Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H001605.708ON54954928970.0
NDAI0E050805.708ON55155224960.0
YKR097W (PCK1)5.708ON54954924730.0
Smik_11.3615.708ON54954924670.0
KNAG0C066405.708ON54754724620.0
Skud_11.3375.708ON54954924610.0
TDEL0B021205.708ON54854924560.0
Suva_11.3345.708ON54854924490.0
KLLA0A00484g5.708ON54354324450.0
CAGL0H06633g5.708ON54453624430.0
NCAS0A031605.708ON55255324350.0
SAKL0E15048g5.708ON54254224210.0
Ecym_40135.708ON54254923850.0
ZYRO0B16456g5.708ON54854923670.0
AFR292W5.708ON54155023150.0
KLTH0E00902g5.708ON54454422960.0
Kwal_55.196635.708ON54454922340.0
TPHA0E001705.708ON57852022260.0
TBLA0E017005.708ON57652621890.0
Kpol_1043.755.708ON55851821840.0
Suva_7.275singletonON961051572e-12
TDEL0C063501.67ON69397880.040
TPHA0B046201.67ON72079751.7
Kpol_2000.791.67ON70787742.3
TBLA0B001002.1ON171750723.9
Klac_YGOB_Anc_7.5417.541ON106988706.6
AEL218W5.75ON147131698.9
YOR272W (YTM1)8.721ON46066689.0
Suva_8.3218.721ON46066689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00160
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...  1120   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   966   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   957   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   954   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   952   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   952   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   950   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   947   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   946   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   945   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   942   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   937   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   923   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   916   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   896   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   889   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   865   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   862   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   847   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   845   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    65   2e-12
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    39   0.040
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...    33   1.7  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...    33   2.3  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   3.9  
Klac_YGOB_Anc_7.541 Chr2 (306623..309832) [3210 bp, 1069 aa] {ON...    32   6.6  
AEL218W Chr5 (220152..224567) [4416 bp, 1471 aa] {ON} Syntenic h...    31   8.9  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    31   9.0  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    31   9.2  

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/549 (98%), Positives = 539/549 (98%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
           FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           FETLPIFNL          TKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 541 EVLAAGPRL 549
           EVLAAGPRL
Sbjct: 541 EVLAAGPRL 549

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/552 (81%), Positives = 498/552 (90%), Gaps = 4/552 (0%)

Query: 1   MSPSKVT-TPLK--DLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISS 57
           MSP K + TP+   D N VEQKIRQELDLS  VTTIRRNAP ++LYEDAL  E+NTIISS
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALH-ERNTIISS 59

Query: 58  TGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTRE 117
           TGAL+AYSGEKTGR P+DKRIVEE  SK+DIWWGPVNKPCSERTW INRERAADYLRTR+
Sbjct: 60  TGALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRD 119

Query: 118 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQF 177
           H+YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQF
Sbjct: 120 HLYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQF 179

Query: 178 PANFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSA 237
           PANFHT+DMSSKTTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSA
Sbjct: 180 PANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSA 239

Query: 238 NEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSV 297
           N+GI   DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS 
Sbjct: 240 NQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSH 299

Query: 298 EKEPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSH 357
           EKEPEIF +IK+GSILENV+YDPK+R V YDDS++TENTRCAYPIEFIPSAKIPC+A++H
Sbjct: 300 EKEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTH 359

Query: 358 PKNIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPF 417
           P NIILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPF
Sbjct: 360 PSNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 419

Query: 418 LALHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLE 477
           LALHP++YATMLA+K+ KH ANAWLINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL 
Sbjct: 420 LALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 479

Query: 478 KESFETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDK 537
           K+ FETLP+FNL           +LLNP+KNW +GE KY+ AV  L+ LF+ENFK Y+DK
Sbjct: 480 KQEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539

Query: 538 ATKEVLAAGPRL 549
           AT EVLAA PR+
Sbjct: 540 ATPEVLAAAPRI 551

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/549 (81%), Positives = 495/549 (90%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+   +   + VEQKIRQEL LS  VTTIRRNAP +VLYED LK+ K T+ISS+GA
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENK-TVISSSGA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 240 IQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIF++IKFGS+LENV+YD KS  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 300 PEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP++YATMLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL  E+
Sbjct: 420 HPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANET 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +ETLPIFNL           +LLNP+KNW +GE KY GAV  L+ LF++NFK Y+D+AT 
Sbjct: 480 YETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATP 539

Query: 541 EVLAAGPRL 549
           +VLAAGP+ 
Sbjct: 540 DVLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/549 (81%), Positives = 494/549 (89%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+   +   + VEQKIRQEL LS  VTTIRRNAP +VLYED LK EK T+ISS+GA
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 240 IQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIF++IKFG++LENV YD KS  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 300 PEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP++YATMLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL  E+
Sbjct: 420 HPIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANET 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +E+LPIFNL           +LLNP+KNW +GE KY GAV  L+ LF+ENFK Y+D+AT 
Sbjct: 480 YESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATP 539

Query: 541 EVLAAGPRL 549
           +VLAAGP+ 
Sbjct: 540 DVLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/547 (80%), Positives = 495/547 (90%), Gaps = 1/547 (0%)

Query: 3   PSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALI 62
           PSK  +   D  +VEQKIR+EL+LS  V TIRRNAP +VLYEDAL  E+ T+I+S+GALI
Sbjct: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALH-ERKTVIASSGALI 60

Query: 63  AYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIV 122
           AYSGEKTGR PKDKRIVEE  SK+++WWGPVNKPCSERTWEINRERAADYLRTR+H+YIV
Sbjct: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120

Query: 123 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFH 182
           DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP+K+EL NFG+PDFTVWNAGQFPAN H
Sbjct: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180

Query: 183 TEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIE 242
           T+DMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+GI+
Sbjct: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240

Query: 243 KKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPE 302
             DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPE
Sbjct: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300

Query: 303 IFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNII 362
           IF++I+FGS+LENV YD KS EVDYDDS+ITENTRCAYPIE+IPSAKIPC+A+SHPKNII
Sbjct: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360

Query: 363 LLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHP 422
           LLTCDASGVLPPV+KL+ +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLALHP
Sbjct: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420

Query: 423 MKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFE 482
           ++YA MLA KM +HKANA+LINTGWTGSSY++GGKRCPL YTRAILDAIHDGSL + ++E
Sbjct: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480

Query: 483 TLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEV 542
           +LPIFNL           +LLNP+KNW +GE KY+GAV  L+ LF+ENFK Y+DKAT +V
Sbjct: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540

Query: 543 LAAGPRL 549
           LAAGP L
Sbjct: 541 LAAGPIL 547

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  952 bits (2461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/549 (81%), Positives = 493/549 (89%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+       + VEQKIRQEL LS  VTTIRRNAP +VLYED LK EK T+ISS+GA
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSG KTGR PKDKRIVEES SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 60  LIAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 240 IQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIF++IKFG++LENV YD KS  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 300 PEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP++YATMLA KM  HK+NA+LINTGW+GSSY++GGKRCPL YTRAILD+IHDGSL  E+
Sbjct: 420 HPIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANET 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +E+LPIFNL           +LLNP+KNW +GE KY G+V  L+ LF+ENFK Y+D+AT 
Sbjct: 480 YESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATP 539

Query: 541 EVLAAGPRL 549
           +VLAAGP+ 
Sbjct: 540 DVLAAGPQF 548

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/549 (80%), Positives = 496/549 (90%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+   + D++ VEQKIR EL LS+ V TIRRNAP ++LYEDAL +EK T I+S+GA
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDAL-NEKKTTIASSGA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSG+KTGR PKDKRI+EE  SK++IWWGPVNKP  E+TW INRERAADYLRTR H+Y
Sbjct: 60  LIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT +EL +FG+PDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
           +HT+ MSSKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 180 YHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I+K DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKE
Sbjct: 240 IQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEI+N+IKFGSILENVVYDPK+R+VDY+DSSITENTRCAYPIE IPSAKIPC+A+SHP+N
Sbjct: 300 PEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           ++LLTCDASGVLPP+SKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 360 LVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP++YATMLA+KM +H+ANAWLINTGWTGSSY+AGGKRCPL YTRAILDAIHDGSL KES
Sbjct: 420 HPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKES 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +ETLP FNL           +LLNPSKNW EGE KY+ AV  L+KLF+ENFK Y+D+AT 
Sbjct: 480 YETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATP 539

Query: 541 EVLAAGPRL 549
           EVLAAGP++
Sbjct: 540 EVLAAGPQV 548

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/549 (80%), Positives = 490/549 (89%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+       + VEQKIRQEL LS  VTTIRRNAP +VLYED LK EK T+ISS+GA
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLK-EKKTVISSSGA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSG KTGR PKDKRIVEE  SK++IWWGPVNKPCSERTW INRERAADYLRTR+HIY
Sbjct: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPT++EL +FG+PDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HT+DMSSK+TIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+G
Sbjct: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKE
Sbjct: 240 IKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIF++I+FG++LENV YD  S  VDYDDSSITENTRCAYPI++IPSAKIPC+A+SHPKN
Sbjct: 300 PEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           IILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFLAL
Sbjct: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP++YATMLA KM +H+ANA+LINTGWTGSSY++GG RC L YTRAILD+IHDGSL K S
Sbjct: 420 HPIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKAS 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +E+LPIFNL           +LLNP+KNW +GE KY GAV  L+ LF+ENFK Y+D+AT 
Sbjct: 480 YESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539

Query: 541 EVLAAGPRL 549
           +VLAAGP+ 
Sbjct: 540 DVLAAGPQF 548

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/543 (80%), Positives = 489/543 (90%), Gaps = 2/543 (0%)

Query: 8   TPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGE 67
           +P K  N+ E+ IR EL LS+ V TIRRNAP ++LYEDALK E++T IS+ GALIAYSG+
Sbjct: 2   SPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALK-ERDTAISNAGALIAYSGD 60

Query: 68  KTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAG 127
           KTGR P+DKRIVEE  SK+++WWGPVNKPCSERTWEINRERAADYLRTR+HIYIVDA+AG
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 128 WDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMS 187
           WDP+YRIKVRVVCARAYHALFMTNMLIRP+K+ELENFG+PDFTVWNAGQFPAN HT  M+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 188 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVT 247
           SKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI+  DVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 248 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSI 307
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS EKEPEIFN+I
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 308 KFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCD 367
           KFGS+LEN++YDP +REVDY+DS+ITENTRCAYPIE+IPSAKIPC+A+ HPKNI+LLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 368 ASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYAT 427
           ASGVLPPVSKLT DQVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 428 MLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIF 487
           MLAEKM +H ANAWLINTGWTGSSY+AGGKRCPL YTRAILDAIHDGSL KE +E LPIF
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 488 NLXX-XXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAG 546
           NL             LLNPSKNW EGE KY+  VK L+ LF+ENFKTY+DKAT++VLAAG
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540

Query: 547 PRL 549
           P+L
Sbjct: 541 PQL 543

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/536 (81%), Positives = 486/536 (90%), Gaps = 1/536 (0%)

Query: 14  NAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCP 73
           N+VE++IR EL LS  VT IRRNAP +VLY+DALK EK T+ISS GALIAYSGEKTGR P
Sbjct: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALK-EKKTVISSAGALIAYSGEKTGRSP 68

Query: 74  KDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYR 133
           KDKRIVEE  S++++WWGPVNKPCSERTW INRERAADYLRTRE +Y+VDAFAGWDPKYR
Sbjct: 69  KDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYR 128

Query: 134 IKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIE 193
           IKVRVVCARAYHALFMTNMLIRPT++EL NFG+PDFTVWNAGQFPAN  T+DM+SKTTIE
Sbjct: 129 IKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIE 188

Query: 194 INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLS 253
           INFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSS N+GI+  DVTLFFGLS
Sbjct: 189 INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLS 248

Query: 254 GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSIL 313
           GTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF++I+FGS+L
Sbjct: 249 GTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVL 308

Query: 314 ENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLP 373
           ENV+YD +S EVDYDDSSITENTRCAYPI+FIPSAKIPC+A +HPKNIILLTCDASGVLP
Sbjct: 309 ENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLP 368

Query: 374 PVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKM 433
           PVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFL+LHPM+YATMLAEKM
Sbjct: 369 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKM 428

Query: 434 EKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLXXXX 493
            +H ANAWLINTGWTGSSY++GGKRC L YTRAILDAIHDGSL K  FE+LPIFNL    
Sbjct: 429 HEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPK 488

Query: 494 XXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549
                 ++LLNP++NW EGE KY  AV KL+ LF+ENFKTY+DKAT +VLAAGP+L
Sbjct: 489 AVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/553 (79%), Positives = 495/553 (89%), Gaps = 5/553 (0%)

Query: 1   MSPSKVTTP----LKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIIS 56
           MSP KV++     + D   VEQ IR+EL LS  VTTIRRNAP +VLYEDAL  E+ T+I+
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALH-ERKTVIA 59

Query: 57  STGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTR 116
           S+GALIAYSG KTGR P+DKRIVEE  SK+++WWGPVNKPCSE+TW INRERAADYLRTR
Sbjct: 60  SSGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTR 119

Query: 117 EHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQ 176
           +H+YIVDAFAGWDPKYRIKVRVVCARAYHA+FMTNMLIRPT++EL  FG+PDFT+WNAGQ
Sbjct: 120 DHLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQ 179

Query: 177 FPANFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSS 236
           FPAN +T+DMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSS
Sbjct: 180 FPANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSS 239

Query: 237 ANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS 296
           AN+GI+  DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS
Sbjct: 240 ANQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLS 299

Query: 297 VEKEPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANS 356
            EKEPEIFN+IK+GSILENV+YD  +R VDYDD+SITENTRCAYPIE+IPSAKIPC+A+S
Sbjct: 300 AEKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADS 359

Query: 357 HPKNIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQP 416
           HPKNIILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTE+GVTEP+ TFSSCFGQP
Sbjct: 360 HPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQP 419

Query: 417 FLALHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSL 476
           FLALHP++YATMLAEK+  H A+AWLINTGWTGSSY+ GGKRCPL YTRAILD+IHDGSL
Sbjct: 420 FLALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSL 479

Query: 477 EKESFETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYED 536
            K+S+ETLPIFNL           ++LNP+KNW EGE KYS AV KL  LF+ENFKTY+D
Sbjct: 480 AKQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQD 539

Query: 537 KATKEVLAAGPRL 549
           +AT +VLAAGP++
Sbjct: 540 RATPDVLAAGPQI 552

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/542 (79%), Positives = 488/542 (90%), Gaps = 1/542 (0%)

Query: 8   TPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGE 67
           +P K   + EQ+IR ELDLS  V TIRRNAP ++LYEDALK E+ T ISS+GALIAYSGE
Sbjct: 2   SPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALK-ERKTTISSSGALIAYSGE 60

Query: 68  KTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAG 127
           KTGR P+DKRIV+ES S +++WWGPVNK CSERTW+INRERAADYLRTR+H+YIVDA+AG
Sbjct: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120

Query: 128 WDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMS 187
           WDP+YRIKVRVVCARAYHALFMTNMLIRPT+ EL  FG+PDFTVWNAGQFPAN HT  M+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180

Query: 188 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVT 247
           SKTT+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI   DVT
Sbjct: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240

Query: 248 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSI 307
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI+N+I
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300

Query: 308 KFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCD 367
           KFGS+LENV+Y+P++REVDY+DSSITENTRCAYPI++IPSAKIPC+A++HP NI+LLTCD
Sbjct: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360

Query: 368 ASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYAT 427
           ASGVLPPVS+LT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 428 MLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIF 487
           MLAEKM KH ANAWLINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL KE +ETLP F
Sbjct: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480

Query: 488 NLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGP 547
           NL          ++LLNP+KNW EGE KY+ AV+ L++LF+ENFKTY+D+AT +VL+AGP
Sbjct: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540

Query: 548 RL 549
           +L
Sbjct: 541 QL 542

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/549 (79%), Positives = 480/549 (87%), Gaps = 7/549 (1%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSKV        + E+KIR EL LSSGV  IRRNAP ++LYEDAL  E+NT ISSTGA
Sbjct: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALL-ERNTAISSTGA 53

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIAYSGEKTGR PKDKRIV+E  S   +WWGPVN+  SERTW+INRERA DYLRTREH+Y
Sbjct: 54  LIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLY 113

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQFPAN
Sbjct: 114 IVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPAN 173

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HTE MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HNVLTLHSSAN+G
Sbjct: 174 THTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG 233

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I K DVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKE
Sbjct: 234 IAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKE 293

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIFN+I++GS+LENVVY+P SR VDYDDSSITENTRCAYPIE+IPSAKIPC++NSHP N
Sbjct: 294 PEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSN 353

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 354 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLAL 413

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HPMKYATMLAEKM +H ANAWLINTGWTG+SY++GGKRCPL YTRAILDAIH GSL    
Sbjct: 414 HPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANAD 473

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +ETLP+F L          ++LLNPS+NW EGE KYS AV  L+ LF++NFK Y+D+ATK
Sbjct: 474 YETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATK 533

Query: 541 EVLAAGPRL 549
           EVL AGP+L
Sbjct: 534 EVLYAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/549 (76%), Positives = 479/549 (87%), Gaps = 1/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSKV  P+ D   VE++IR+EL L S V TIR NAP + LYED LK++K  ++SS GA
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSS-GA 59

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           L AYSG KTGR PKDKRI+EE  SK ++WWGPVNKP SE+TW INRERAADYLRTR+H+Y
Sbjct: 60  LAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLY 119

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           I+DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ +EL NFG+PDFTVWNAGQFPAN
Sbjct: 120 IIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPAN 179

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            +TE M+SKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 180 RNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           IE+ DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ EKE
Sbjct: 240 IERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKE 299

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEI+N+IKFGS+LENVV+D  +REVDY D+SITENTRCAYPI++IPSAKIPC+A+ HP N
Sbjct: 300 PEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSN 359

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 360 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLAL 419

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HPM+YATMLA+KM +H ANAWL+NTGWTGSSY AGGKRCPL YTRAILD+IHDGSL K  
Sbjct: 420 HPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKAD 479

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +ETLPIFNL            LLNP+K+W EG  KY+ AVK L+  F ENFK Y+D+AT 
Sbjct: 480 YETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATP 539

Query: 541 EVLAAGPRL 549
           +VLAAGP+ 
Sbjct: 540 DVLAAGPQF 548

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/550 (77%), Positives = 477/550 (86%), Gaps = 10/550 (1%)

Query: 1   MSPSKV-TTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTG 59
           MSPSKV  TP       E+KIR EL LSSGV TIRRNAP +VLYEDAL  E+ T ISSTG
Sbjct: 1   MSPSKVYQTP-------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALA-ERKTAISSTG 52

Query: 60  ALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHI 119
           ALIAYSGEKTGR PKDKRIV+E  S ++IWWGPVN+  SE+TW INRERAAD+LRTREH+
Sbjct: 53  ALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHL 112

Query: 120 YIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPA 179
           YIVDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQFPA
Sbjct: 113 YIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPA 172

Query: 180 NFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANE 239
           N HTE MSSKTT+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HNVLTLHSSAN+
Sbjct: 173 NTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQ 232

Query: 240 GIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEK 299
           G    DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EK
Sbjct: 233 G-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEK 291

Query: 300 EPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPK 359
           EPEIFN+IK+GS+LENVVYDP +R VDY+DSSITENTRCAYPIE+IPSA+IPC++ +HP 
Sbjct: 292 EPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPS 351

Query: 360 NIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLA 419
           NI+LLTCDASGVLPPVS+LT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLA
Sbjct: 352 NIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLA 411

Query: 420 LHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKE 479
           LHPMKYATMLAEKM +H A+AWLINTGWTGSSY AGGKRCPL YTRAILD+IHDG+L + 
Sbjct: 412 LHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQA 471

Query: 480 SFETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKAT 539
            +ETLP+F L           +LLNP+KNW EGE KY+ AV  L+  F ENFK Y+D+AT
Sbjct: 472 EYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQAT 531

Query: 540 KEVLAAGPRL 549
           +EV+ AGP++
Sbjct: 532 EEVVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/544 (76%), Positives = 469/544 (86%), Gaps = 3/544 (0%)

Query: 8   TPLKDLNAVEQK--IRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYS 65
           +P K  N V  K  IRQEL L   V TIRRNAP ++LYEDALK+ K TI SS GALIA+S
Sbjct: 2   SPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASS-GALIAFS 60

Query: 66  GEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAF 125
           G KTGR PKDKRIV+E  S  +IWWGPVNK CSE+TW +NRERAADYLRTR+H+YIVDA+
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 126 AGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTED 185
           AGWDP+YRIK+RVVCARAYHALFMTNMLIRPTK+ELENFG+PDFTVWNAGQFPAN HT+ 
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 186 MSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKD 245
           M+SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI  +D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 246 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFN 305
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 306 SIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLT 365
           +IKFGS+LENV YDP +R VDY+D  ITENTRCAYPIE+IPSAKIPC+ANSHPKNI+LLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 366 CDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKY 425
           CDASGVLPPVSKLT  QVMYHFISGYTSK+AGTE+GVTEP+ TFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 426 ATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLP 485
           ATMLAEKM +H+ANAWLINTGWTG+S++ GG RCPL YTRAILDA+HDGSL +E FETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 486 IFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAA 545
            F L            +LNP+KNW+EGE KY   V  L+KLF ENFK Y+D+A+ +V++A
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 546 GPRL 549
           GP L
Sbjct: 541 GPVL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/549 (73%), Positives = 469/549 (85%), Gaps = 5/549 (0%)

Query: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60
           MSPSK+    ++L +V+ +IR+EL L   V TIRRNAP ++LYEDALK+ K T IS++GA
Sbjct: 1   MSPSKI----RNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENK-TRISASGA 55

Query: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120
           LIA+SG KTGR PKDKRIV+E  S ++IWWGPVNK CSE+TW +NRERAAD+LRTR+H+Y
Sbjct: 56  LIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLY 115

Query: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180
           IVDA+AGWDP+YRIK+RVVCARAYHALFMTNMLI+PT  ELE FG+PDFTVWNAGQFPAN
Sbjct: 116 IVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPAN 175

Query: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240
            HT+ M+SKTTIEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPI+H VLTLHSSAN+G
Sbjct: 176 THTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQG 235

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           I   DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KE
Sbjct: 236 IRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKE 295

Query: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360
           PEIFN+I+FGS+LENV YD  +REVD+++  ITENTRCAYPIE+IPSAKIPC+A+ HPKN
Sbjct: 296 PEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKN 355

Query: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSK+AGTE+GVTEP+ TFSSCFGQPFLAL
Sbjct: 356 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLAL 415

Query: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480
           HP+KYATMLA+KM  HKA+AWLINTGWTG S++ GG RCPL YTRAILDAIHDG+L KE 
Sbjct: 416 HPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEE 475

Query: 481 FETLPIFNLXXXXXXXXXXTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540
           +ETLP FNL          + +LNP+++W  GE KY   V+ L+ LF+ENFK YE  A+ 
Sbjct: 476 YETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANAST 535

Query: 541 EVLAAGPRL 549
           E++ AGP L
Sbjct: 536 EIMCAGPLL 544

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/520 (77%), Positives = 450/520 (86%), Gaps = 1/520 (0%)

Query: 30  VTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKEDIW 89
           +  I+RN PV+ LYED LK+ K T +SSTGALIAYSG KTGR PKDKRIVEE  SK++IW
Sbjct: 60  LINIKRNPPVATLYEDGLKENK-TTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118

Query: 90  WGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHALFM 149
           WGPVNK CSERTW INRERA DYL TR+ +Y++DAF GWDP+YRIK+RVVCARAYHALFM
Sbjct: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178

Query: 150 TNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTEYA 209
            NMLIRPTK+ELENFG PDFTVWNAGQF AN  T DMSSKT++EINFK MEM ILGTEYA
Sbjct: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238

Query: 210 GEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLI 269
           GEMKKGIFTVMFYLMPI+HNVLTLHSSAN+     DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298

Query: 270 GDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDYDD 329
           GDDEHCWSD GVFNIEGGCYAKCI LS EKEP+IFN+IKFGS+LEN +YD ++ EVDYD+
Sbjct: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358

Query: 330 SSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHFIS 389
           S+ITENTRCAYPI++I +AKIPC+A+ HP N+ILLTCDASGVLPPVSKLT +QVMYHFIS
Sbjct: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418

Query: 390 GYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGWTG 449
           GYTSKMAGTE GVTEPQPTFSSCFGQPFLALHPMKYA+MLAEKM+KHKANAWL+NTGWTG
Sbjct: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478

Query: 450 SSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLXXXXXXXXXXTKLLNPSKNW 509
           SSY++GG RCPL YTRAILDAIHDGSL+ E +ETLPIFNL          ++LLNP+ +W
Sbjct: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538

Query: 510 YEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549
            +    Y  AV++L KLF ENFKTYEDKAT EV+ AGP L
Sbjct: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/526 (74%), Positives = 459/526 (87%), Gaps = 5/526 (0%)

Query: 28  SGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKED 87
           S +  I+ N   ++LYEDALK+ K T+ISS+GALIAYSG KTGR PKDKRIV E  SK++
Sbjct: 52  SSLINIKHNPSAAILYEDALKEPK-TVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDN 110

Query: 88  IWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHAL 147
           +WWGPVNKPCSE+TW+INRER  DYL TR ++Y++DA+ GWDP+YR+KVRVVCARAYHAL
Sbjct: 111 VWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHAL 170

Query: 148 FMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTE 207
           FMTNMLIRPT++EL+NF +PDFTVWNAG F AN +T DM+SKT++EINFKAMEMIILGTE
Sbjct: 171 FMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTE 230

Query: 208 YAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRL 267
           YAGEMKKGIFTVMFYLMPIHHN+LTLHSSANEGIEKKDVT+FFGLSGTGKTTLSADP+RL
Sbjct: 231 YAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRL 290

Query: 268 LIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDY 327
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF++I+FGS+LENV Y+  + +VDY
Sbjct: 291 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDY 350

Query: 328 DDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHF 387
           +D +ITENTRCAYPI++I SAKIPC+ANSHPKN+ILLTCDASGVLPPVSKLT +QVMYHF
Sbjct: 351 NDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHF 410

Query: 388 ISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGW 447
           ISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLALHP+ YATMLA+KM+++K+NAWLINTGW
Sbjct: 411 ISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGW 470

Query: 448 TGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLXXXXXXXXXXTKLLNPSK 507
           TGSSY AGG RCPL YTRAILDAIHDG+L  E++ETLP+FNL           ++LNP  
Sbjct: 471 TGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPEN 530

Query: 508 NW----YEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549
           +W     +  + Y+ AV KL+ LF+ENFK Y+DKAT +VLAAGP++
Sbjct: 531 SWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/518 (75%), Positives = 447/518 (86%), Gaps = 1/518 (0%)

Query: 32  TIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWG 91
           TI+RN P++ LYED LK E +T +SSTGAL+AYSG KTGR PKDKRIVEE  SK++IWWG
Sbjct: 42  TIKRNPPIAELYEDGLK-EDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 92  PVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTN 151
           PVNKPCSE TW INRERA DYL TR+ +Y++DA+AGWD  YRIK+RVVCAR YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 152 MLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIEINFKAMEMIILGTEYAGE 211
           MLIRPT +ELENFG+PDFT+WNAG F AN  T+DM+SKT+IEINFK+MEM+ILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 212 MKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGD 271
           MKKGIFTVMFYLMP++HNVLTLHSSAN+G+   DVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 272 DEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSILENVVYDPKSREVDYDDSS 331
           DEHCWSD GVFNIEGGCYAKCI L+ EKEPEIFN+IKFGS+LEN VYD  +  VDYDDS 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 332 ITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHFISGY 391
           ITENTRCAYPI+FI SAKIPC+ + HP N+ILLTCDASGVLPPVSKLT +QVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 392 TSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHKANAWLINTGWTGSS 451
           TSKMAGTEQGVTEP+PTFS+CFGQPFLALHPMKYA MLA+KM  HKA+AWLINTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 452 YIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLXXXXXXXXXXTKLLNPSKNWYE 511
           Y AGGKRCPL YTRAILDAIH+GSL  E +ETLP+FNL          ++LLNPSK W +
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 512 GELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549
            ++ YS AVKKL  LF++NF  Y+D+AT +V+AAGP L
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query: 378 LTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKMEKHK 437
           LTS++VMYHF SG+ S   G                 +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 438 ANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFE 482
            +A+LINTG+                TR   D+IHD SL KE F 
Sbjct: 58  -SAYLINTGYALK-------------TRVNFDSIHDDSLAKELFR 88

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 20/97 (20%)

Query: 241 IEKKDVTLFFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDTGVFNIEGGCYAKC 292
           +E  +     G SG+GK+T+++        +  R++IGD      +   FN+    Y + 
Sbjct: 463 VEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDH-----NINSFNVRK--YRRL 515

Query: 293 INLSVEKEPEIFNSIKFGSILENVVYDPKSREVDYDD 329
           + + V++EP++FN    G+IL+N++Y       D DD
Sbjct: 516 LGI-VQQEPQLFN----GTILDNILYTVPPERADNDD 547

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 20/79 (25%)

Query: 249 FFGLSGTGKTTLS--------ADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300
           F G SG+GK+T+S        A    +LIG+D        + ++    Y K + + V++E
Sbjct: 484 FVGPSGSGKSTVSQLLLRYYDATEGNILIGEDN-------IKSLSLRKYRKLLGV-VQQE 535

Query: 301 PEIFNSIKFGSILENVVYD 319
           P +FN    G+I++N++Y+
Sbjct: 536 PMLFN----GTIIDNILYN 550

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 20/87 (22%)

Query: 241 IEKKDVTLFFGLSGTGKTTLSADPHR--------LLIGDDEHCWSDTGVFNIEGGCYAKC 292
           IE  +   F G SG+GK+T+S+   R        +L+G ++       + N     Y + 
Sbjct: 479 IEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGED-------IKNFSLRKYRRL 531

Query: 293 INLSVEKEPEIFNSIKFGSILENVVYD 319
           + + V++EP +FN    G+ILEN++Y 
Sbjct: 532 LGV-VQQEPMLFN----GTILENILYS 553

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 345  IPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLTSDQVMYHFIS-GYTS 393
            + S K+ C+  S     ILLT +AS    P S   S++++YH+IS GYT+
Sbjct: 968  LSSLKVKCLLKSGT---ILLTDNASTSSKPPSNKQSNRMLYHYISQGYTT 1014

>Klac_YGOB_Anc_7.541 Chr2 (306623..309832) [3210 bp, 1069 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 1069

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 36/88 (40%)

Query: 320 PKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLPPVSKLT 379
           P S E++ D+  +  N R    ++ +   KIP   ++ P + + + C      P   +  
Sbjct: 616 PYSPELELDEDFVDYNNRLGDELKSLSEIKIPRFLSAAPPHALFMDCTHDNETPYQKRTV 675

Query: 380 SDQVMYHFISGYTSKMAGTEQGVTEPQP 407
            D +    + G +S   G+  G  E  P
Sbjct: 676 EDTLPNAALVGLSSSAVGSVYGYDEIYP 703

>AEL218W Chr5 (220152..224567) [4416 bp, 1471 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR164C (DNA2)
          Length = 1471

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 238  NEGIEKKDVTLFFGLSGTGKTTLSADPHRLL 268
            ++ I  KD  L  G+ GTGKTTL A+  R+L
Sbjct: 1069 DKAIRCKDYALILGMPGTGKTTLIAEIIRIL 1099

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 6   VTTPLKDLNAVEQKI------RQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTG 59
           V  PL+D+N    KI      R++L +  G  TIRR AP+S+L E      +  I  ST 
Sbjct: 243 VVDPLEDINNPNNKISTAARKRRKLTMKDG--TIRRRAPLSLL-ESHTAPVEQVIFDSTD 299

Query: 60  ALIAYS 65
             + YS
Sbjct: 300 NTVGYS 305

>Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W
           (REAL)
          Length = 460

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 6   VTTPLKDLNAVEQKI------RQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTG 59
           V  PL+D+N    KI      R++L +  G  TIRR AP+S+L E      +  I  ST 
Sbjct: 243 VVDPLEDINNPNNKISTAARKRRKLTMKDG--TIRRRAPLSLL-ESHTAPVEQVIFDSTD 299

Query: 60  ALIAYS 65
             + YS
Sbjct: 300 NTVGYS 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,439,160
Number of extensions: 2661277
Number of successful extensions: 6833
Number of sequences better than 10.0: 36
Number of HSP's gapped: 6936
Number of HSP's successfully gapped: 36
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)