKPLNTNYF 177

Query: 137 GFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFNDD 196
           GFMFW+ IW+M+  LI+A  N V  LQYVTTFPCDIFGLF            LT+QF D 
Sbjct: 178 GFMFWVYIWSMIFDLILAFGNAVCLLQYVTTFPCDIFGLFINIVYLQKGVQILTHQFKDK 237

Query: 197 TSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIH 256
             ++  A+GFANV VA+ M +FG  FK  +  P+LT ++R  ISDYS ALSVLFWS+FIH
Sbjct: 238 NGNDDPAAGFANVIVAMAMTVFGTFFKLIKMTPLLTPKLRTIISDYSNALSVLFWSSFIH 297

Query: 257 FGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYF 316
           FGG ++NV F KLPITK++ PT+    RDRSTWLAYESI V +VF+ALPFGIILT+LFYF
Sbjct: 298 FGGYLNNVDFQKLPITKAYHPTSGT-YRDRSTWLAYESIPVRDVFIALPFGIILTLLFYF 356

Query: 317 DHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLV 376
           DH+VSSLMAQ  +YKL KPS+FH+DF LLG+TTG+SGVLG+PAPNGLIPQAPLHTE+LLV
Sbjct: 357 DHSVSSLMAQKEEYKLKKPSSFHYDFALLGLTTGVSGVLGIPAPNGLIPQAPLHTETLLV 416

Query: 377 YGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNA 436
           +     VI+CVEQRFTNT QG LML TM+R  L+CLGQIPQAVLSGLF  MG +GL GN 
Sbjct: 417 HDKDEKVIRCVEQRFTNTAQGGLMLVTMSRGLLVCLGQIPQAVLSGLFITMGIQGLTGNQ 476

Query: 437 IISRIVWIFTDSNTKADSK-LSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVLL 495
           II R++W+FT+   K  SK L  +  KK+ LF++FS+IGF  EFAIT+T  AIGFPI+LL
Sbjct: 477 IIHRLIWLFTEERKKDKSKLLQNVPKKKLILFLTFSLIGFAGEFAITDTIAAIGFPIILL 536

Query: 496 LTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEIDNDEDILAATDTAH 554
           LTV+   +FP +FT+EELD L+ +VAQ+FTIKNLL++ + N     N +++   TD  H
Sbjct: 537 LTVVACLLFPYMFTKEELDILDSNVAQEFTIKNLLMKNIRNANFFSNKDEV--ETDVEH 593

>NCAS0A00550 Chr1 (92249..94066) [1818 bp, 605 aa] {ON} Anc_1.73
           YNL275W
          Length = 605

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/563 (63%), Positives = 426/563 (75%), Gaps = 14/563 (2%)

Query: 2   KKSYVTEEHITVENVSV--------SKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYR 53
           +K    E+ +T  N SV          K RIP+ G GI+LDL+DRLPIY  DW+DSLDYR
Sbjct: 11  QKYNTREDLLTEPNSSVYYQEFEKKRPKRRIPKPGIGIWLDLKDRLPIYIDDWRDSLDYR 70

Query: 54  VIPSLIATYFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGV 113
           VIP+++ TYF NLLPAIAFAQDMFDRTDNSYGVNEILL+SAMAGI+FG+L GQPLCIVGV
Sbjct: 71  VIPAVLETYFNNLLPAIAFAQDMFDRTDNSYGVNEILLASAMAGIVFGVLGGQPLCIVGV 130

Query: 114 TGPITIFNYTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIF 173
           TGPI+IFNYTVYEIIKPL  NYFGFMFWI IW+M+ H ++A  N V  LQYVTTFPCDIF
Sbjct: 131 TGPISIFNYTVYEIIKPLNTNYFGFMFWICIWSMIFHFLLAFGNAVCLLQYVTTFPCDIF 190

Query: 174 GLFXXXXXXXXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTE 233
           GLF            L  QFN     + +A+GFA+V VA+LM +FG TFKQ  K P    
Sbjct: 191 GLFINIVYLEKGVQILVKQFNYHGHQD-VAAGFADVVVAVLMTVFGTTFKQFNKTPFFNH 249

Query: 234 RIRCFISDYSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYE 293
            IR FISDY+TALSVLFWS F HFGG ++N+HF KLPITKS+ PT++   RDRSTWLAY 
Sbjct: 250 TIRTFISDYATALSVLFWSGFTHFGGYLNNIHFEKLPITKSYFPTSDT-FRDRSTWLAYA 308

Query: 294 SIMVGNVFLALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISG 353
            I   ++F+ALPFGII+TILFYFDHNVSSLMAQ  +YKL KPS+FH+DF LLG+TTGI+G
Sbjct: 309 KIPTKHIFIALPFGIIMTILFYFDHNVSSLMAQKYQYKLKKPSSFHYDFALLGVTTGIAG 368

Query: 354 VLGLPAPNGLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLG 413
           VLG+PAPNGLIPQAPLHTESLLV   +  V++CVEQRFTNTVQG++ML TM RP L+CLG
Sbjct: 369 VLGIPAPNGLIPQAPLHTESLLVLDENQEVVRCVEQRFTNTVQGLMMLGTMTRPLLVCLG 428

Query: 414 QIPQAVLSGLFFIMGFEGLMGNAIISRIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSM 472
           +IPQA+LSGLFF MG  GL+ N II RI+W+F D   K  ++ L+ +S K +  F+ FS+
Sbjct: 429 EIPQAILSGLFFTMGINGLIDNVIIHRIMWLFMDKKRKDPENPLNGISKKSLFFFLCFSL 488

Query: 473 IGFTAEFAITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLE 532
            GF AEFAITNT  AIGFP+VLLL+VI  F+FP IFT EELD L+ +VA++FTIKNLLL+
Sbjct: 489 AGFVAEFAITNTVAAIGFPLVLLLSVIVCFLFPKIFTREELDILDENVAKEFTIKNLLLK 548

Query: 533 TLSNNKEIDNDEDILAATDTAHD 555
            + +    DN+      +D   D
Sbjct: 549 NICDP---DNNNLTPQVSDELSD 568

>KNAG0F00430 Chr6 (55719..57623) [1905 bp, 634 aa] {ON} Anc_1.73
           YNL275W
          Length = 634

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/553 (63%), Positives = 422/553 (76%), Gaps = 16/553 (2%)

Query: 23  RIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDMFDRTDN 82
           R P +G GIYLDL+DRLP Y +DW DS DYRVIPSL+ TYF NLLPAIAFAQDMFDRTDN
Sbjct: 47  RFPVLGKGIYLDLKDRLPYYISDWTDSWDYRVIPSLVETYFNNLLPAIAFAQDMFDRTDN 106

Query: 83  SYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYFGFMFWI 142
           SYGVNEILLSSAM G++FG LSGQPLCIVGVTGPI IF+YTVYEIIKPL  NYFGFMFWI
Sbjct: 107 SYGVNEILLSSAMGGVVFGALSGQPLCIVGVTGPIAIFHYTVYEIIKPLNTNYFGFMFWI 166

Query: 143 SIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFNDDTSSNP- 201
            +WAM+ HL++A  N VA LQ+VTTFPCDIFG+F            L  QF++ +S  P 
Sbjct: 167 DMWAMIFHLLMAFTNSVALLQFVTTFPCDIFGMFINVVYIEKGIQILGRQFHNSSSDIPD 226

Query: 202 ----LASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIHF 257
               ++SGFA+V VALLM IFG TFKQ  +FP+ T RIR  I+DYS ALSV+FWS FIHF
Sbjct: 227 TQENISSGFASVVVALLMMIFGITFKQFHRFPLFTHRIRTLIADYSIALSVVFWSGFIHF 286

Query: 258 GGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYFD 317
           GG +++V F KLPI+K++ P+   G RD +TWLAY  I   +VF+ALPFG+ILTILFYFD
Sbjct: 287 GGYLNDVKFEKLPISKAYFPSTEIG-RDATTWLAYTKISTRDVFIALPFGLILTILFYFD 345

Query: 318 HNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLVY 377
           HNVSSLMAQ ++YKL KPS+FH+DF LLG+TT ++GVLG+P PNGLIPQAPLHTESLLV 
Sbjct: 346 HNVSSLMAQRSQYKLKKPSSFHYDFALLGLTTCVAGVLGIPPPNGLIPQAPLHTESLLVL 405

Query: 378 GSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNAI 437
            S+  V++CVEQRFTNTVQG++ML TM RP L+CL QIPQAVLSGLFF+MG +GLM N I
Sbjct: 406 DSNMEVVRCVEQRFTNTVQGLMMLGTMTRPLLVCLSQIPQAVLSGLFFVMGIQGLMDNVI 465

Query: 438 ISRIVWIFTDSNTK----ADSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIV 493
           +SRI++IFTDS  K      + L  +S K + LFV+F  +G  AE  ITNT  AIGFP++
Sbjct: 466 VSRIIYIFTDSKIKDTEIPQNALQRMSKKSLFLFVTFGTLGAAAEVGITNTIAAIGFPLI 525

Query: 494 LLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEI--DNDEDILAATD 551
           LLLTVI  F FP IFTEEEL+ L+P VAQ FTIKNLL+E L    +     DE++  +T 
Sbjct: 526 LLLTVIVCFWFPKIFTEEELEILDPPVAQTFTIKNLLIENLCGKSDACYQEDEEVQLSTF 585

Query: 552 TAHDNIVRTTAYE 564
            +    VRT+ ++
Sbjct: 586 VS----VRTSTFD 594

>Smik_14.62 Chr14 (98199..99929) [1731 bp, 576 aa] {ON} YNL275W
           (REAL)
          Length = 576

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/543 (62%), Positives = 421/543 (77%), Gaps = 2/543 (0%)

Query: 3   KSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATY 62
           +S V +     E+     + R+P++G GI+LDL+DR+P Y +DW D+ +YRVIPS + TY
Sbjct: 34  ESSVVDSRNDEESHEKLSRRRLPKLGMGIWLDLKDRIPYYKSDWVDAFNYRVIPSTVDTY 93

Query: 63  FENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNY 122
           F NLLPAIAFAQDMFDRTDNSYGVNE+LLSSAMAGI+FG+L+GQPLCIVGVTGPI+IFNY
Sbjct: 94  FNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLAGQPLCIVGVTGPISIFNY 153

Query: 123 TVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXX 182
           TVYEIIKPL  +YFGFMFWI +W+M+ HL++A  NVV  LQYVTTFPCDIFGLF      
Sbjct: 154 TVYEIIKPLNTSYFGFMFWICLWSMIFHLLLAFTNVVCLLQYVTTFPCDIFGLFINVVYI 213

Query: 183 XXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDY 242
                 LT QF++ +    +  GFA+V VAL+M  FG  FK    +P+ T +IR FISDY
Sbjct: 214 QKGIQILTRQFHNTSGEKSVQDGFASVVVALVMTAFGLFFKSFHHYPLFTHKIRTFISDY 273

Query: 243 STALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFL 302
           STALSVLFWS+F HFGG +++V F KLPITKSF PT+   +R ++TWLAYE I V +VF+
Sbjct: 274 STALSVLFWSSFTHFGGYLNDVKFKKLPITKSFFPTS-KFNRPQNTWLAYEPIPVKDVFI 332

Query: 303 ALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNG 362
           ALPFGIILTILFYFDHNVSSLMAQ  +YKL KPS+FH+DF LLG+TT ISGVLG+PAPNG
Sbjct: 333 ALPFGIILTILFYFDHNVSSLMAQRHQYKLRKPSSFHYDFALLGLTTCISGVLGIPAPNG 392

Query: 363 LIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSG 422
           LIPQAPLHTE+LLV  S+ NV++CVEQR TNT QG+++L TM RP L+CLG+IPQAVLSG
Sbjct: 393 LIPQAPLHTETLLVRDSNQNVVRCVEQRLTNTFQGLMILGTMTRPLLVCLGEIPQAVLSG 452

Query: 423 LFFIMGFEGLMGNAIISRIVWIFTDSNTKA-DSKLSYLSYKKIALFVSFSMIGFTAEFAI 481
           LFFIMG  GLM N II RIV++F+D   +  +S L+ +S + + +F+ FS+ GFT EFAI
Sbjct: 453 LFFIMGINGLMTNVIIHRIVFLFSDPKRRDNNSPLAKISKRSMVIFLCFSLAGFTGEFAI 512

Query: 482 TNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEID 541
           TNT  AIGFP+VLLL+VI +F F  IF  EEL  L+ +VAQ+FT+KNLLLE + + K  D
Sbjct: 513 TNTIAAIGFPLVLLLSVIVSFSFTYIFPSEELKVLDNNVAQRFTLKNLLLENIRDAKFSD 572

Query: 542 NDE 544
             +
Sbjct: 573 RHK 575

>TPHA0B04570 Chr2 complement(1077406..1079121) [1716 bp, 571 aa]
           {ON} Anc_1.73 YNL275W
          Length = 571

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/528 (65%), Positives = 413/528 (78%), Gaps = 6/528 (1%)

Query: 8   EEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLL 67
           +E I V+     +K R P +G GI +D+ DRLP YW DWKD  DYRVIPS + TYF NLL
Sbjct: 32  DESIEVKR----RKRRFPTLGKGIMMDIYDRLPYYWDDWKDGWDYRVIPSTLETYFNNLL 87

Query: 68  PAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEI 127
           PAIAFAQDMFDRTDNSYGVNE+LLSSAMAGI+FGILSGQPLCIVGVTGPI+IFNYTVYEI
Sbjct: 88  PAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGILSGQPLCIVGVTGPISIFNYTVYEI 147

Query: 128 IKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXX 187
           IK   IN+FGFMFWI IW+M+LH I AI N+V+ LQYVTTFPCDIFGLF           
Sbjct: 148 IKSQDINFFGFMFWICIWSMILHFISAITNLVSLLQYVTTFPCDIFGLFINVVYIQKGIQ 207

Query: 188 XLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALS 247
            LT QF +   +  +++GF+++TVAL M IFG  FK   K  +LT  +R  ISDYST LS
Sbjct: 208 ILTRQFTNKHGTPDISAGFSSITVALCMTIFGTGFKSFTKTKLLTPTLRTVISDYSTFLS 267

Query: 248 VLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFG 307
           VLFWS FIHFGG ++++ F  LPITKSF PT++ G RDRSTWLAYE I V +VFLALPFG
Sbjct: 268 VLFWSGFIHFGGALNDIDFQSLPITKSFRPTSDIG-RDRSTWLAYEWIPVKDVFLALPFG 326

Query: 308 IILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQA 367
           IILT+LFYFDHNVSSLMAQ ++YK  KPSAFH+DFFLLGITTGISGVLG+PAPNGLIPQA
Sbjct: 327 IILTLLFYFDHNVSSLMAQRSEYKQVKPSAFHYDFFLLGITTGISGVLGIPAPNGLIPQA 386

Query: 368 PLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIM 427
           PLH+ESLLV   +  V++CVEQR TNTVQG+++LATMARPFL+CLGQIPQAVLSGLFF+M
Sbjct: 387 PLHSESLLVMDKNMEVVRCVEQRVTNTVQGLMILATMARPFLVCLGQIPQAVLSGLFFMM 446

Query: 428 GFEGLMGNAIISRIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKG 486
           G +GL+ NAII +I W+FT+   K  +S +  +S K I +++ F++ GFT EFAITNT  
Sbjct: 447 GIQGLLSNAIIDKISWLFTEERLKDHNSPMINVSKKSIIIYLCFALAGFTGEFAITNTIA 506

Query: 487 AIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           AIGFP+VLL TV   F+FP +  EE+L  L+ +VA+ F IKNL LE +
Sbjct: 507 AIGFPLVLLATVAGCFIFPKVIPEEDLATLDGAVAEDFIIKNLKLENM 554

>SAKL0C02376g Chr3 (214343..216010) [1668 bp, 555 aa] {ON} similar
           to uniprot|P53838 Saccharomyces cerevisiae YNL275W
          Length = 555

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/522 (63%), Positives = 411/522 (78%), Gaps = 3/522 (0%)

Query: 14  ENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFA 73
           ++ S  ++ R+P++  G+  DLRD+LP Y +DW DS DYRV+P++I TYF NLLPAIAFA
Sbjct: 32  DHHSEPRRRRLPKLFAGVVADLRDKLPEYPSDWIDSWDYRVVPAVIETYFNNLLPAIAFA 91

Query: 74  QDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKI 133
           QDMFDRT+N+YGVNE+LLSSAMAGI+FG++ GQPLCIVGVTGPI+IFNYTVY++IKPL  
Sbjct: 92  QDMFDRTNNAYGVNEVLLSSAMAGIVFGVIGGQPLCIVGVTGPISIFNYTVYDVIKPLNT 151

Query: 134 NYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQF 193
           NYFGFMFW+ +W+M+ H ++A  N+V  LQYVTTFPCDIFGLF            LT QF
Sbjct: 152 NYFGFMFWVCMWSMIFHFVLAASNLVCLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQF 211

Query: 194 NDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSA 253
           +D T     A+G+A++ VAL+M IFG   K   + P+LT R+R  +SDYSTALSV+FWSA
Sbjct: 212 HDKTGQEDTAAGYASIVVALVMTIFGLAGKLFCRTPLLTHRLRTLVSDYSTALSVVFWSA 271

Query: 254 FIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTIL 313
           F HFGG + +V F KLPITKSF PT+    RDR+TWLAYE+I VG+VFLALPFGI+LTIL
Sbjct: 272 FTHFGGYMDDVDFQKLPITKSFRPTSE--LRDRNTWLAYEAIPVGHVFLALPFGILLTIL 329

Query: 314 FYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTES 373
           FYFDHNVSSLMAQ  +YKL K S FH+DF LLG+ TGISGVLG+PAPNGLIPQAPLHTES
Sbjct: 330 FYFDHNVSSLMAQRYQYKLKKASTFHYDFALLGVVTGISGVLGIPAPNGLIPQAPLHTES 389

Query: 374 LLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLM 433
           LLV  S G VI+CVEQRFTNTVQG+++L TM+RP LICLGQIPQAVLSGLFFIMG +GL+
Sbjct: 390 LLVRDSGGEVIRCVEQRFTNTVQGLMVLGTMSRPLLICLGQIPQAVLSGLFFIMGLQGLL 449

Query: 434 GNAIISRIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPI 492
            N I++R+V++F+    K  D  LS +  K +  F + S++GF  EF+ITNTKGAIGFP+
Sbjct: 450 SNVIVARLVYLFSAEQQKNQDRLLSRVPNKVLISFTALSLLGFAGEFSITNTKGAIGFPL 509

Query: 493 VLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           VLLLTVIFT  FP ++  + LD L+  VA+ FT+KNLL+E L
Sbjct: 510 VLLLTVIFTLAFPRLYNPQHLDILDEQVAEDFTLKNLLVEHL 551

>NDAI0F04260 Chr6 complement(1039927..1041828) [1902 bp, 633 aa]
           {ON} Anc_1.73 YNL275W
          Length = 633

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/559 (62%), Positives = 427/559 (76%), Gaps = 19/559 (3%)

Query: 4   SYVTEEHITVENVSVSKKV------RIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPS 57
           S +T +  ++   S   K+      RIP+ G GI+LDL+DRLP Y  DWKDS+DYRVIP+
Sbjct: 34  STITPDQTSITTTSEEPKMSNRKFRRIPKPGIGIWLDLKDRLPFYIQDWKDSVDYRVIPA 93

Query: 58  LIATYFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPI 117
           ++ TYF N+LPAIAFAQDMFDRTDNSYGVNE+LLSSAMAGI+FG+LSGQPLCIVGVTGPI
Sbjct: 94  VLETYFNNVLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLSGQPLCIVGVTGPI 153

Query: 118 TIFNYTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFX 177
           +IFNYTVYEIIKPL  NYFGFMFWI IW+M+ H I+AI N V  LQYVTTFPCDIFGLF 
Sbjct: 154 SIFNYTVYEIIKPLNTNYFGFMFWICIWSMIFHFILAIGNAVCLLQYVTTFPCDIFGLFI 213

Query: 178 XXXXXXXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRC 237
                      L  QFN       +ASGFA++ +A+ M + G TFKQ  + P     IR 
Sbjct: 214 NIVYLQKGVQILVKQFN--IHGEDVASGFASIVLAITMTVCGLTFKQFIRTPFFNHTIRV 271

Query: 238 FISDYSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMV 297
            ISDY+TALSVLFWSAF HFGG + NV+F KLPITKS+ PT++   RDRSTWLAY  I  
Sbjct: 272 IISDYATALSVLFWSAFPHFGGYLDNVNFEKLPITKSYFPTSDR-FRDRSTWLAYAKIST 330

Query: 298 GNVFLALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGL 357
            ++F+ALPFGII+TILFYFDHNVSSLMAQ  +YKL KPS+FH+DFFLLGITTG+SGVLG+
Sbjct: 331 KDIFIALPFGIIMTILFYFDHNVSSLMAQKYQYKLKKPSSFHYDFFLLGITTGVSGVLGI 390

Query: 358 PAPNGLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQ 417
           PAPNGLIPQAPLHTESLLV   + NV++CV+QRFTNTVQG++ML TM RPFL+CLGQIPQ
Sbjct: 391 PAPNGLIPQAPLHTESLLVLDENQNVVRCVDQRFTNTVQGLMMLGTMTRPFLVCLGQIPQ 450

Query: 418 AVLSGLFFIMGFEGLMGNAIISRIVWIFTDSNTKA-DSKLSYLSYKKIALFVSFSMIGFT 476
           AVLSGLF+ MG  GL+ N II RI+W+FTD   K   + L+ +S K + +F+ FS+ GF 
Sbjct: 451 AVLSGLFWTMGINGLIDNVIIYRIIWLFTDKKKKDLTNPLNKVSRKSLIIFLIFSLCGFV 510

Query: 477 AEFAITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSN 536
           AEF+ITNT  AIGFP+VLLL+V+  F+FP +  ++ELD L+ SVA++FTIKNLLL+ + +
Sbjct: 511 AEFSITNTVAAIGFPLVLLLSVLVCFLFPKLIPKDELDILDESVAKEFTIKNLLLDNICD 570

Query: 537 ---------NKEIDNDEDI 546
                    + EID++E +
Sbjct: 571 PEYTGAFHSDDEIDDEEKL 589

>KAFR0D03990 Chr4 complement(785167..786924) [1758 bp, 585 aa] {ON}
           Anc_1.73 YNL275W
          Length = 585

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/556 (64%), Positives = 421/556 (75%), Gaps = 14/556 (2%)

Query: 12  TVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIA 71
           TV+     K+   P +G GIY+D +DR P YW DW+D+ DYRVIPSL+ TYF NLLPAIA
Sbjct: 11  TVDTGLKQKRRHFPPLGKGIYMDFKDRFPYYWQDWRDAWDYRVIPSLVETYFNNLLPAIA 70

Query: 72  FAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPL 131
           FAQD FDRTDN YGVNEILL+SA+ G++FG+ +GQPLCIVGVTGPITIFNYTVY IIKPL
Sbjct: 71  FAQDAFDRTDNLYGVNEILLASALGGVVFGLFAGQPLCIVGVTGPITIFNYTVYSIIKPL 130

Query: 132 KINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTN 191
             N+FGFMFWI IWAM+ HLI+A  N V+ LQYVTTFPCDIFGLF            L  
Sbjct: 131 NANFFGFMFWICIWAMIFHLILAFTNAVSLLQYVTTFPCDIFGLFISVVYIQKGIQILGR 190

Query: 192 QFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFW 251
           Q+   T    + SGFA+V VAL+MFIFGF FKQA + P+   +IR FISDYSTALSVLFW
Sbjct: 191 QYKYGT----IESGFASVVVALVMFIFGFMFKQATRTPLFNHKIRTFISDYSTALSVLFW 246

Query: 252 SAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILT 311
           SAFIHFGG+++NV F KLPITK+FIPTA    R RSTWLAYE I   NVF+ALPFGII+T
Sbjct: 247 SAFIHFGGELNNVKFEKLPITKAFIPTATR-ERSRSTWLAYEPISTRNVFIALPFGIIVT 305

Query: 312 ILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHT 371
           ILFYFDHNVSSLMAQ  +YKL KPSAFHWD+ LLGITTGI+GVLG+PAPNGLIPQAPLHT
Sbjct: 306 ILFYFDHNVSSLMAQRYQYKLKKPSAFHWDYALLGITTGIAGVLGIPAPNGLIPQAPLHT 365

Query: 372 ESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEG 431
           ++LLV+    NV++CVEQRFTNTVQG+LM+ TM RP L+CLGQIPQAVLSGLFF+MGF+G
Sbjct: 366 KTLLVHDRDMNVVRCVEQRFTNTVQGLLMIGTMTRPLLVCLGQIPQAVLSGLFFLMGFQG 425

Query: 432 LMGNAIISRIVWIFTDSNTKADSKLSYLSYKKIA--LFVSFSMIGFTAEFAITNTKGAIG 489
           ++ + I+ RI W FTD   K D     L  +K A  LF+S  +IG  AE AI+ T  AI 
Sbjct: 426 VLDSVIMQRIFWFFTDP-LKKDPASPLLKVRKRAFILFISLGVIGAAAEIAISATIAAIA 484

Query: 490 FPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEIDNDEDILAA 549
           FPIVLLLTV+  F+FP  FT+EEL+ L+P+VAQ FTIKNLLLE L +  +    EDI   
Sbjct: 485 FPIVLLLTVLVCFLFPRFFTKEELEILDPNVAQSFTIKNLLLENLCSPPK----EDI--E 538

Query: 550 TDTAHDNIVRTTAYEQ 565
            + A+D+   TT  + 
Sbjct: 539 KEGANDDTSYTTGIDD 554

>TDEL0C06290 Chr3 complement(1147901..1149610) [1710 bp, 569 aa]
           {ON} Anc_1.73 YNL275W
          Length = 569

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/510 (63%), Positives = 407/510 (79%), Gaps = 2/510 (0%)

Query: 20  KKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDMFDR 79
           ++ RIP+ G GI+LDL++++P YW DW+DS DYRVIPS++ TYF NLLPA+AFAQDMFD+
Sbjct: 21  RRRRIPKPGAGIWLDLQEKVPCYWQDWRDSWDYRVIPSVLNTYFNNLLPALAFAQDMFDK 80

Query: 80  TDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYFGFM 139
           T N+YGVNE+LLS+ +AG++FG+L+GQPLCIVGVTGPI IFNYTVYE+I PL  NYFGFM
Sbjct: 81  THNAYGVNEVLLSTGLAGVVFGVLAGQPLCIVGVTGPIAIFNYTVYELIGPLNTNYFGFM 140

Query: 140 FWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFNDDTSS 199
           FW+ IW+M+LHLI+A  N VA LQYVT FPCDIFGLF            LT QF+ +   
Sbjct: 141 FWVCIWSMILHLIMAFSNTVALLQYVTAFPCDIFGLFINVVYIEKGIQILTRQFHTNEGE 200

Query: 200 NPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIHFGG 259
             L +GF +VTVAL M +FG  FK   + P+LT R+R FI+DYST LSVLFWSAF HFGG
Sbjct: 201 EDLTAGFGSVTVALCMTLFGLVFKNITRTPLLTHRLRIFIADYSTPLSVLFWSAFTHFGG 260

Query: 260 DISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYFDHN 319
            + +VHF K+PI+KSF PT +  +R+ STWLAY+ I V +VF+ALPFGIILT+LFYFDHN
Sbjct: 261 YLDDVHFQKVPISKSFYPT-DKVNRNASTWLAYQKIPVKDVFIALPFGIILTLLFYFDHN 319

Query: 320 VSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLVYGS 379
           VSSLMAQ  +YKL K ++FH+DF LLGITTG+SGVLG+PAPNGLIPQAPLHTESLLV+  
Sbjct: 320 VSSLMAQRFEYKLKKNASFHYDFALLGITTGVSGVLGIPAPNGLIPQAPLHTESLLVHDE 379

Query: 380 SGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNAIIS 439
           +G V +CVEQRFTNTVQG++ + TM RP L+CLGQIPQAVLSGLFFIMG EGL+ N II+
Sbjct: 380 NGKVARCVEQRFTNTVQGLMAIGTMTRPLLVCLGQIPQAVLSGLFFIMGIEGLLHNEIIA 439

Query: 440 RIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVLLLTV 498
           RI+ +FT++  +   S L+++S KK+ +F+ FS+ GF  EFAITNT  AIGFP+VLLLTV
Sbjct: 440 RILCLFTETKKRDPQSILNHVSRKKLVIFLCFSLAGFVGEFAITNTIAAIGFPLVLLLTV 499

Query: 499 IFTFVFPMIFTEEELDALNPSVAQKFTIKN 528
           I   VFP IFT+EEL+ L+ +  ++FT+KN
Sbjct: 500 IIRMVFPKIFTKEELNVLDHNATEEFTVKN 529

>Suva_14.67 Chr14 (113780..115507) [1728 bp, 575 aa] {ON} YNL275W
           (REAL)
          Length = 575

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/535 (64%), Positives = 415/535 (77%), Gaps = 2/535 (0%)

Query: 3   KSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATY 62
           +S + E     E    + + R  + G GI+LDL+DR+P Y +DW DS DYRVIPS++ TY
Sbjct: 34  ESSIPESRSDEETPEKTSRRRFAKPGIGIWLDLKDRIPFYKSDWVDSFDYRVIPSVVDTY 93

Query: 63  FENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNY 122
           F NLLPAIAFAQDMFDRT+NSYGVNE+LLSSAMAGI+FG+L+GQPLCIVGVTGPI+IFNY
Sbjct: 94  FNNLLPAIAFAQDMFDRTNNSYGVNEVLLSSAMAGIVFGVLAGQPLCIVGVTGPISIFNY 153

Query: 123 TVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXX 182
           TVYEIIKPL  NYFGFMFWI +W+MV HLI+A  N V  LQYVTTFPCDIFGLF      
Sbjct: 154 TVYEIIKPLNTNYFGFMFWICMWSMVFHLILAFSNAVCLLQYVTTFPCDIFGLFINVVYI 213

Query: 183 XXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDY 242
                 LT QF  ++    +  GFA++ VAL+M IFG  FK  + +P+ T +IR FISDY
Sbjct: 214 QKGIQILTRQFYTESGEESVQDGFASIVVALVMTIFGLFFKLFQNYPLFTHQIRTFISDY 273

Query: 243 STALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFL 302
           STALSVLFWS+F HFGG + +V F KLPITKSF PT+   +R + TWLAYE I V +VF+
Sbjct: 274 STALSVLFWSSFTHFGGYLQDVQFKKLPITKSFFPTSKI-NRPQGTWLAYEQIPVKDVFI 332

Query: 303 ALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNG 362
           ALPFGIILTILFYFDHNVSSLMAQ  +Y+L KPS+FH+DF LLGITT ISGVLG+PAPNG
Sbjct: 333 ALPFGIILTILFYFDHNVSSLMAQRHQYRLKKPSSFHYDFALLGITTCISGVLGIPAPNG 392

Query: 363 LIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSG 422
           LIPQAPLHTE+LLV+ S+  V++CVEQRFTNT+QG+++L TM RP L+CLG+IPQAVLSG
Sbjct: 393 LIPQAPLHTETLLVHDSNQEVVRCVEQRFTNTIQGLMILGTMTRPLLVCLGKIPQAVLSG 452

Query: 423 LFFIMGFEGLMGNAIISRIVWIFTDSNTKA-DSKLSYLSYKKIALFVSFSMIGFTAEFAI 481
           LFFIMG  GLM N II R+V++F+D   +  DS L  +S + IA+F+ FS+IGF  EFAI
Sbjct: 453 LFFIMGINGLMTNVIIRRLVFLFSDPKRRDNDSPLVNVSKRSIAIFLCFSLIGFAGEFAI 512

Query: 482 TNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSN 536
           TNT  AIGFP+VLLL+V+  F F  IF  EEL  L+ +VAQKFTIKNLLLE + +
Sbjct: 513 TNTIAAIGFPLVLLLSVLVCFSFTHIFPSEELKILDTNVAQKFTIKNLLLENIRD 567

>Skud_14.65 Chr14 (107762..109492) [1731 bp, 576 aa] {ON} YNL275W
           (REAL)
          Length = 576

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/544 (63%), Positives = 420/544 (77%), Gaps = 4/544 (0%)

Query: 3   KSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATY 62
           +S V+E     E+   S + R+P++G GI+LDL+DRLP Y +DW D+LDYRVIPS++ TY
Sbjct: 34  ESSVSERRNDEESHEKSSRRRLPKLGMGIWLDLKDRLPYYKSDWADALDYRVIPSVVDTY 93

Query: 63  FENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNY 122
           F NLLPAIAFAQDMFDRTDNSYGVNE+LLSSAMAGI+FGIL+GQPLC+VGVTGPI+IFNY
Sbjct: 94  FNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGILAGQPLCVVGVTGPISIFNY 153

Query: 123 TVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXX 182
           TVYEIIKPL  NYFGFMFWI +W+M+ HL++A  N V  LQYVTTFPCDIFGLF      
Sbjct: 154 TVYEIIKPLNTNYFGFMFWICMWSMIFHLLLAFTNAVCLLQYVTTFPCDIFGLFINVVYI 213

Query: 183 XXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDY 242
                 LT QF        + +GF++V VALLM  FG  FK    +P+ T +IR FISDY
Sbjct: 214 QKGIQILTRQFEIKPGEKSVQNGFSSVVVALLMTAFGLFFKLFHHYPLFTHKIRTFISDY 273

Query: 243 STALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFL 302
           STALSVLFWS+F HFGG + +V F KLPITKSF PT+   +R + TWLAYE I    VF+
Sbjct: 274 STALSVLFWSSFTHFGGYLQDVQFKKLPITKSFFPTSKT-NRPQGTWLAYEPIPAKYVFI 332

Query: 303 ALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNG 362
           ALPFGIILTILFYFDHNVSSLMAQ  +YKL KPS+FH+DF LLG+TT ISGVLG+PAPNG
Sbjct: 333 ALPFGIILTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNG 392

Query: 363 LIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSG 422
           LIPQAPLHTE+LLV  S+  V++CVEQRFTNT QG+++L TM RP L+CLG+IPQAVLSG
Sbjct: 393 LIPQAPLHTEALLVRDSNQKVVRCVEQRFTNTFQGLMILGTMTRPLLVCLGEIPQAVLSG 452

Query: 423 LFFIMGFEGLMGNAIISRIVWIFTDSNTKA-DSKLSYLSYKKIALFVSFSMIGFTAEFAI 481
           LFFIMG  GLM N I++R+V++F+D   +  +S L  +S K + +F+ FS+ GF  EFAI
Sbjct: 453 LFFIMGINGLMTNTIVNRLVFLFSDRTRRDNNSTLVRVSRKSMVVFLCFSLAGFAGEFAI 512

Query: 482 TNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL--SNNKE 539
           TNT  AIGFP+VLLL+V+ +F FP IF  EELD L+ +VAQKFTIKNLLLE +  +N + 
Sbjct: 513 TNTIAAIGFPLVLLLSVLVSFSFPYIFPSEELDILDTNVAQKFTIKNLLLENIRDANFRC 572

Query: 540 IDND 543
             ND
Sbjct: 573 THND 576

>ZYRO0F16918g Chr6 complement(1405769..1407550) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P53838 Saccharomyces
           cerevisiae YNL275W
          Length = 593

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/532 (62%), Positives = 406/532 (76%), Gaps = 6/532 (1%)

Query: 8   EEHITVENVSVSK----KVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYF 63
           EE  TV + S  +    + + P  G GI+LDL+DR+P+Y +DW+DS DYRVIP+++ TYF
Sbjct: 38  EEEETVRSKSRPRLRRHRYKFPPPGIGIWLDLKDRIPLYGSDWRDSWDYRVIPAVLDTYF 97

Query: 64  ENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYT 123
            NLLPA+AFAQDMFDRTD++YGVNE+LLSSAMAGI+FG+L GQPLCIVGVTGPI+I NYT
Sbjct: 98  SNLLPALAFAQDMFDRTDHAYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISILNYT 157

Query: 124 VYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXX 183
           +Y+I+K    NYFGFMFW+ IW+M+LH ++   N VA LQYVTTFPCDIFGLF       
Sbjct: 158 IYDIVKDWSSNYFGFMFWVCIWSMILHFVLVFSNAVALLQYVTTFPCDIFGLFINIVYIQ 217

Query: 184 XXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYS 243
                LT QF+       +  GFA+V VA++M IFG  FK     P+L   +R FISDY+
Sbjct: 218 KGIQVLTKQFDSKEHGKDVEGGFASVVVAIVMAIFGIMFKNFSITPLLNHPLRTFISDYA 277

Query: 244 TALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLA 303
           T LSVLFWSAF HFGG +++V+F KLPITKSF PT+    RD+STWLAYESI   +VF+A
Sbjct: 278 TPLSVLFWSAFTHFGGYLNDVNFQKLPITKSFHPTSAT-RRDKSTWLAYESIATKDVFIA 336

Query: 304 LPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGL 363
           LPFGIILT+LFYFDHNVSSLMAQ  +YKL KP+ FH+DF LLGITTG++GVLG+PAPNGL
Sbjct: 337 LPFGIILTVLFYFDHNVSSLMAQRHEYKLKKPATFHYDFLLLGITTGVAGVLGIPAPNGL 396

Query: 364 IPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGL 423
           IPQAPLHTE+LLV+   GN+++CVEQRFTNTVQG++M+ TM RP LICLGQIPQAVLSGL
Sbjct: 397 IPQAPLHTEALLVHDIDGNIVRCVEQRFTNTVQGLMMIGTMTRPLLICLGQIPQAVLSGL 456

Query: 424 FFIMGFEGLMGNAIISRIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSMIGFTAEFAIT 482
           FFIMG  GL GN I+ R++W+FT+   K   S L  +  + +  F+ FS+ GF  EFAIT
Sbjct: 457 FFIMGVNGLTGNVILRRVLWLFTEQRLKDTTSLLQKVKNRWLIFFLCFSLAGFAGEFAIT 516

Query: 483 NTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           NT  AI FPIVLLLTVI  F FP +F  ++L  L+ SVAQ+FT+KNLL +TL
Sbjct: 517 NTIAAILFPIVLLLTVIIRFTFPFLFPNDQLSLLDQSVAQEFTLKNLLWDTL 568

>KLLA0C02123g Chr3 (173935..175614) [1680 bp, 559 aa] {ON} similar
           to uniprot|P53838 Saccharomyces cerevisiae YNL275W
          Length = 559

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/528 (64%), Positives = 414/528 (78%), Gaps = 4/528 (0%)

Query: 8   EEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLL 67
           +  + ++++   +K R P +  G+  D++D++P Y +DWKDS DYRVIPS++ TYF NLL
Sbjct: 34  DSDVEIQSIEKPRK-RFPPLCAGLIHDIKDKVPQYPSDWKDSWDYRVIPSVLETYFNNLL 92

Query: 68  PAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEI 127
           PA+AFAQDMFDRTDNSYGVNE+LLSSA+AG++FGI+ GQPLCIVGVTGPI+IFNYTVYEI
Sbjct: 93  PALAFAQDMFDRTDNSYGVNEVLLSSAIAGLVFGIIGGQPLCIVGVTGPISIFNYTVYEI 152

Query: 128 IKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXX 187
           I PL I+YFGFMFWI IW+M+ H ++ I+N V  LQYVTTFPCDIFGLF           
Sbjct: 153 IMPLNIDYFGFMFWICIWSMITHFLLVIVNSVCLLQYVTTFPCDIFGLFINVVYIQKGIQ 212

Query: 188 XLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALS 247
            LT QF D+ S   LASG++++ VALLM IFG  FK  +  P+LT  +R  ISDYSTALS
Sbjct: 213 ILTRQFVDENSDFNLASGYSSIMVALLMAIFGLAFKFFQLTPLLTYTMRTLISDYSTALS 272

Query: 248 VLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFG 307
           V+FWS FIHFGG + +V F KLPITK+F PT +  S  R TWLAY+ I VG+VFLALPFG
Sbjct: 273 VVFWSGFIHFGGLLDSVSFQKLPITKAFAPTRHGDS--RQTWLAYQDISVGDVFLALPFG 330

Query: 308 IILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQA 367
           I+LTILFYFDHNVSSLMAQ  +YKL K S FH+DF LLGITTGI+GVLG+PAPNGLIPQA
Sbjct: 331 IVLTILFYFDHNVSSLMAQRKEYKLRKASTFHYDFALLGITTGIAGVLGIPAPNGLIPQA 390

Query: 368 PLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIM 427
           PLHT+SLLV    GNVI+C EQRFTNTVQG+++L TM RPFLICLG IPQAVLSGLFFIM
Sbjct: 391 PLHTQSLLVRDDDGNVIRCAEQRFTNTVQGLMILGTMTRPFLICLGLIPQAVLSGLFFIM 450

Query: 428 GFEGLMGNAIISRIVWIFTDSNTKA-DSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKG 486
           G +GL+ N I+ RI ++FTD   K+ DS L+ +S K + LF+S S++GF AEFAITNTKG
Sbjct: 451 GIQGLVSNTIVHRIWFVFTDPKKKSKDSTLNTVSTKSLLLFISLSLVGFVAEFAITNTKG 510

Query: 487 AIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           AIGFPIVLLLTVI +  FP IF +++L  L+  V+++FT+KN+L   L
Sbjct: 511 AIGFPIVLLLTVILSLFFPKIFPDKDLAILDEPVSEEFTLKNILPRNL 558

>YNL275W Chr14 (119268..120998) [1731 bp, 576 aa] {ON}  BOR1Boron
           efflux transporter of the plasma membrane; binds HCO3-,
           I-, Br-, NO3- and Cl-; has similarity to the
           characterized boron efflux transporter A. thaliana BOR1
          Length = 576

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/526 (64%), Positives = 410/526 (77%), Gaps = 2/526 (0%)

Query: 21  KVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDMFDRT 80
           + R P +G GI+LDL+DR+P Y +DW D+ +YRVIPS++ TYF NLLPAIAFAQDMFDRT
Sbjct: 52  RRRFPTLGIGIWLDLKDRIPYYKSDWVDAFNYRVIPSIVDTYFNNLLPAIAFAQDMFDRT 111

Query: 81  DNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYFGFMF 140
           DNSYGVNE+LLSSAMAGI+FG+L GQPLCIVGVTGPI+IFNYTVYEIIKPL  +YFGFMF
Sbjct: 112 DNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMF 171

Query: 141 WISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFNDDTSSN 200
           WI +W+M+ HL++A  N V  LQYVTTFPCDIFGLF            LT QF+  +   
Sbjct: 172 WICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQFSAKSGEK 231

Query: 201 PLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIHFGGD 260
            +  GFA+V VAL+M  FG  FK    +P+ + RIR FISDYSTALSVLFWS+F HFGG 
Sbjct: 232 SVQDGFASVVVALVMTAFGLFFKLFHYYPLFSHRIRTFISDYSTALSVLFWSSFTHFGGY 291

Query: 261 ISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYFDHNV 320
           + +V F KLPITK+F PT+   +R ++TWLAYE I V +VF+ALPFGI LTILFYFDHNV
Sbjct: 292 LHDVKFKKLPITKAFFPTSKV-NRPQNTWLAYEPIPVKDVFIALPFGIFLTILFYFDHNV 350

Query: 321 SSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLVYGSS 380
           SSLMAQ  +YKL KPS+FH+DF LLG+TT ISGVLG+PAPNGLIPQAPLHTE+LLV  S+
Sbjct: 351 SSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLHTETLLVRDSN 410

Query: 381 GNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNAIISR 440
             VI CVEQRFTNT QG+++L TM RP L+CLG+IPQAVLSGLFFIMG  GLM N+II R
Sbjct: 411 QKVISCVEQRFTNTFQGLMILGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQR 470

Query: 441 IVWIFTDSNTKAD-SKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVLLLTVI 499
           +V++F+D N + + S L  +S K + +F+SFS+ GF  EFAITNT  AIGFP+VLLL+V+
Sbjct: 471 LVFLFSDPNRRDNTSPLMKVSKKSMLIFLSFSLTGFAGEFAITNTIAAIGFPLVLLLSVL 530

Query: 500 FTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNNKEIDNDED 545
            +F F  IF  EEL  L+ +VAQKFTIKNLLLE + + K  D  ED
Sbjct: 531 VSFSFAYIFPTEELKILDTNVAQKFTIKNLLLENIRDAKFCDKHED 576

>KLTH0F02156g Chr6 (173860..175536) [1677 bp, 558 aa] {ON} similar
           to uniprot|P53838 Saccharomyces cerevisiae YNL275W
          Length = 558

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/536 (59%), Positives = 407/536 (75%), Gaps = 4/536 (0%)

Query: 3   KSYVTEEHITVENVSVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATY 62
           ++ +++     ++   + + + P+   GI  DLRDRLP+YW+DW DS DYRVIPS+I T+
Sbjct: 23  RAKLSQTEEDTDDTQSNLRTKFPKPFAGIAHDLRDRLPVYWSDWSDSWDYRVIPSVIETF 82

Query: 63  FENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNY 122
           F NLLPAIAFAQDMFDRTD+SYGVNE+LL+S + G++FG+L+GQPLCIVGVTGPITIFNY
Sbjct: 83  FNNLLPAIAFAQDMFDRTDHSYGVNEVLLASTVGGVVFGLLAGQPLCIVGVTGPITIFNY 142

Query: 123 TVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXX 182
           TVYE+IKPL  NYFGFMFW+ IW+M+ H ++AI N V  LQYVTTFPCD+FGLF      
Sbjct: 143 TVYEVIKPLHTNYFGFMFWVCIWSMIFHFLLAIFNAVCLLQYVTTFPCDVFGLFNNVVYM 202

Query: 183 XXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDY 242
                 L  QF  +   + L++GFA+  VALLM +FG + K   K P  + RIR FI+DY
Sbjct: 203 EKGIQILVRQFKKNGKVD-LSAGFASTVVALLMTMFGLSSKLITKTPFFSHRIRTFIADY 261

Query: 243 STALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFL 302
           STALSV+FWS FIHFGG +S++ F KLPITKSFIPT++   RDR+TWLAYE+I   ++F+
Sbjct: 262 STALSVVFWSGFIHFGGFLSDIDFQKLPITKSFIPTSH--LRDRTTWLAYEAISTRDIFI 319

Query: 303 ALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNG 362
           ALPFG++LT LFYFDHNVSSLMAQ  +Y+L K S FH+DF LLG TTG+SG+LG+PAPNG
Sbjct: 320 ALPFGLVLTTLFYFDHNVSSLMAQRYQYRLKKASTFHYDFALLGATTGVSGILGIPAPNG 379

Query: 363 LIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSG 422
           LIPQAPLHTESLLV    G V++CVEQRFTNT QG+L LATM+RP L+CLGQIPQAVLSG
Sbjct: 380 LIPQAPLHTESLLVRDKRGEVVRCVEQRFTNTAQGLLTLATMSRPLLVCLGQIPQAVLSG 439

Query: 423 LFFIMGFEGLMGNAIISRIVWIFTDSNTKADSKLSY-LSYKKIALFVSFSMIGFTAEFAI 481
           LFFIMG   L+ NAI+ RI+ + T+ + +    L Y +   K+ +F+S S+ GF AEFAI
Sbjct: 440 LFFIMGLNNLLHNAILGRIMLLITERDKRDLRNLIYKVPLPKVLIFLSLSLAGFAAEFAI 499

Query: 482 TNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLSNN 537
           +NT  AIGFP++LLLTVI +  FP  F+ E+L  L+  VA++FT+KNL + +L+  
Sbjct: 500 SNTIAAIGFPLILLLTVIVSLFFPKWFSPEDLKILDEGVAEEFTLKNLQVSSLTGT 555

>Ecym_1078 Chr1 (149412..151073) [1662 bp, 553 aa] {ON} similar to
           Ashbya gossypii AFR677C
          Length = 553

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/534 (57%), Positives = 390/534 (73%), Gaps = 5/534 (0%)

Query: 3   KSYVTEEHITVENV-SVSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIAT 61
           KS+  EE +   NV    K  R P + +GI  D++DRLP Y +DW DS DYRVIP L+ T
Sbjct: 22  KSFEDEEQMFTNNVDKTGKNKRFPPLFSGIMQDIKDRLPYYRSDWTDSWDYRVIPVLVET 81

Query: 62  YFENLLPAIAFAQDMFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFN 121
           Y  NLLPAIAFAQDMFD TDN++GVNE+LLSSA+ GI+FGI  GQPLCI+GVT P++IFN
Sbjct: 82  YLNNLLPAIAFAQDMFDHTDNAFGVNEVLLSSAIGGIVFGIFCGQPLCILGVTAPVSIFN 141

Query: 122 YTVYEIIKPLKINYFGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXX 181
           YTVYEIIKP  I+YFGFMFWI IWAM+ HL++AI N+V  LQYV++FPCD+FGLF     
Sbjct: 142 YTVYEIIKPWGIDYFGFMFWICIWAMICHLLLAITNMVCLLQYVSSFPCDVFGLFNNIVY 201

Query: 182 XXXXXXXLTNQFNDDTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISD 241
                  LT QFND+  ++ LASG+A++ VAL+M +FG   K + K  +    +R FISD
Sbjct: 202 IHKGIEILTRQFNDNGKTD-LASGYASIVVALIMTLFGSVCKLSVKTSLFPYSLRTFISD 260

Query: 242 YSTALSVLFWSAFIHFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVF 301
           YST  +VLF S FIHFGG ++++HF KL IT +F PT+    R  + WLAY SI    +F
Sbjct: 261 YSTVAAVLFGSLFIHFGGYVNDIHFQKLHITHNFTPTSK--LRGGAGWLAYHSIPTRYIF 318

Query: 302 LALPFGIILTILFYFDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPN 361
           LALPFGIILTILFYFDHNVSSLMAQ  KYKL KPS FH+DF LL +TTG+SG+LG+PAPN
Sbjct: 319 LALPFGIILTILFYFDHNVSSLMAQRNKYKLKKPSTFHYDFALLSLTTGLSGLLGVPAPN 378

Query: 362 GLIPQAPLHTESLLVYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLS 421
           GLIPQAPLHTE+LLV  ++G +++CVEQRFTNT QG+LM+ATM +P L CLGQIPQA LS
Sbjct: 379 GLIPQAPLHTEALLVRDNNGKIVRCVEQRFTNTGQGLLMIATMTKPLLTCLGQIPQAALS 438

Query: 422 GLFFIMGFEGLMGNAIISRIVWIFTDSNTKADSK-LSYLSYKKIALFVSFSMIGFTAEFA 480
           GLFF+M  +GL+ NAII +++W+ T+ + +  S  LS +  K I +F +  ++G   E+ 
Sbjct: 439 GLFFVMAIQGLVENAIIRKLLWLLTERSKRGLSNPLSNIPPKTILIFTTLGIVGALIEYG 498

Query: 481 ITNTKGAIGFPIVLLLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           +T +K AI FPI L+LTV+ +  FP  F++  +  L+  VA+ FT KNLL E L
Sbjct: 499 LTLSKAAIAFPIALVLTVVLSLSFPKWFSKATVPILDEPVAEPFTRKNLLFENL 552

>Kwal_33.13346 s33 (179660..181033) [1374 bp, 457 aa] {OFF} YNL275W
           - Hypothetical ORF [contig 118] FULL
          Length = 457

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/460 (63%), Positives = 363/460 (78%), Gaps = 4/460 (0%)

Query: 76  MFDRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINY 135
           MFDRT ++YGVNE+LL+SA+ G++FG L GQPLCIVGVTGPI+IFNYTVY+IIKPL  +Y
Sbjct: 1   MFDRTGHAYGVNEVLLASALGGVVFGALGGQPLCIVGVTGPISIFNYTVYDIIKPLHTSY 60

Query: 136 FGFMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFND 195
           FGFMFW+ IWAMV H ++AI N V  LQYVTTFPCDIFGLF            LT QF+ 
Sbjct: 61  FGFMFWVCIWAMVCHFLLAIFNAVCLLQYVTTFPCDIFGLFINVVYVQKGIQILTRQFHL 120

Query: 196 DTSSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFI 255
           +  ++   +GFA++ VALLM  FG + K   + P  + R+R FISDYSTALSV+FWS FI
Sbjct: 121 EGKTD-FEAGFASIVVALLMSAFGLSAKLIVRTPFFSPRVRTFISDYSTALSVVFWSGFI 179

Query: 256 HFGGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFY 315
           HFGG +S+V+F KLPI KSF P+++   RDRSTWLAYE I V +VF+ALPFGIIL+ILFY
Sbjct: 180 HFGGYLSDVNFQKLPIAKSFHPSSS--MRDRSTWLAYERISVRDVFIALPFGIILSILFY 237

Query: 316 FDHNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLL 375
           FDHNVSSLMAQ ++YKLTKPSAFH+DF LLGITTG+SGVLG+PAPNGLIPQAPLHTESLL
Sbjct: 238 FDHNVSSLMAQRSQYKLTKPSAFHYDFVLLGITTGVSGVLGIPAPNGLIPQAPLHTESLL 297

Query: 376 VYGSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGN 435
           V+ S G V++CVEQRFTNTVQG++ LATM+RP L+CL QIPQAVL+GLFFIMG  GL+ N
Sbjct: 298 VHDSHGRVVRCVEQRFTNTVQGLMNLATMSRPLLVCLDQIPQAVLAGLFFIMGLNGLLNN 357

Query: 436 AIISRIVWIFTDSNTKADSK-LSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVL 494
           AI++R+ ++ T  + K  +  L  +  KK  LF++ S+ GF AEFAITNT+GAIGFP+VL
Sbjct: 358 AILNRVQYLCTQPSLKDPANMLKKVPLKKTLLFLALSLTGFAAEFAITNTRGAIGFPLVL 417

Query: 495 LLTVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETL 534
           LLTVI +  FP  F+ +EL  L+ +VA++FT+KNL +  L
Sbjct: 418 LLTVIVSLFFPKWFSVDELTVLDENVAEEFTLKNLRMSAL 457

>AFR677C Chr6 complement(1685714..1687354) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL275W
          Length = 546

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/519 (56%), Positives = 372/519 (71%), Gaps = 4/519 (0%)

Query: 18  VSKKVRIPRIGTGIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPAIAFAQDMF 77
             K+ R P +G GI  D+RDRLP YW+DW D+ DYRVIP+ + TYF NLLPA+AFAQDMF
Sbjct: 31  CEKRRRFPPLGAGIACDVRDRLPQYWSDWTDAWDYRVIPAALETYFSNLLPALAFAQDMF 90

Query: 78  DRTDNSYGVNEILLSSAMAGIIFGILSGQPLCIVGVTGPITIFNYTVYEIIKPLKINYFG 137
           D T+N++GVNE+LLSSA+A ++FG+L GQPLCIVGVTGPI++FNYT+Y+I+KPL ++YFG
Sbjct: 91  DHTNNAFGVNEVLLSSALAALVFGVLGGQPLCIVGVTGPISVFNYTLYDIVKPLGVDYFG 150

Query: 138 FMFWISIWAMVLHLIIAIMNVVAFLQYVTTFPCDIFGLFXXXXXXXXXXXXLTNQFNDDT 197
           FMFW+ IWA V HL +A+ N+V  LQYV+ FPCDIFGLF            L  QF    
Sbjct: 151 FMFWVCIWATVCHLALAVTNMVCLLQYVSAFPCDIFGLFINIVYLQKGVDILVKQFQTKE 210

Query: 198 SSNPLASGFANVTVALLMFIFGFTFKQARKFPILTERIRCFISDYSTALSVLFWSAFIHF 257
             +  A+GFA+VT+AL M IFG   K   + P+LT  +R F+SDYST LSV+FW+ F HF
Sbjct: 211 GFDA-AAGFASVTIALCMAIFGTAGKLFTETPLLTHAMRTFVSDYSTVLSVVFWTGFTHF 269

Query: 258 GGDISNVHFSKLPITKSFIPTANNGSRDRSTWLAYESIMVGNVFLALPFGIILTILFYFD 317
           GG +  V    LP++  F PT+   +RD+STWLAY  I     FLALPFGIILTILFYFD
Sbjct: 270 GGALGAVDLLHLPVSTPFQPTSE--TRDQSTWLAYVPIAPRYAFLALPFGIILTILFYFD 327

Query: 318 HNVSSLMAQNAKYKLTKPSAFHWDFFLLGITTGISGVLGLPAPNGLIPQAPLHTESLLVY 377
           H+VSSLMAQ   Y+L K S FH+DF LL +TT ++GVLG+PAPNGLIPQAP+H ESLLV 
Sbjct: 328 HSVSSLMAQRTHYRLRKASTFHYDFALLSVTTAVAGVLGIPAPNGLIPQAPMHKESLLVR 387

Query: 378 GSSGNVIKCVEQRFTNTVQGILMLATMARPFLICLGQIPQAVLSGLFFIMGFEGLMGNAI 437
              G VI+CVEQR TN++QG+L L TM RP L CLG IPQAVLS LFFIM F GL  NAI
Sbjct: 388 DRHGTVIRCVEQRVTNSLQGLLFLGTMTRPLLHCLGLIPQAVLSALFFIMAFNGLYNNAI 447

Query: 438 ISRIVWIFTDSNTK-ADSKLSYLSYKKIALFVSFSMIGFTAEFAITNTKGAIGFPIVLLL 496
           + +I+W+ TD   +  ++ L+ +  + +A+F + +      EF +T +K AI FP+ LL 
Sbjct: 448 LRKILWLLTDPRRRDPENPLNAVPLRPLAIFTALATFCALVEFVLTLSKAAIAFPVALLA 507

Query: 497 TVIFTFVFPMIFTEEELDALNPSVAQKFTIKNLLLETLS 535
           TV+ + +FP  F  E L  L+P VA++FT+KNLLLE L+
Sbjct: 508 TVLLSLLFPRFFQREHLRILDPPVAEEFTMKNLLLENLT 546

>Kwal_33.13344 s33 (179389..179667) [279 bp, 92 aa] {ON} YNL275W -
          Hypothetical ORF [contig 118] FULL
          Length = 92

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%)

Query: 30 GIYLDLRDRLPIYWADWKDSLDYRVIPSLIATYFENLLPA 69
          GI  D++DR PIYW DW D+ DYRVIP+++ TYF+   P+
Sbjct: 45 GILHDIKDRAPIYWRDWSDAWDYRVIPAVVETYFKQFAPS 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,903,514
Number of extensions: 2477629
Number of successful extensions: 8333
Number of sequences better than 10.0: 27
Number of HSP's gapped: 8460
Number of HSP's successfully gapped: 27
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)