Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0H001505.712ON65665632370.0
NDAI0F002005.712ON110547010641e-131
SAKL0E15136g5.712ON103749410521e-130
Suva_9.305.712ON106248910381e-127
NCAS0G001705.712ON103045410331e-127
Skud_11.3385.712ON71244810021e-126
Smik_9.135.712ON106049910191e-125
KLLA0A00396g5.712ON101248510091e-124
YIL156W (UBP7)5.712ON107154710121e-123
Smik_11.3625.712ON7214489871e-123
TDEL0B020805.712ON102545810021e-122
Skud_9.125.712ON106449410031e-122
KNAG0L022005.712ON116150310061e-122
Suva_11.3355.712ON7244549761e-122
YKR098C (UBP11)5.712ON7174519751e-122
Kpol_2001.785.712ON4034159461e-121
Kwal_55.196455.712ON9704659841e-120
KLTH0E00814g5.712ON9744679801e-120
CAGL0H06721g5.712ON10814719811e-119
TPHA0D046605.712ON10454559541e-115
Ecym_40095.712ON15174659591e-113
TBLA0E017605.712ON12124969091e-108
AFR296C5.712ON11694548961e-106
CAGL0G02563gsingletonON6316698301e-101
KAFR0D021605.712ON8464598312e-99
ZYRO0B16544g5.712ON10441333803e-37
Suva_2.2288.188ON9274383031e-27
CAGL0I06765g8.188ON8874492958e-27
Skud_4.3238.188ON9264372922e-26
TBLA0F036108.188ON11444162896e-26
Kwal_14.20088.188ON4244602728e-25
KAFR0C025908.188ON9783212709e-24
Smik_4.3078.188ON9292322611e-22
TDEL0B042208.188ON8252352582e-22
CAGL0G05247g8.188ON9472332583e-22
YDR069C (DOA4)8.188ON9262322565e-22
AFR007W8.188ON8482412556e-22
Kpol_1032.288.188ON8822342522e-21
Ecym_61848.188ON8512412512e-21
NCAS0B042808.188ON9223422512e-21
YER144C (UBP5)8.188ON8052372494e-21
KNAG0D019308.188ON9863072494e-21
Smik_5.3098.188ON8052382451e-20
Suva_5.2728.188ON7882372432e-20
KLTH0H07678g8.188ON8612392404e-20
Skud_5.2818.188ON8232372387e-20
TPHA0C027708.188ON9702422342e-19
KLLA0E10275g8.188ON7962422315e-19
NDAI0C059008.188ON8262602297e-19
SAKL0H18986g8.188ON8932442291e-18
NDAI0A036808.188ON11162462272e-18
ZYRO0G06798g8.188ON8772352243e-18
NCAS0A039108.188ON7954422163e-17
ABL145W2.69ON7494411833e-13
NCAS0C021108.540ON4943711787e-13
KNAG0G015908.188ON6712261797e-13
KNAG0C021801.137ON12312301781e-12
Kwal_33.136281.137ON11602121762e-12
TPHA0A025401.137ON12862011763e-12
Kpol_304.65.712ON5621801743e-12
NCAS0B005808.742ON4664471662e-11
Kwal_26.91518.742ON4544491653e-11
AFR627C1.137ON12872021663e-11
Smik_10.371.137ON12472261655e-11
KLTH0F03674g1.137ON11982091646e-11
Ecym_46857.390ON7781421637e-11
YJL197W (UBP12)1.137ON12542251621e-10
TDEL0C056401.137ON11782081611e-10
Kpol_2001.541.137ON12232181611e-10
CAGL0L01639g1.137ON11472101602e-10
KAFR0E009308.540ON4984831582e-10
NDAI0B004801.137ON12532491574e-10
KAFR0F015601.137ON11712121575e-10
SAKL0H04994g8.742ON4541131555e-10
KLLA0C03476g1.137ON12522041565e-10
Skud_14.1482.69ON7764391556e-10
ZYRO0C17908g1.137ON12042081566e-10
KNAG0B023707.390ON7531421557e-10
KLTH0D12760g8.742ON4534501537e-10
NCAS0I031401.137ON12012061548e-10
Suva_6.2761.137ON12562301549e-10
Ecym_81401.137ON12642001531e-09
Kwal_33.144302.69ON5114361502e-09
Smik_2.497.390ON7451431493e-09
KNAG0F012202.69ON7844491485e-09
KAFR0A042108.742ON4401351465e-09
Skud_10.221.137ON12551981476e-09
Suva_2.507.390ON7501431467e-09
Skud_2.387.390ON7481401458e-09
TDEL0B036708.742ON4634531441e-08
ZYRO0B03300g7.390ON8131411441e-08
KNAG0G029308.742ON4591141431e-08
NDAI0E041807.390ON8271511441e-08
KAFR0A069102.307ON6783691431e-08
YBL067C (UBP13)7.390ON7471431422e-08
YER098W (UBP9)7.390ON7541431413e-08
NCAS0A143707.390ON7291421413e-08
KLLA0C06974g8.742ON4462571394e-08
TBLA0H036008.540ON4823851394e-08
NDAI0A016707.390ON8461421404e-08
TPHA0E008707.390ON7151061395e-08
NCAS0E026107.390ON7171411396e-08
KNAG0C035807.390ON7761421386e-08
Kpol_1064.488.742ON4661231368e-08
SAKL0C04246g1.137ON12972001388e-08
TBLA0J006001.137ON14622071371e-07
TDEL0B030608.540ON7342831361e-07
CAGL0H05335g8.540ON4834631341e-07
NCAS0D023905.18ON12111241352e-07
ZYRO0A05962g8.742ON4651361332e-07
Suva_16.2408.540ON5234091332e-07
Smik_5.2447.390ON7491401323e-07
NDAI0E008108.742ON4931491323e-07
TBLA0D006207.390ON11711391333e-07
CAGL0M11198g8.742ON4611371313e-07
CAGL0A04477g7.390ON7701401314e-07
ZYRO0D03982g8.540ON8213771315e-07
TPHA0O016402.69ON7464271315e-07
Suva_13.4078.742ON4711431288e-07
Ecym_62488.742ON4661191289e-07
YMR223W (UBP8)8.742ON4711451279e-07
Kpol_1045.417.390ON7121411281e-06
KLTH0B07150g2.69ON7561381281e-06
Suva_5.2177.390ON7541421281e-06
TBLA0B097602.69ON8982951271e-06
KLLA0D08459g2.69ON7501531262e-06
TDEL0A011002.69ON6611401262e-06
Ecym_11668.540ON6964191252e-06
SAKL0E13002g2.69ON7394391253e-06
Smik_13.4318.742ON4711431243e-06
Skud_13.3928.742ON4731451243e-06
YER151C (UBP3)8.202ON9121611243e-06
SAKL0H00418g5.18ON11901331243e-06
Skud_5.2237.390ON7481401243e-06
NDAI0C059508.202ON10801611234e-06
TPHA0G005608.742ON4631261225e-06
ZYRO0C09812g2.69ON7021371225e-06
ZYRO0F01276g3.270ON7762351217e-06
CAGL0J11352g2.69ON7711201217e-06
Smik_5.3188.202ON9091631218e-06
TDEL0C015707.390ON7651411209e-06
NDAI0F034102.69ON8702491201e-05
AEL242W8.540ON6132901191e-05
TBLA0D010708.742ON4831191181e-05
ZYRO0D07062g5.18ON11931381191e-05
Kpol_1024.448.540ON4963891181e-05
AFR551W8.742ON4691171172e-05
TPHA0L022905.18ON11931261192e-05
Kpol_1018.937.390ON7551441182e-05
YPL072W (UBP16)8.540ON4994711172e-05
SAKL0H18656g8.202ON7721601182e-05
NDAI0I025305.18ON11971311182e-05
Skud_5.2898.202ON9101611172e-05
Skud_16.2098.540ON5034101163e-05
NCAS0B061302.307ON7702671163e-05
NCAS0I016203.270ON7952331163e-05
Kpol_513.255.18ON11902211154e-05
CAGL0M13783g5.18ON11961151154e-05
AGR370W7.390ON740551144e-05
AGL357W5.18ON11661381154e-05
YMR304W (UBP15)5.18ON12302191128e-05
TPHA0P006807.390ON7271491129e-05
Suva_13.4955.18ON12301301129e-05
KLTH0B09944g5.18ON11891331111e-04
KAFR0I026005.18ON12131251111e-04
ZYRO0B11044g8.202ON8261581101e-04
Klac_YGOB_Anc_5.18b5.18ON11661211101e-04
NCAS0D006001.369ON4932571092e-04
Smik_13.5215.18ON12312191102e-04
TBLA0B019308.202ON10191591102e-04
TDEL0A016208.202ON7951571092e-04
Skud_13.4785.18ON12311311092e-04
NCAS0G018002.69ON8751181082e-04
KAFR0L017307.390ON7011411083e-04
Suva_5.2808.202ON9051611083e-04
CAGL0I06600g8.202ON8161591083e-04
TDEL0G004105.18ON11861431073e-04
CAGL0K10494g1.369ON4952021064e-04
KAFR0K018107.390ON7141421064e-04
SAKL0F12430g7.390ON7541421064e-04
TBLA0C070205.18ON1247561065e-04
YFR010W (UBP6)1.369ON4991191046e-04
CAGL0I05522g7.390ON7241011047e-04
Kpol_1044.242.69ON7242031047e-04
Ecym_56715.18ON11761381047e-04
NDAI0B034302.307ON8564021048e-04
Kwal_34.162681.369ON4491201020.001
KNAG0E012905.18ON11961221030.001
Ecym_55448.202ON8341601030.001
KNAG0A019708.540ON4714711020.001
Suva_4.2953.270ON7822121010.002
TPHA0D043508.202ON8541571010.002
CAGL0H10186g3.270ON7782221010.002
ZYRO0G01188g1.369ON500741000.002
TDEL0D035503.270ON7802241010.002
KAFR0B023708.202ON8291591000.002
TBLA0C012001.369ON50330990.002
KLTH0E12540g8.540ON75277990.003
TDEL0D024001.369ON494112980.003
Kwal_26.95985.18ON1191133990.004
KLLA0E20351g7.390ON697148980.004
TBLA0B060802.307ON824277980.004
KAFR0A075802.69ON802186980.004
Suva_6.831.369ON500119960.005
Kpol_1055.318.202ON822157970.005
TPHA0A025101.369ON50530960.006
TBLA0E025703.270ON785230960.007
KNAG0C019401.369ON499103950.007
Kpol_534.231.369ON496174950.008
SAKL0H10076g8.540ON76781950.009
Ecym_27171.369ON483216940.010
KLTH0C06732g7.390ON714130940.011
AGR139C8.202ON789156940.011
KNAG0A054502.307ON764270940.012
KNAG0J008003.270ON765116940.013
Kwal_27.108427.390ON711140930.014
Kwal_27.120308.540ON74981930.014
KLLA0A10791g1.369ON48440910.021
Kwal_14.19578.202ON444143910.021
KLTH0H07370g8.202ON781159920.021
KLLA0E23387g8.540ON782220910.023
KLLA0E01013g8.202ON774150910.025
ZYRO0A02420g2.307ON745410910.027
TBLA0A064705.443ON132030910.030
Skud_6.941.369ON49930890.036
NDAI0E028208.540ON495383890.040
KLLA0E02377g5.443ON122037890.048
KLTH0H13354g1.369ON49527880.048
Smik_7.3141.369ON499120880.059
Kpol_1016.15.443ON125131880.061
KAFR0C004103.270ON769237870.068
Kwal_27.114442.307ON757275870.072
KNAG0B041905.443ON126248870.086
YNL186W (UBP10)2.69ON792190860.10
Smik_16.1638.540ON501407850.11
TPHA0E017105.443ON128330850.16
SAKL0D10120g1.369ON49230840.16
NDAI0A074103.270ON810232840.18
NDAI0H035501.369ON50249830.20
KAFR0C045201.369ON499176830.21
NDAI0C015505.443ON129548830.22
TPHA0J026205.443ON122570830.25
NDAI0G007802.307ON486105820.27
AGR389C2.307ON775277820.29
SAKL0G02728g5.443ON123726820.30
AGR023C3.270ON780251820.33
KLLA0E08801g2.307ON77124820.34
KAFR0D050705.443ON122730810.38
AEL029W1.369ON44631800.40
Kpol_1003.532.307ON78833810.40
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0H00150
         (656 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...  1251   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     414   e-131
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   409   e-130
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   404   e-127
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     402   e-127
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   390   e-126
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   397   e-125
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   393   e-124
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   394   e-123
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   384   e-123
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   390   e-122
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   390   e-122
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   392   e-122
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   380   e-122
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   380   e-122
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   369   e-121
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   383   e-120
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   382   e-120
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   382   e-119
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   372   e-115
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   374   e-113
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   354   e-108
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   349   e-106
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   324   e-101
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   324   2e-99
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   150   3e-37
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   121   1e-27
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   118   8e-27
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   117   2e-26
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   115   6e-26
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   109   8e-25
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   108   9e-24
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   105   1e-22
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   103   2e-22
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   103   3e-22
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   103   5e-22
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   102   6e-22
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   101   2e-21
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   101   2e-21
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    101   2e-21
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   100   4e-21
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   100   4e-21
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    99   1e-20
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    98   2e-20
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    97   4e-20
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    96   7e-20
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    95   2e-19
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    94   5e-19
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    93   7e-19
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    93   1e-18
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              92   2e-18
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    91   3e-18
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     88   3e-17
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    75   3e-13
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    73   7e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    74   7e-13
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    73   1e-12
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    72   2e-12
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    72   3e-12
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...    72   3e-12
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       69   2e-11
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    68   3e-11
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    69   3e-11
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    68   5e-11
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    68   6e-11
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    67   7e-11
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    67   1e-10
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    67   1e-10
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    67   1e-10
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    66   2e-10
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    65   2e-10
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    65   4e-10
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    65   5e-10
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    64   5e-10
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    65   5e-10
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    64   6e-10
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    65   6e-10
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    64   7e-10
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    64   7e-10
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    64   8e-10
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    64   9e-10
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    64   1e-09
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    62   2e-09
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    62   3e-09
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    62   5e-09
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    61   5e-09
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    61   6e-09
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    61   7e-09
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    60   8e-09
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    60   1e-08
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    60   1e-08
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    60   1e-08
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    60   1e-08
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    60   1e-08
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    59   2e-08
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    59   3e-08
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    59   3e-08
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    58   4e-08
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    58   4e-08
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    59   4e-08
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    58   5e-08
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    58   6e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    58   6e-08
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    57   8e-08
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    58   8e-08
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    57   1e-07
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    57   1e-07
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    56   1e-07
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    57   2e-07
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    56   2e-07
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    56   2e-07
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    55   3e-07
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    55   3e-07
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    56   3e-07
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    55   3e-07
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    55   4e-07
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    55   5e-07
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    55   5e-07
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    54   8e-07
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    54   9e-07
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    54   9e-07
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    54   1e-06
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    54   1e-06
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    54   1e-06
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    54   1e-06
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    53   2e-06
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    53   2e-06
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    53   2e-06
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    53   3e-06
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    52   3e-06
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    52   3e-06
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    52   3e-06
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    52   3e-06
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    52   3e-06
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    52   4e-06
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    52   5e-06
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    52   5e-06
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    51   7e-06
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    51   7e-06
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    51   8e-06
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    51   9e-06
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    51   1e-05
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    50   1e-05
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    50   1e-05
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    50   1e-05
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    50   1e-05
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    50   2e-05
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    50   2e-05
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    50   2e-05
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    50   2e-05
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    50   2e-05
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    50   2e-05
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    50   2e-05
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    49   3e-05
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    49   3e-05
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    49   3e-05
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    49   4e-05
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    49   4e-05
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    49   4e-05
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    49   4e-05
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    48   8e-05
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    48   9e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    48   9e-05
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    47   1e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    47   1e-04
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    47   1e-04
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    47   1e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    47   2e-04
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    47   2e-04
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    47   2e-04
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    47   2e-04
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    47   2e-04
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      46   2e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    46   3e-04
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    46   3e-04
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    46   3e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    46   3e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   4e-04
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    45   4e-04
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    45   4e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    45   5e-04
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    45   6e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    45   7e-04
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    45   7e-04
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    45   7e-04
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     45   8e-04
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    44   0.001
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    44   0.001
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    44   0.001
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    44   0.001
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    44   0.002
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    44   0.002
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    44   0.002
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    43   0.002
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    44   0.002
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    43   0.002
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    43   0.002
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    43   0.003
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    42   0.003
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    43   0.004
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    42   0.004
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    42   0.004
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    42   0.004
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.005
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    42   0.005
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    42   0.006
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    42   0.007
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    41   0.007
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    41   0.008
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    41   0.009
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    41   0.010
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    41   0.011
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    41   0.011
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    41   0.012
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    41   0.013
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    40   0.014
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    40   0.014
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    40   0.021
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    40   0.021
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    40   0.021
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    40   0.023
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    40   0.025
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    40   0.027
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.030
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.036
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    39   0.040
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.048
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    39   0.048
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.059
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.061
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    38   0.068
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    38   0.072
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    38   0.086
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    38   0.10 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    37   0.11 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    37   0.16 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    37   0.16 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    37   0.18 
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    37   0.20 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    37   0.21 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.22 
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    37   0.25 
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               36   0.27 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    36   0.29 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    36   0.30 
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    36   0.33 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.34 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    36   0.38 
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    35   0.40 
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    36   0.40 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    36   0.44 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    35   0.51 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    35   0.56 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    35   0.71 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    35   0.79 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   0.99 
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    34   1.0  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   1.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    34   1.2  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    34   1.2  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    34   1.2  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    34   1.2  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    34   1.3  
TDEL0C01260 Chr3 complement(214580..215959) [1380 bp, 459 aa] {O...    34   1.5  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    34   1.6  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    34   1.7  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    34   1.7  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    34   1.7  
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    33   2.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    33   2.2  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    33   2.2  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    33   2.3  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    33   2.4  
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    33   2.5  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    33   2.6  
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    33   2.6  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    33   3.2  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    32   4.1  
Smik_7.141 Chr7 (260116..261495) [1380 bp, 459 aa] {ON} YGL130W ...    31   8.8  

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 1251 bits (3237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/656 (96%), Positives = 631/656 (96%)

Query: 1   MASLSSDKMNLEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXX 60
           MASLSSDKMNLEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLER       
Sbjct: 1   MASLSSDKMNLEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDH 60

Query: 61  XXXXXXXFKVYTSHKSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYE 120
                  FKVYTSHKSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYE
Sbjct: 61  TTYLLDLFKVYTSHKSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYE 120

Query: 121 GQISMKNILDTVKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180
           GQISMKNILDTVKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP
Sbjct: 121 GQISMKNILDTVKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180

Query: 181 TLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGL 240
           TLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGL
Sbjct: 181 TLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGL 240

Query: 241 RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGG 300
           RNQGNTCYINSMVQCLFGTKVLRDLFISE  YKDFIKKDAETKISEPFARLLLTMYENGG
Sbjct: 241 RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGG 300

Query: 301 TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDIN 360
           TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDIN
Sbjct: 301 TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDIN 360

Query: 361 LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK 420
           LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK
Sbjct: 361 LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK 420

Query: 421 ENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSIN 480
           ENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSIN
Sbjct: 421 ENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSIN 480

Query: 481 PLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVI 540
           PLNFFKLHKVLSPSSGN           KSDGKNKNKYKNEKLITLKQLNFIKLPPILVI
Sbjct: 481 PLNFFKLHKVLSPSSGNHHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVI 540

Query: 541 HLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKD 600
           HLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKD
Sbjct: 541 HLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKD 600

Query: 601 LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
           LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE
Sbjct: 601 LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  414 bits (1064), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/470 (50%), Positives = 306/470 (65%), Gaps = 33/470 (7%)

Query: 205  ESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD 264
            E  S +L R    +K ++P I+ + N+   LS+ GLRN GNTCYINSM+QCLF T++ RD
Sbjct: 648  ERESLMLTRS---RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRD 704

Query: 265  LFISEXXYKDFI---KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNI 321
            LFIS   ++ FI   K     KIS  F  L   MY NGG SV+P +FL+  ++LRPDL I
Sbjct: 705  LFISSK-FQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRI 763

Query: 322  PKDQQDTQEFLVILLDILHDELVYTDDLIS---NNYVSDDINL---GKEYMPWLQNNLKA 375
            P DQQDTQEFL+I+LD LHDEL    ++++   N  + D+ NL    KEY  W   N+  
Sbjct: 764  PDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIG 823

Query: 376  NGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCI 433
            NG SPID IF GQ+EN LQCQRCGN+SYNYS FY+LSLAIPK +    +   RVKLE+CI
Sbjct: 824  NGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883

Query: 434  NFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLN--------FF 485
            N FTSDE+L+GENAW+CPKC  +   T  +++    V +  K K+++  N        FF
Sbjct: 884  NMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSS-KKKNMSSHNEHHRYKSKFF 942

Query: 486  KLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRF 545
             LH   S  S +            S  KN+  +K++KLIT+K LNFI LPPILVIHLSRF
Sbjct: 943  TLH-TRSHRSISPFRKKTSPAAVPSSTKNE-PWKSKKLITIKTLNFIVLPPILVIHLSRF 1000

Query: 546  YYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSL 605
            YY+ TKKNN VITYPLILNI++KNN +V KY+LYG++NH G L  GHYTS+VNK+ NH L
Sbjct: 1001 YYDLTKKNNTVITYPLILNIVLKNN-EVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDL 1059

Query: 606  DLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
               +Q+WY FDDE +K+  ++  ++K         +  S  VYVLFYERI
Sbjct: 1060 GSKKQRWYYFDDETVKEERNHGDMDKGIL------QVSSRDVYVLFYERI 1103

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 81/149 (54%), Gaps = 5/149 (3%)

Query: 15  SLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSH 74
           S+ G   F+    ++L   V SI+  DIK YY +L+LE+              F  Y  +
Sbjct: 2   SVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKN 61

Query: 75  KSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKE 134
            +  +    AF+ G +YLFLIIP  +QFQ+KNK +  Y +LK  YE +  M N+L  VK+
Sbjct: 62  NTNNKDVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKD 121

Query: 135 KSVSILEQDL----SGINRRILKK-RAYT 158
           +  ++L+ D     S +N RI+K+ RAY+
Sbjct: 122 EIENVLDMDENNNGSDLNHRIIKRQRAYS 150

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  409 bits (1052), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/494 (46%), Positives = 298/494 (60%), Gaps = 43/494 (8%)

Query: 181  TLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGL 240
            T+SH  ++  R LS  KRS       +S            +VP I+ + N+   LS+ GL
Sbjct: 566  TVSH--AHRHRYLSHSKRSQHQHYSPISHQYI--------SVPTIEQSSNVYVSLSITGL 615

Query: 241  RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD--AETKISEPFARLLLTMYEN 298
            RN G+TCYINSM+QCLF T+  RD+F+S   Y D+I K      +IS  F  L   MY N
Sbjct: 616  RNLGSTCYINSMLQCLFATRKFRDIFLSPK-YHDYISKGYIHRAQISRSFHMLFKKMYMN 674

Query: 299  GGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY---- 354
            GG SV+P  FL+  + +RPD  IP DQQDTQEFL+ LLD LHDEL    + ++N+Y    
Sbjct: 675  GGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDELS-DPEQVANDYPQLL 733

Query: 355  VSDDINL---GKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
            + DD NL   GKEY  W ++++  NG SPID IFQGQ+ENCLQCQRCG++SYNYS FY+L
Sbjct: 734  LHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVL 793

Query: 412  SLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPAT 469
            SLAIP           +V LEDCIN FTSDE+L+GENAW+CP+C  +          P  
Sbjct: 794  SLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTSM-----SGSGPGE 848

Query: 470  VENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGK--------NKNKYKNE 521
             + + K K + P +    ++                    S              K+K++
Sbjct: 849  GKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMPGSEKWKSK 908

Query: 522  KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGL 581
            KL T+K  NFI +PPILVIHLSRF+Y+ TKKN+ VITYPLILNI++KNN +V KY+LYG+
Sbjct: 909  KLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNN-EVAKYRLYGI 967

Query: 582  INHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDE 641
            +NH G L  GHYTS+VNKDL H +   +Q+WY FDDEV+K+ N++        F+     
Sbjct: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG------DFDAGIAS 1021

Query: 642  FDSSKVYVLFYERI 655
              SS VYVLFYERI
Sbjct: 1022 VSSSDVYVLFYERI 1035

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVN 87
           ++L   V  ++  DIK YY KL+LE+              + +    +  +  A  AF+ 
Sbjct: 11  NELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLK-QGNQEDALTAFII 69

Query: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147
           GSFY++LIIP  +QF T+NK +  Y DL+  Y+ + SM N+L  V +K  +IL +     
Sbjct: 70  GSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCKSRDFD 129

Query: 148 NRRILKKRAYTEPS 161
           + +I +KRAY+ PS
Sbjct: 130 DTKITRKRAYSVPS 143

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  404 bits (1038), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/489 (46%), Positives = 295/489 (60%), Gaps = 67/489 (13%)

Query: 222  VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAE 281
            +P I+ + N    LS+ GLRN GNTCYINSM+QCLF  KV R LFIS   YK ++++   
Sbjct: 586  IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSK-YKSYLQQSRG 644

Query: 282  TKISEP-----FARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILL 336
             ++  P        L   MY NGG SV+P  FL+  + LRPDL IP DQQDTQEFL+ILL
Sbjct: 645  NRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704

Query: 337  DILHDELVYTDDLISNNYV------SDDINLG-KEYMPWLQNNLKANGKSPIDLIFQGQI 389
            D LHDEL      ++N+Y       +D + +  KEY  W   N+  NG SPID IFQGQ+
Sbjct: 705  DRLHDELS-NQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763

Query: 390  ENCLQCQRCGNTSYNYSMFYMLSLAIP-------KIAKENSKNRVKLEDCINFFTSDEIL 442
            EN LQC+RCG T++NYS FY+LSLAIP       K+ + N K RVKLEDCIN FTSDE+L
Sbjct: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEK-RVKLEDCINMFTSDEVL 822

Query: 443  TGENAWNCPKCCPTT-----------------IETYDEADSPATVENRVKNKSI------ 479
            +GENAW+CP+C PT                  +++  +     T+  R K + +      
Sbjct: 823  SGENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDS 882

Query: 480  -------NPLNFFKLHKVLSP-----SSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLK 527
                   NP++F +  +  SP       G             +DG N N +KN+KL T+K
Sbjct: 883  SNESTSNNPVHFER-ERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVK 941

Query: 528  QLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGG 587
             +NF+ LP ILVIHLSRFYY+ TKKNN VITYPLILNII+KNN D +KY+L+G++NH G 
Sbjct: 942  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN-DTMKYRLFGVVNHTGT 1000

Query: 588  LTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKV 647
            L  GHYTS+VNKDL H++D+   +WY FDDEV+K   ++      +S  I      SS  
Sbjct: 1001 LISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVK---ADKKHGSDKSLKIS-----SSDA 1052

Query: 648  YVLFYERIE 656
            YVLFYER+ 
Sbjct: 1053 YVLFYERVH 1061

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 81/152 (53%), Gaps = 10/152 (6%)

Query: 34  VDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVY--TSHKSRKRQATLAFVNGSFY 91
           V  ++  DIK YY +    +              F++Y  +    R   A  AFV G +Y
Sbjct: 20  VRDLYHEDIKHYYPQ---LKLEKLLDLLEHTEYLFELYLDSMRHERPNDALTAFVIGCYY 76

Query: 92  LFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE---QDLSGIN 148
           +FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L+   + + GI 
Sbjct: 77  VFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVVGIE 136

Query: 149 RRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180
            RI KKRA++ P I   LS   +S S+ +  P
Sbjct: 137 HRITKKRAFSVPGI--DLSDQLASLSLDAAGP 166

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  402 bits (1033), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/454 (48%), Positives = 293/454 (64%), Gaps = 29/454 (6%)

Query: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI- 276
            ++ ++P I+ + N+   LS+ GLRN GNTCYINSM+QCLF T+  RDLF++   Y  F+ 
Sbjct: 588  RRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSK-YSSFLN 646

Query: 277  --KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334
              K      IS  F  L   MY NGG SV+P +FL+  ++LRPDL IP DQQDTQEFL+I
Sbjct: 647  GSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMI 706

Query: 335  LLDILHDELVYTDDLISNNYVS----DDINL---GKEYMPWLQNNLKANGKSPIDLIFQG 387
            +LD LHDEL    +++ N Y S    D  +L    +EY  W + ++  NG SPID IFQG
Sbjct: 707  ILDRLHDELSNQQEVV-NEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQG 765

Query: 388  QIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTGE 445
            QIEN LQCQRCG++S+NYS FY+LSLAIPK +    +   RVKLEDCIN FT+DE+L+GE
Sbjct: 766  QIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEMLSGE 825

Query: 446  NAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKL----HKVLSPSSGNXXXX 501
            NAW+CP C     +        +  + R   +  +   FF L    H+ LSP   +    
Sbjct: 826  NAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRSLSPFRKSGSSS 885

Query: 502  XXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPL 561
                   K    ++ ++K +KLIT+K LNFI LPP+LVIHLSRF+Y+ TKKN  VITYPL
Sbjct: 886  TNSTSKIK----HEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPL 941

Query: 562  ILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIK 621
            ILNI++KNN +V KYKLYG++NH G L  GHYTS+VNK+  H+L+ N+Q+WY FDDEV+K
Sbjct: 942  ILNIVLKNN-EVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVK 1000

Query: 622  KLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
               ++  I+   S      +  S  VYVLFYER+
Sbjct: 1001 AEGNHGDIDNGIS------KVSSKDVYVLFYERL 1028

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 86/149 (57%), Gaps = 6/149 (4%)

Query: 34  VDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVNGSFYLF 93
           + S+++ DIK YY +L+LE+              F ++  H+   + A  +F+ G +YLF
Sbjct: 22  IQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELF-LHFGHEGNNKDALTSFIVGCYYLF 80

Query: 94  LIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL----EQDLSGINR 149
           LI+P  +QFQ++NK +  Y DLK  YE Q SM N+L  VK++  +IL    E++++  N 
Sbjct: 81  LIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEKTAEREINETNN 140

Query: 150 RILKKRAYTEPSIRSGLSRDRSSTSVLSR 178
           RI+++RAY+ P   + L+    S SV  R
Sbjct: 141 RIVRQRAYSVPD-SNDLTEQLHSLSVSDR 168

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  390 bits (1002), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/448 (48%), Positives = 291/448 (64%), Gaps = 35/448 (7%)

Query: 223 PIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA-- 280
           P I+ +  +   LS+ GL+N  NTCYINS++QCLFG+   RDLF+++  Y+ F+K +   
Sbjct: 277 PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKK-YRLFLKTEEYP 335

Query: 281 -ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDIL 339
            E ++S     L   MY NGG++++P  FL+    LRPDLNIP DQQDTQEFL+I+L  +
Sbjct: 336 KEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARI 395

Query: 340 HDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCL 393
           H+EL       Y  DL+S +  +  +N  K Y  W +  + A+G SPID IF+GQ+EN L
Sbjct: 396 HEELSNENVTKYYCDLVSYDTNALQVNPIK-YQKWYEETILADGLSPIDHIFRGQMENIL 454

Query: 394 QCQRCGNTSYNYSMFYMLSLAIPK--IAKENSKNR-VKLEDCINFFTSDEILTGENAWNC 450
           +CQRCGN+S++YS FY+LSLAIPK  +    SK++ +KLEDCIN FTSDE LTG+NAW+C
Sbjct: 455 KCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDC 514

Query: 451 PKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKS 510
           P+C    I+     DS          K  +PL  F  H   S S               S
Sbjct: 515 PEC---RID-----DSKLKTGENSSQKKRSPL--FSFH---SRSRSKSPHHHHHYHHHGS 561

Query: 511 DG--KNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMK 568
           D   KN NK+K+++L T+K L+FI LPPILVIHLSRFYY+ TKKNNAVITYPLILNII+K
Sbjct: 562 DNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILK 621

Query: 569 NNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
           NN  VV+YKLYG +NH G L  GHYTS+VNK+ +H + LN+Q W  FDD+ I + + +  
Sbjct: 622 NN-KVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKD-- 678

Query: 629 INKKESFNIEKDEFDSSKVYVLFYERIE 656
              ++ F   K +  SS+VYVLFYER++
Sbjct: 679 ---RDGFEAGKTKMSSSEVYVLFYERMD 703

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 80/138 (57%), Gaps = 8/138 (5%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTS--HKSRKRQATLAF 85
           D + +LV  +++ DIK +Y++LRL+               F VY      +R+ +A  AF
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHL---FDVYLRDLEINREVEALTAF 62

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS 145
           + G +YL+LIIP  +QFQT++ L++ Y  LK  Y+ +  M  +L  V+++S SI++Q LS
Sbjct: 63  IIGGYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLS 122

Query: 146 GINR---RILKKRAYTEP 160
             NR    I +KRAY+ P
Sbjct: 123 DSNRITVTITRKRAYSLP 140

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  397 bits (1019), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/499 (46%), Positives = 296/499 (59%), Gaps = 65/499 (13%)

Query: 211  LARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEX 270
            L +P   K +++P I+   N+   LS+ GLRN GNTCYINSM+QCLF  K  R LFIS  
Sbjct: 571  LLQPLPPKDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSN 630

Query: 271  XYKDFIKKDAET------KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD 324
             YK++++  A        K+S   + L   MY NGG SV+P  FL+  + LRPDL IP D
Sbjct: 631  -YKNYLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD 689

Query: 325  QQDTQEFLVILLDILHDELVYTDDLISNNYV------SDDINLGK-EYMPWLQNNLKANG 377
            QQDTQEFL+ILLD LHDEL      ++N+Y       +D + +   EY  W   N+  NG
Sbjct: 690  QQDTQEFLMILLDRLHDELS-NQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNG 748

Query: 378  KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIP----KIAK--ENSKNRVKLED 431
             SPID IFQGQ+EN LQC+RCG T++NYS FY+LSLAIP    K++K   +++ RVKLED
Sbjct: 749  ISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLED 808

Query: 432  CINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVL 491
            CIN FTSDE+L+GENAW+CP+C PT   T   + S    E+ +         FF LH   
Sbjct: 809  CINMFTSDEVLSGENAWDCPRCGPTASFTASASASALENESSILKSKKKKSRFFTLHTGS 868

Query: 492  ----------SPSSGNXXXXXXXXXXXKS-------------------------DGKNKN 516
                      S   GN           +S                         D  N  
Sbjct: 869  KRRHLDIFGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTG 928

Query: 517  KYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKY 576
             +KN+K+ T+K +NF+ LP ILVIHLSRFYY+ TKKNN VITYPLILNII+KNN D +KY
Sbjct: 929  DFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN-DTMKY 987

Query: 577  KLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFN 636
            +L+G++NH G L  GHYTS+VNKDL HS+D+   +WY FDDEV+K          K+  +
Sbjct: 988  RLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA--------DKKHGS 1039

Query: 637  IEKDEFDSSKVYVLFYERI 655
             +  +  SS VYVLFYER+
Sbjct: 1040 DKNLKISSSDVYVLFYERV 1058

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 89/165 (53%), Gaps = 10/165 (6%)

Query: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVY--TSHKSRK 78
           +F+    D+L   V  ++  DIK YY +    +              F++Y  + H  R 
Sbjct: 7   LFTPEYSDELLRRVQDLYHEDIKHYYPQ---LKLEKLLDLLEHTEYLFELYLDSMHHGRP 63

Query: 79  RQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVS 138
             A  AFV G +Y+FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   
Sbjct: 64  NDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGV 123

Query: 139 ILEQDLS---GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180
           +L++ +    GI  RI KKRA++ P+  + LS   +S S+ +  P
Sbjct: 124 VLDESVKHVVGIEHRINKKRAFSVPA--NDLSGQVASLSLDTAGP 166

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  393 bits (1009), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/485 (46%), Positives = 296/485 (61%), Gaps = 42/485 (8%)

Query: 191  RTLSTPKRSS-TLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYI 249
            + L TP+R+  T+ T+ L    +         +P I+ + N    LS+ GLRN GNTCYI
Sbjct: 549  KELRTPQRNDWTVQTQHLHVPFS---------IPTIERSPNEFVSLSITGLRNMGNTCYI 599

Query: 250  NSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVIPKNFL 309
            NSM+QCLFG    RDLF+    ++    K + T IS+ F+ L   MY NGG SV+P  FL
Sbjct: 600  NSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFL 659

Query: 310  QQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY----VSDDINL---G 362
            +   +LRPD +IP DQQDTQEFL+ LLD LHDEL      ++N+Y    + DD  L    
Sbjct: 660  KACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTK-VANDYPNLLLHDDEKLLVDN 718

Query: 363  KEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK-- 420
            KEY  W    LK NG SPID IFQGQ+EN L+CQRCG TSYNYS FY+LSLAIP +    
Sbjct: 719  KEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPK 778

Query: 421  --ENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNK- 477
                SK  ++LEDCIN +T DE+LTGENAW+CPKC   +  +    +S  TV+ + K   
Sbjct: 779  TFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNF 838

Query: 478  -SINPLN-----FFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNF 531
             S+N  +     FFKL    S  SG            K +   K   K++K+ T+K LNF
Sbjct: 839  LSVNGDHKSRSKFFKLS---SSRSGKRSLSPFKSNSVKPE---KLHIKSKKMTTIKTLNF 892

Query: 532  IKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKG 591
            I +P ILVIHLSRF+Y+ TKKN  +I YPLIL++++KNN ++ +Y+LYG+INH G L  G
Sbjct: 893  ITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNN-EIARYRLYGIINHFGNLVSG 951

Query: 592  HYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLF 651
            HYTS+VNK L+H +   +Q+WY FDDEV+KK  ++   ++  +         S  VYVLF
Sbjct: 952  HYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGIT------SISSGDVYVLF 1005

Query: 652  YERIE 656
            YERI 
Sbjct: 1006 YERIH 1010

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 78/144 (54%), Gaps = 6/144 (4%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVN 87
           D+L S V  ++  D+K YY KL+LE+              ++   S   +       +V 
Sbjct: 11  DELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLS-VEKYEDCLCEYVI 69

Query: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147
           GSFY+FLIIP  VQF  +NK ++ Y DLK  Y+ +++M N+L  V  K  S+L Q++  +
Sbjct: 70  GSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEIL 129

Query: 148 NRRIL---KKRAYT--EPSIRSGL 166
            ++ L   +KRA++  EP IR  L
Sbjct: 130 AKQHLDPSRKRAFSVEEPIIRYQL 153

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  394 bits (1012), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/547 (42%), Positives = 308/547 (56%), Gaps = 78/547 (14%)

Query: 170  RSSTSVLSRKPTL---SHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIID 226
             S  S +SRKP +    HV      +    +R      +     + +P   + + +P I+
Sbjct: 540  HSQVSSISRKPPIPAKQHVKKEQLNSNEIIQRKRQHQHQHYDQQILQPQ--RAYNIPTIE 597

Query: 227  ATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK------KDA 280
             + N+   LS+ GLRN GNTCYINSM+QCLF  K  R LFIS   YK +++         
Sbjct: 598  RSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSK-YKSYLQPIRSNGSHY 656

Query: 281  ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILH 340
              K+S   + L   MY NGG SV+P  FL+  + LRPDL IP DQQDTQEFL+ILLD LH
Sbjct: 657  SPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLH 716

Query: 341  DELVYTDDLISNNYV------SDDINLGK-EYMPWLQNNLKANGKSPIDLIFQGQIENCL 393
            DEL      ++N+Y       +D + +   EY  W   N+  NG SPID IFQGQ+EN L
Sbjct: 717  DELS-DQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 775

Query: 394  QCQRCGNTSYNYSMFYMLSLAIPKIAKENSK------NRVKLEDCINFFTSDEILTGENA 447
            QC+RCG T++NYS FY+LSLAIP+ + + SK       RVKLEDCIN FTSDE+L+GENA
Sbjct: 776  QCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENA 835

Query: 448  WNCPKCCPTTIETYDEADSPATVENR--VKNKSINPLNFFKLHK--------------VL 491
            W+CP+C PT       + S + +EN   +         FF LH                 
Sbjct: 836  WDCPRCGPTA----SVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITE 891

Query: 492  SPSSGNXXXXXXXXXXXKS-----------------------DGKNKNKYKNEKLITLKQ 528
              +S N           +S                       D  N + YKN+KL T+K 
Sbjct: 892  GHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKT 951

Query: 529  LNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGL 588
            +NF+ LP ILVIHLSRFYY+ TKKNN V+TYPLILNII+KNN D +KYKL+G++NH G L
Sbjct: 952  INFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNN-DTMKYKLFGVVNHTGTL 1010

Query: 589  TKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVY 648
              GHYTS+VNKDL H++++   +WY FDDEV+K          ++  + +  +  SS VY
Sbjct: 1011 ISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKA--------DRKHGSDKNLKISSSDVY 1062

Query: 649  VLFYERI 655
            VLFYER+
Sbjct: 1063 VLFYERV 1069

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 83/152 (54%), Gaps = 10/152 (6%)

Query: 34  VDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVY--TSHKSRKRQATLAFVNGSFY 91
           V  ++  DIK YY +    +              F++Y  + H  R   A  AF+ G +Y
Sbjct: 29  VQDLYHEDIKHYYPQ---LKLEKLLDLLEHTEYLFELYLDSIHHDRPNDALTAFIIGCYY 85

Query: 92  LFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDL---SGIN 148
           +FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L++ +   +GI 
Sbjct: 86  VFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHGAGIE 145

Query: 149 RRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180
            RI KKRA++ P+    LS   +S S+ +  P
Sbjct: 146 HRITKKRAFSVPA--DDLSGQVASLSLDTAAP 175

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score =  384 bits (987), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 213/448 (47%), Positives = 285/448 (63%), Gaps = 35/448 (7%)

Query: 222 VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA- 280
           +P I+ + ++   LS+ GL+N  NTCYINS++QCLFGT + RDLF+++  Y+ F++ D  
Sbjct: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK-YRLFLQTDKY 345

Query: 281 --ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDI 338
             E ++S     L   MY NGG ++ P  FL+    LRPDLNIP DQQDTQEFL+I+L  
Sbjct: 346 PREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILAR 405

Query: 339 LHDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENC 392
           LH+EL       Y  DL+S +  +  +N  K Y  W + ++  +G SPID IF+GQ+EN 
Sbjct: 406 LHEELSNGTVTEYYPDLVSYDANAFQVNPSK-YQKWYEGSVLTDGLSPIDYIFRGQMENI 464

Query: 393 LQCQRCGNTSYNYSMFYMLSLAIPKIAK---ENSKNRVKLEDCINFFTSDEILTGENAWN 449
           L+CQRCGN+S++YS FY+LSLAIPKI+     +   ++KLEDCIN FTSDE L+G+N+W+
Sbjct: 465 LKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524

Query: 450 CPKCCPTTIET-YDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXX 508
           CP C  T ++T  +E+ S        K KS     FF  H   S S              
Sbjct: 525 CPNCGTTDLKTKINESTSQ-------KKKS----TFFSFHS-RSRSKSPHHHHHHHHHSH 572

Query: 509 KSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMK 568
            +  K+  K+ + KL T+K  +FI LPPILVIHLSRFYY+ T+KNN VITYPLILN+I+K
Sbjct: 573 DNTEKHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILK 632

Query: 569 NNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
           NN  VV+YKLYG +NH G L  GHYTS VNK+ NH + LN Q W  FDD+ IK+      
Sbjct: 633 NN-KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ------ 685

Query: 629 INKKESFNIEKDEFDSSKVYVLFYERIE 656
            +  + F   K E  SS+VYVLFYER++
Sbjct: 686 -HHHDDFEAGKTEVSSSEVYVLFYERMD 712

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 84/138 (60%), Gaps = 8/138 (5%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYT--SHKSRKRQATLAF 85
           D + +LV ++++ DIK +Y++LRL+               F+VY   S  +++ +A  AF
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHL---FEVYLRDSEINQEMEALTAF 62

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS 145
           + G +YL+L+IP  +QFQT+N L++ Y  LK DY+ +  M  +L  VKE+S  I+++ LS
Sbjct: 63  IIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLS 122

Query: 146 G---INRRILKKRAYTEP 160
               I+R I +KRAY+ P
Sbjct: 123 DSNRISRTITRKRAYSLP 140

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  390 bits (1002), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/458 (46%), Positives = 290/458 (63%), Gaps = 39/458 (8%)

Query: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK 277
            + +++P I+ + N    LS+ GLRN GNTCYINSM+QCLF T   RDLF+S   +++F  
Sbjct: 588  RHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVS-GKFEEFFN 646

Query: 278  KDAETK--ISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVIL 335
            ++   +  +S+ F  L   MY NGG SV+P +FL+    LRPDL IP DQQDTQEFL++ 
Sbjct: 647  QNYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVT 706

Query: 336  LDILHDELV--------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQG 387
            LD LHDEL         Y D L+ + +  D +N GKEY  W + ++  NG +PID IFQG
Sbjct: 707  LDRLHDELSNQAAVANEYPDLLLYDEHQMD-VN-GKEYKKWFEESVIGNGLAPIDHIFQG 764

Query: 388  QIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTGE 445
            QIEN L+CQRCGN+S++YS FY+LSLAIPK +    +   RVKLEDCIN FT+DEIL+GE
Sbjct: 765  QIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGE 824

Query: 446  NAWNCPKC-------CPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNX 498
            NAW+CPKC        P  ++   +       E R ++KS     FF++H     S    
Sbjct: 825  NAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEER-RSKS----GFFRIHSKSKRSKSPF 879

Query: 499  XXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVIT 558
                        +      +K+++L T K LNFI LPP+L+IHLSRFYY+ TKKN+ ++T
Sbjct: 880  RMLGSTKFPLAME-----DWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVT 934

Query: 559  YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
            YPL+LNII+KNN +  +Y+LY ++NH G L  GHYTS+VNK+  H LD   Q+WY FDDE
Sbjct: 935  YPLVLNIILKNN-ETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDE 993

Query: 619  VIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
            V+K+   +  I++     I K    SS VYVLFYER++
Sbjct: 994  VVKEETKHGNIDQ----GILK--VSSSDVYVLFYERLD 1025

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 80/155 (51%), Gaps = 12/155 (7%)

Query: 11  LEDSSLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKV 70
           + D+ +   P +S+    +L   V ++++ DIK Y+T+    +              F+ 
Sbjct: 1   MADTEVSFTPEYSN----ELLRCVQNLYEDDIKHYFTQ---SKLEKLLDLLEHTEYLFES 53

Query: 71  YTS--HKSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNI 128
           Y    H+   + A  AF+ G +YL+LI+P  ++FQT+NK ++ + DL   Y+ Q +M N+
Sbjct: 54  YLQFLHEKNNQDALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNV 113

Query: 129 LDTVKEKSVSILE---QDLSGINRRILKKRAYTEP 160
           L  VK++  SIL+   ++      +  + RAY+ P
Sbjct: 114 LLMVKDEVDSILDRNAREFKEFEHQKARTRAYSVP 148

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score =  390 bits (1003), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 227/494 (45%), Positives = 295/494 (59%), Gaps = 67/494 (13%)

Query: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI- 276
            + + +P I+ + N+   LS+ GLRN GNTCYINSM+QCLF  K+ R LFIS   YK+++ 
Sbjct: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFIS-ANYKNYLQ 639

Query: 277  -----KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEF 331
                 +    +K+S     L   MY NGG SV+P  FL+  + LRPDL IP DQQDTQEF
Sbjct: 640  PPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699

Query: 332  LVILLDILHDELVYTDDLISNNYV------SDDINLGK-EYMPWLQNNLKANGKSPIDLI 384
            L+ILLD LHDEL      ++N+Y       +D + +   EY  W   N+  NG SPID I
Sbjct: 700  LMILLDRLHDELS-NQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDI 758

Query: 385  FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSK------NRVKLEDCINFFTS 438
            FQGQ+EN LQC+RCG T++NYS FY+LSLAIP+ + + SK       RVKLEDCIN FT 
Sbjct: 759  FQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTD 818

Query: 439  DEILTGENAWNCPKCCPTTIETYDEADSPATVENR-VKNKSINPLNFFKLH--------- 488
            DE+L+GENAW+CP+C PT   +   A + A      +         FF LH         
Sbjct: 819  DEVLSGENAWDCPRCGPTASSSSASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLD 878

Query: 489  --------------------KVLSP-----SSGNXXXXXXXXXXXKSDGKNKNKYKNEKL 523
                                +  SP     SSG             +DG N N +KN+KL
Sbjct: 879  FFGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKL 938

Query: 524  ITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLIN 583
             T+K +NF+ LP ILVIHLSRFYY+ TKKN+ VITYPLILNII+KNN + +KY+L+G++N
Sbjct: 939  TTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNN-ETMKYRLFGVVN 997

Query: 584  HQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKD-EF 642
            H G L  GHYTS+VNKDL HS+D+   +WY FDDEV+K  N + +         +K+ + 
Sbjct: 998  HTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS---------DKNLKI 1048

Query: 643  DSSKVYVLFYERIE 656
             SS VYVLFYER+ 
Sbjct: 1049 SSSDVYVLFYERVH 1062

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 81/144 (56%), Gaps = 4/144 (2%)

Query: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQ 80
           +F+    ++L   V  ++  DIK YY +L+LE+              +     H +R   
Sbjct: 7   LFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRH-NRPND 65

Query: 81  ATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL 140
           A  AF+ G +Y+FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L
Sbjct: 66  ALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVL 125

Query: 141 EQDLS---GINRRILKKRAYTEPS 161
           ++ +    GI  RI KKRA++ P+
Sbjct: 126 DESVKHAVGIEHRITKKRAFSVPA 149

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  392 bits (1006), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/503 (44%), Positives = 294/503 (58%), Gaps = 81/503 (16%)

Query: 220  HTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD 279
            +++P I+   NI   LS+ GLRN GNTCYINSM+QCLF TK  R+LFIS   YK+F+K+ 
Sbjct: 673  YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFIS-MKYKEFLKEV 731

Query: 280  A--------ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEF 331
            A        +  IS  F  L   MY NGG SV+P +FL+  SLLRPD  IP DQQDT EF
Sbjct: 732  APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEF 791

Query: 332  LVILLDILHDELVYTDDLISNN-----YVSDDINL-GKEYMPWLQNNLKANGKSPIDLIF 385
            L+++LD LHDEL   D +++       Y    +N+  KEY  W   ++  NG SPID IF
Sbjct: 792  LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIF 851

Query: 386  QGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILT 443
            QGQ+EN L CQRCG++S+NYS FY+LSLAIPK      +   RV LE+C+N +TSDE+L+
Sbjct: 852  QGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLS 911

Query: 444  GENAWNCPKCCPTTIETYDEADSPATVENRVKNKS------------------------- 478
            GENAW+CP CC  T       D    VE   +NK+                         
Sbjct: 912  GENAWDCPNCCKIT------KDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLFSFSLH 965

Query: 479  --------INPLNFFKLHKVLSP-----SSGNXXXXXXXXXXXKSD-------------G 512
                    +  LN  K+++ LSP      S +           ++D              
Sbjct: 966  HRHHHRSELGELNVSKINRSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDIDELREMK 1025

Query: 513  KNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNID 572
            +   ++K++KL T+K LNFI++P  L+IHLSRFYY+ TKKN+ ++TYPLILNI++K+N +
Sbjct: 1026 EEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSN-E 1084

Query: 573  VVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
            VVKYKLYG++NH G L  GHYTSIV+K L+HSL+ N   WY FDDEV+K+   +  +   
Sbjct: 1085 VVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHG 1144

Query: 633  ESFNIEKDEFDSSKVYVLFYERI 655
                    +  SS VYVLFYERI
Sbjct: 1145 VM------KISSSDVYVLFYERI 1161

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 75/137 (54%), Gaps = 7/137 (5%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTS--HKSRKRQATLAF 85
           D+L   V  ++  DI     +LRL+R              +++Y S   K +   A  +F
Sbjct: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWL---YELYLSCLGKDQNMDALGSF 76

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQ--D 143
           +NG FY++L++P  +QF T+N+  T Y D++  YE Q++M N+L  VKE+   +LE   D
Sbjct: 77  INGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQWD 136

Query: 144 LSGINRRILKKRAYTEP 160
            + +N RI + RAY+ P
Sbjct: 137 SASLNERIPRNRAYSVP 153

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  380 bits (976), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 286/454 (62%), Gaps = 37/454 (8%)

Query: 218 KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK 277
           K   +P+I+ +DN+   LS+ GLRN  NTCYINSMVQCLF T + RDLF+++  YK F++
Sbjct: 276 KTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKK-YKLFLE 334

Query: 278 KDAETK---ISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334
            +   K   +S     L   MY NGG ++IP  FL+    LRPDLNIP DQQDTQEFL+I
Sbjct: 335 NEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMI 394

Query: 335 LLDILHDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388
           +L  +H+EL       Y  DLI N+  +  +N  K Y  W +  + ++G SPID IFQGQ
Sbjct: 395 ILARIHEELSNNNVTKYYSDLILNDATALQVNPSK-YQKWCEETVLSDGLSPIDHIFQGQ 453

Query: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAK---ENSKNRVKLEDCINFFTSDEILTGE 445
           +EN L+CQRCGN+SY+YS FY+LSLAIPK +     +   ++KLEDCINFFTSDE L+ +
Sbjct: 454 MENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDD 513

Query: 446 NAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXX 505
           NAW+CPKC   T E   + D   + + R    SI     F LH      S          
Sbjct: 514 NAWDCPKC--RTAEYKLKKDENLSQKKR----SI----LFNLHSRPRSKSPRHRHHHHHH 563

Query: 506 XXXKSDGKNKN-------KYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVIT 558
                D K  +       K+K++KL T+K L+FI LPPILVIHLSRFYY+ TKKNN VIT
Sbjct: 564 RHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVIT 623

Query: 559 YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
           YPLILNII+KNN  VV+YKLY  +NH G L  GHYTS+VNK+ +H + LN Q W  FDD+
Sbjct: 624 YPLILNIILKNN-KVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDD 682

Query: 619 VIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFY 652
           VIK+ + +     ++ F   + E  S++VYVLFY
Sbjct: 683 VIKQHHKD-----RDDFETGRTEISSNEVYVLFY 711

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 8/134 (5%)

Query: 32  SLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTS--HKSRKRQATLAFVNGS 89
           SLV  ++  DIK  Y++    R              F VY      ++K+ A  AF+ G 
Sbjct: 10  SLVREVYDVDIKCVYSQ---LRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVGG 66

Query: 90  FYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSG--- 146
           FYL+L+IP+ +QFQT+N +++ Y  LK  Y+ +  M  +L  VK++S  I++Q LS    
Sbjct: 67  FYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSKR 126

Query: 147 INRRILKKRAYTEP 160
           I+R + +KRAY+ P
Sbjct: 127 ISRSMKRKRAYSLP 140

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score =  380 bits (975), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/451 (46%), Positives = 286/451 (63%), Gaps = 32/451 (7%)

Query: 218 KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI- 276
           K + +P+I+ ++++   LS+ GL+N  NTCYINS++QCLFGT + RDLF+++  Y+ F+ 
Sbjct: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK-YRLFLN 336

Query: 277 --KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334
             K   E ++S     L   MY NGG ++IP  FL+    LRPDLNIP DQQDTQEFL+I
Sbjct: 337 TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLI 396

Query: 335 LLDILHDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388
           +L  +H+EL       Y  DL+S +  +  +N  K Y  W + N+  +G SPID I++GQ
Sbjct: 397 VLARIHEELSNENVVKYYPDLVSYDANALQVNPSK-YEKWYERNVITDGLSPIDHIYRGQ 455

Query: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIPKIA--KENSKNR-VKLEDCINFFTSDEILTGE 445
           +EN L+CQRCGN+SY+YS FY+LSLAIPK++     SK+R +KLEDCIN FT DE L+G+
Sbjct: 456 LENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515

Query: 446 NAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXX 505
           NAW+CP C  T     D       + ++ K  +I    F    +  SP            
Sbjct: 516 NAWDCPNCRIT-----DSKSKKEEITSQKKKSTI--FGFHSRSRSKSPHH-----HHHHH 563

Query: 506 XXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI 565
                  KN  K  ++KL T+K L+FI LPPILVIHLSRFYY+ TKKN+ VITYPLILNI
Sbjct: 564 HSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI 623

Query: 566 IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
           I+KN   V++YKLYG +NH G L  GHYTS+VNK+ +H + LN Q W  FDD+ I++   
Sbjct: 624 ILKNG-KVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRK 682

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
           +     + +F   K E  S +VYVLFYER++
Sbjct: 683 D-----RNNFEAGKTEMSSDEVYVLFYERMD 708

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 81/138 (58%), Gaps = 8/138 (5%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTS--HKSRKRQATLAF 85
           D + +LV  +++ DIK +Y++LRL+               F VY      +++ +A  AF
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHL---FNVYLRDLEINQEMEALTAF 62

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS 145
           + G +YL+LIIP  +QFQT+N L++ Y  LK DY+ +  M  +L  V+++S  I+++ L+
Sbjct: 63  IIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLA 122

Query: 146 ---GINRRILKKRAYTEP 160
              GI R I +KRAY+ P
Sbjct: 123 ESNGICRTIKRKRAYSLP 140

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  369 bits (946), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/415 (48%), Positives = 264/415 (63%), Gaps = 25/415 (6%)

Query: 252 MVQCLFGTKVLRDLFISEXXYKDFIKK--DAETKISEPFARLLLTMYENGGTSVIPKNFL 309
           MVQCLFGTK+LRDLFIS   Y+ ++ K  D  + +S  F+ L   MY NGG SV+P +FL
Sbjct: 1   MVQCLFGTKLLRDLFISSK-YEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 310 QQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD-------DLISNNYVSDDINLG 362
           +  + LRPDL IP DQQDTQEFL+++LD LHDEL   +       DL+  +     +N  
Sbjct: 60  KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVN-N 118

Query: 363 KEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE- 421
           KEY  W    + ANG SPID IFQGQIEN L CQRCG  SYNYS FY+LSLAIPK +   
Sbjct: 119 KEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGT 178

Query: 422 -NSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSIN 480
            +   RVKLEDCIN FT+DE+L+GENAW+C  C  +++   ++     T     K +S  
Sbjct: 179 FSRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRK 238

Query: 481 PLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVI 540
              F     +L   +G             S      K K++KL+T+K +NFI LPP LVI
Sbjct: 239 SRLF-----LLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVI 293

Query: 541 HLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKD 600
           HLSRFYY+ +KKN  ++TYPLILNI++ NN +  KY+LYG++NH G L  GHYT++VNK+
Sbjct: 294 HLSRFYYDLSKKNETIVTYPLILNIVLNNN-ETAKYRLYGIVNHTGNLISGHYTTLVNKE 352

Query: 601 LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
            NH L  ++Q+WY FDDEV+K+ N++  I++         +  SS+VYVLFYER+
Sbjct: 353 KNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVI------KVSSSQVYVLFYERV 401

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  383 bits (984), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/465 (47%), Positives = 286/465 (61%), Gaps = 41/465 (8%)

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISE 269
           VL       + T+P I+ + N    LS+ GLRN GNTCYINSM+QCLF T+  RDLF+S 
Sbjct: 528 VLQNKMHHAEGTIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSP 587

Query: 270 XXYKDFIKKDAET--KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQD 327
             Y+D+  K      ++S+ F  L   MY NGG SV+P  FL+  + LRPDL IP +QQD
Sbjct: 588 K-YEDYFSKRYSNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQD 646

Query: 328 TQEFLVILLDILHDELVYTDDLISNNY----VSDDINLG---KEYMPWLQNNLKANGKSP 380
           TQEFL+ LL  LHDEL  ++  ++N+Y    + DD +L    KEY  W ++N+  NG SP
Sbjct: 647 TQEFLLFLLSQLHDELSESNH-VANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISP 705

Query: 381 IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPK-IAKENSKNRVKLEDCINFFTSD 439
           ID IFQGQ+EN L CQRCG++SYNYSMFY+LSLAIP  ++    K +++LEDCIN FTSD
Sbjct: 706 IDAIFQGQMENGLLCQRCGHSSYNYSMFYVLSLAIPASMSSFGQKKKMRLEDCINLFTSD 765

Query: 440 EILTGENAWNCPKCCPTTIETYDEADSP-----ATVEN---RVKNKSINPLNFFKLHKVL 491
           E LT ENAW+CPKC         + D       +T +N   R +++      FFKL    
Sbjct: 766 EKLTNENAWDCPKCGSAVSGNGPDGDKKKRKFLSTSDNSNGRSRSR------FFKL---- 815

Query: 492 SPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTK 551
              S +            S      K+K++KL T+K LNF+ LP +L IHLSRF Y+ T 
Sbjct: 816 --RSKSRSRSVSPFHKPSSQSPASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTN 873

Query: 552 KNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQ 611
           KNN VITYPL L+I++KNN +VV Y+LY + NH G L  GHYTS+VNKDL+H L    Q+
Sbjct: 874 KNNKVITYPLTLSIVLKNN-EVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQK 932

Query: 612 WYNFDDEVIKK-LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           WY FDDEV K+ LN  N      S +       SS VYVLFYE+I
Sbjct: 933 WYYFDDEVAKRDLNHGNIDAGITSVS-------SSDVYVLFYEKI 970

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%), Gaps = 7/135 (5%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATL--AF 85
           ++L   V  ++  DI  YY +LRLE+              F+ Y      K+ + L  AF
Sbjct: 11  NELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYL---FESYRRSLEAKQNSELLTAF 67

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS 145
           V G FY++LIIP+ +QF +++K +  Y DL+  Y+ + +M N+L  V     S+   +L 
Sbjct: 68  VVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESVSRDELE 127

Query: 146 GINRRILKKRAYTEP 160
               +I++KRAY+ P
Sbjct: 128 SA--KIMRKRAYSVP 140

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  382 bits (980), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/467 (47%), Positives = 284/467 (60%), Gaps = 40/467 (8%)

Query: 216 EIKKHTVPIIDATDNIPK---------------MLSLVGLRNQGNTCYINSMVQCLFGTK 260
           EI+KH+VP +    N  K                LS+ GLRN G TCY+NSM+QCLF TK
Sbjct: 519 EIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATK 578

Query: 261 VLRDLFISEXXYKDFIKKDAE-TKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDL 319
             RDLF+S      F +K     ++S+ F  L   MY NGG SV+P  FL+  + LRPD 
Sbjct: 579 AFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDF 638

Query: 320 NIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY----VSDDINLG---KEYMPWLQNN 372
            IP DQQDTQEFL+ LL  LHDEL  ++  ++N+Y    + DD  L    KEY  W + +
Sbjct: 639 RIPHDQQDTQEFLLFLLSQLHDELSESNR-VANDYPGLLLHDDKKLDVDQKEYDTWFEKH 697

Query: 373 LKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENS-KNRVKLED 431
           +  NG SPID IFQGQ+EN L CQRCG++S+NYS+FY+LSLAIP      S + +V+LED
Sbjct: 698 ISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLED 757

Query: 432 CINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPAT--VENRVKNKSINPLNFFKLHK 489
           CIN FTSDE LT ENAW+CPKC  +   T  E +      + N     S N   FFKL  
Sbjct: 758 CINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRFFKL-- 815

Query: 490 VLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS 549
                S +            S  +N  K K++KL T+K LNFI LP +L IHLSRF+Y+ 
Sbjct: 816 ----RSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDL 871

Query: 550 TKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNE 609
           TKKNN VITYPLIL+I++KN   ++KY+LY + NH G L  GHYTS+VNKDL+H L+  +
Sbjct: 872 TKKNNKVITYPLILSIVLKNE-QIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGK 930

Query: 610 QQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
           Q+WY FDDE +KK  ++  I+   +         SS VYVLFYE+I+
Sbjct: 931 QKWYYFDDETVKKDINHGDIDAGIT------SISSSDVYVLFYEKID 971

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 87/175 (49%), Gaps = 14/175 (8%)

Query: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQ 80
           ++S    ++L   V  ++  DI  Y+ KLRLE+              ++    H     Q
Sbjct: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYR----HALAANQ 59

Query: 81  AT---LAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSV 137
           A     AFV G FY++LIIP+ +QFQ+++K +  Y DLK  Y+ + +M N+L  V E   
Sbjct: 60  AEDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIE 119

Query: 138 SILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRT 192
           S+ + ++     RI++KRAY+ P  +S +     +   LS+  + +  P  P  T
Sbjct: 120 SMSKDEVE--TARIMRKRAYSVPYGKSPV-----TIQALSKANSATVEPDAPTET 167

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  382 bits (981), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/471 (45%), Positives = 292/471 (61%), Gaps = 49/471 (10%)

Query: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK 277
            +K ++P I+   N     S+ GLRN GNTCYIN M+Q LF T  L++LFIS   Y+++  
Sbjct: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS-GKYREYQM 686

Query: 278  K---DAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334
            K   + E+ IS  FA L   MY NGG +V+P  FL+  + LRPDL IP DQQDTQEFL+ 
Sbjct: 687  KPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLF 746

Query: 335  LLDILHDELVYTDDLISNN-----YVSDDINLGKE-YMPWLQNNLKANGKSPIDLIFQGQ 388
            +L+ LHDEL    ++I++      Y  D + + KE Y  W    + ANG SP+D +FQGQ
Sbjct: 747  ILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806

Query: 389  IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKEN--SKNRVKLEDCINFFTSDEILTGEN 446
            +EN LQCQRCG  S NYS FY+LSLA+PK +        RVKLEDCIN FTSDE+LTGEN
Sbjct: 807  MENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGEN 866

Query: 447  AWNCPKCCPTTIE------TYDEADSPATVENRVKNKSINPLNFFKL--HKVLSPSSGNX 498
            AW+CPKC    +E      T  +   P +  +  K+K      FF L   K +S S    
Sbjct: 867  AWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSK------FFGLPTGKAISRSKS-- 918

Query: 499  XXXXXXXXXXKSDGKNK-------------NKYKNEKLITLKQLNFIKLPPILVIHLSRF 545
                      K +GK +             +K K++KL+T+K +NFI LP +L+IHLSRF
Sbjct: 919  -PFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRF 977

Query: 546  YYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSL 605
            YY+ TKKN+AV++YPL+LNI++KN  ++V+YKLY ++NH G L  GHYTS+VNKD +H+L
Sbjct: 978  YYDLTKKNDAVVSYPLVLNIVLKNE-EIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNL 1036

Query: 606  DLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
               EQ+WY FDDEV+K   ++  ++K  +      +  S  VYVLFYER++
Sbjct: 1037 GNTEQKWYYFDDEVVKAEKTHGNVDKGIT------KVSSKNVYVLFYERVD 1081

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 43/63 (68%)

Query: 80  QATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSI 139
           +A   F+ G FY++L++P  +QFQT++K ++ Y +L+  YE Q++M N++  VKE+   I
Sbjct: 60  KAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119

Query: 140 LEQ 142
            EQ
Sbjct: 120 QEQ 122

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  372 bits (954), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/455 (47%), Positives = 289/455 (63%), Gaps = 38/455 (8%)

Query: 222  VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAE 281
            VP I+   N    LS+ GLRN GNTCYI+SM+QCLF T  LRDLFI+   Y+ +I     
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFIT-TKYESYINHKVT 667

Query: 282  TKI--SEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDIL 339
             KI  S  F+ L   MY NGG SV+P +FL+  + LRPDL IP DQQDTQEFL+++LD L
Sbjct: 668  DKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRL 727

Query: 340  HDELVYTDDLISNN-----YVSDDINLG-KEYMPWLQNNLKANGKSPIDLIFQGQIENCL 393
            HDEL   D ++++      Y ++ +++   +Y  W +N+  + G SPID IFQGQIEN +
Sbjct: 728  HDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSI 787

Query: 394  QCQRCGNTSYNYSMFYMLSLAIPKIA--KENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
             CQRCG +S+NYS FY+LSLAIPKI+    +  NRVKLEDCIN FT DE+L+GENAW+C 
Sbjct: 788  NCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCS 847

Query: 452  KCCPTT---IET-----YDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXX 503
            +C   +   ++T     + E  S  T +++   KS      F L K  +P+S +      
Sbjct: 848  RCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKS----RLFLLPKKYNPTSRSLSPFGR 903

Query: 504  XXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLIL 563
                  S+         +K+ T+K LNFIK+P ILVIHLSRF+Y+ +KKN  V+ YPLIL
Sbjct: 904  HSSHKSSEKWKS-----KKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLIL 958

Query: 564  NIIMKNNIDVVKYKLYGLINHQGG-LTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIK- 621
            NI++KN  +V KY+LY ++NH G  +  GHYT++VNK+ NH L  NEQQWY FDDEV+K 
Sbjct: 959  NIVLKNE-EVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKH 1017

Query: 622  KLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
            +LN  N     E  N    +  SS VYVLFYE+I+
Sbjct: 1018 ELNHGNI---DEGVN----KVSSSHVYVLFYEKID 1045

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 75/137 (54%), Gaps = 4/137 (2%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVN 87
           ++L   V   + ++IK ++ +LRL +              + +   H+ +  +   A++ 
Sbjct: 13  NELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESY-LDLLHEQKYDECLSAYIV 71

Query: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQ---DL 144
           G FYL+LIIP   QFQ +NK F  Y +LKI Y+ Q +M N+L  VK +  SIL++   +L
Sbjct: 72  GCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDESILEL 131

Query: 145 SGINRRILKKRAYTEPS 161
            GI + I + RAY+ P+
Sbjct: 132 EGIEKVIKRDRAYSSPA 148

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  374 bits (959), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/465 (45%), Positives = 279/465 (60%), Gaps = 59/465 (12%)

Query: 217  IKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI 276
            I   ++P I+ + N    LS+ GLRN  NTCYINSM+QCLF T   R+LF+S   Y  ++
Sbjct: 1084 IPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK-YAHYL 1142

Query: 277  KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILL 336
            K      +S  F  L   MY NGG SV+P  FL+  + L+PDL IP  QQDTQEFL+ LL
Sbjct: 1143 KSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLL 1202

Query: 337  DILHDELVYTDDLISNNY----VSDDINL---GKEYMPWLQNNLKANGKSPIDLIFQGQI 389
            D LHDEL   +  +SN+Y    + D++ L     +Y  W   N+  NG SPID +FQGQ+
Sbjct: 1203 DKLHDELSSIES-VSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261

Query: 390  ENCLQCQRCGNTSYNYSMFYMLSLAIPK-IAKENSKNR-VKLEDCINFFTSDEILTGENA 447
            EN L CQRCG +SY YS FY+LSLA+P  +AK   K + ++LEDCINFFT DE+L+ +NA
Sbjct: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNA 1321

Query: 448  WNCPKCC-PTTIETYDEADSPATVENRVKNKSINPLN--------FFKL-HKVLSPSSGN 497
            W+CP+CC P+   +YD          R  + S   LN         FK  +K+ S S   
Sbjct: 1322 WDCPRCCSPSDYMSYDHKG------KRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEA- 1374

Query: 498  XXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVI 557
                       K   K  +K  N K  T+K LNFI +P ILVIHLSRF Y+ TKKNN V+
Sbjct: 1375 ----------PKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVV 1424

Query: 558  TYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
            +YPLILNI++KN+ +V K++LY ++NH G L  GHYTS+VNK+LNH +   +Q+WY FDD
Sbjct: 1425 SYPLILNIVLKNS-EVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483

Query: 618  EVIKKLNSNNTINKKESFNIEKDEFD-------SSKVYVLFYERI 655
            E++K             F+    ++D       SS VYVLFYERI
Sbjct: 1484 EIVK-------------FDTNHGDYDNGIASVSSSNVYVLFYERI 1515

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 78/159 (49%), Gaps = 15/159 (9%)

Query: 29  DLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVNG 88
           +L   V+ ++  +++D Y KLRLE+              ++     + +      A+V G
Sbjct: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLG-RGQVEAGITAYVVG 70

Query: 89  SFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGIN 148
           +FYL+LIIP  ++F T+N  ++ Y DLK  YE   +M N++  V  K  S+++  LSG  
Sbjct: 71  AFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEG 130

Query: 149 ------RRILKKRAYTEPSIRSG--------LSRDRSST 173
                 R   +KRAY+  S  S         LS +RSST
Sbjct: 131 DEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSST 169

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  354 bits (909), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/496 (42%), Positives = 287/496 (57%), Gaps = 66/496 (13%)

Query: 215  AEIKKH-TVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYK 273
              I +H ++PI++ ++N    LS+ GLRN GNTCYINSM+QCLF T   R++F+S   Y+
Sbjct: 729  GAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHK-YE 787

Query: 274  DFIKKDAET--KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEF 331
             ++  D  T  ++S+ F  L   MY NGG SV+P  FL+  ++LRPDL IP DQQDTQEF
Sbjct: 788  KYMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEF 847

Query: 332  LVILLDILHDEL-----VYTD--DLISNNYVSDDINLGK-EYMPWLQNNLKANGKSPIDL 383
            L+++LD LHDEL     V  D  DL+  +Y  DD+ +   +Y+ W   ++K+NG SPID 
Sbjct: 848  LMLILDRLHDELSNQHEVKLDYPDLV--DYDVDDMEVQPGQYIKWYNESVKSNGLSPIDH 905

Query: 384  IFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEI 441
            +FQGQ E+ L CQRCG +S+ YS FY+LSLAIPK +        RV LEDCI  FT+DEI
Sbjct: 906  VFQGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEI 965

Query: 442  LTGENAWNC-------PKCCPTTIETYDEADSPATVEN---------------------R 473
            L+ ENAW+C       PK  P  I  + E      +                       R
Sbjct: 966  LSDENAWDCPRCGSAAPKQEP--IHRHREKKHIHDISPPPRSPSSPEPRSKRFFLLNAPR 1023

Query: 474  VKNKSINPLNFFK--LHKVLSPSSGNXXXXXXXXXXXKSDGKNKN-----------KYKN 520
               +S +PL       H    P                 D +N+N           ++ +
Sbjct: 1024 EVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQNHTTPNGRAGRVRHYS 1083

Query: 521  EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYG 580
             K++T+K +NF+K P ILVIHLSRFYY+ TKKNN VITYPL LNI +KN  +V +YKLYG
Sbjct: 1084 GKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNG-EVARYKLYG 1142

Query: 581  LINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKD 640
            L+NH G L  GHYTS+VNKD +H L   +Q+W+ FDDE++K+  ++  I    +      
Sbjct: 1143 LVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVT------ 1196

Query: 641  EFDSSKVYVLFYERIE 656
               SS VYVLFY+RI+
Sbjct: 1197 SISSSHVYVLFYQRIK 1212

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 85/183 (46%), Gaps = 32/183 (17%)

Query: 28  DDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTS--HKSRKRQATLAF 85
           D+L   V  I+ ++ K +Y +L+LE+              F+ YT     S    A  AF
Sbjct: 16  DELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFL---FETYTKSLRDSHFDDALSAF 72

Query: 86  VNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLS 145
           + GSFY++ IIP   QF TKN+ +  Y +LK  YE +++M N+L  VK +   IL+ +  
Sbjct: 73  IVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDSNYK 132

Query: 146 GIN----------RRILKKRAYTEPSIRSGLS-----------------RDRSSTSVLSR 178
             N          + I ++RA++ P+  +  S                  + SST+VLS 
Sbjct: 133 SQNESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDNSMDTLNTSSTTVLSN 192

Query: 179 KPT 181
           K T
Sbjct: 193 KGT 195

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  349 bits (896), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 211/454 (46%), Positives = 272/454 (59%), Gaps = 33/454 (7%)

Query: 221  TVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA 280
            +VP I+   N    LS+ GLRN  NTCYINSM+QCLF T   R+LF+S   Y  ++K   
Sbjct: 729  SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNK-YSRYLKSSN 787

Query: 281  ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILH 340
               +S  F  L   MY NGG SV+P  FL+  S L+PDL IP  QQDTQEFL+ LLD L 
Sbjct: 788  MDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRLR 847

Query: 341  DELVYTDDLISNNY------------VSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388
            DEL Y   ++ N+Y            V+D     KEY  W   N + NG SPID IFQGQ
Sbjct: 848  DELSYLAAVV-NDYPQLLLHESSVLKVND-----KEYTTWFDQNFEKNGLSPIDSIFQGQ 901

Query: 389  IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTGEN 446
            IE+ L CQRC  +SY+YS FY+LSLA+P    +      +++LEDCINFFT DE+LTG+N
Sbjct: 902  IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQN 961

Query: 447  AWNCPKCCPTTIETYDEADSPATVENR--VKNKSINPLNFFKLHKVLSPSSGNXXXXXXX 504
             W+CPKC   +          +  +N+  + +++ N  N  + H       G+       
Sbjct: 962  PWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSS 1021

Query: 505  X---XXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPL 561
                   KS GK   K  N+KL T+K LNFI LP IL+IHLSRF Y+ TKKNN V+TYPL
Sbjct: 1022 SPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPL 1081

Query: 562  ILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIK 621
            ILNI++KNN +V KY+LY  INH G L  GHYTS+VNKDL H +   +Q+WY FDDE++ 
Sbjct: 1082 ILNIVLKNN-EVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIV- 1139

Query: 622  KLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
            KL+ N+      +++       SS VY+LFYERI
Sbjct: 1140 KLDPNHG-----NYDRGITSVSSSDVYLLFYERI 1168

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 80/153 (52%), Gaps = 7/153 (4%)

Query: 29  DLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVNG 88
           +L + V   ++  +++ Y +LR E+              ++     + + R+  +A+V G
Sbjct: 12  ELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLV-REGQTREGLMAYVIG 70

Query: 89  SFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL----EQDL 144
           +FYL+LIIP  ++F T+N  ++ Y DL+  YE + +M N++  V EK  ++L     +D 
Sbjct: 71  AFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDG 130

Query: 145 SGINRRILKKRAYTEPSIRSGLSRDRSSTSVLS 177
              + ++ +KRAY+ P    G++R   S   L+
Sbjct: 131 ERGDTKLYRKRAYSVP--EKGVARSSDSLQHLT 161

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  324 bits (830), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 225/669 (33%), Positives = 347/669 (51%), Gaps = 67/669 (10%)

Query: 16  LDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHK 75
           +  D +  + E+  L SLV  +F+  IK  Y  L L +               +     K
Sbjct: 1   MTADLVICNTEI--LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEK 58

Query: 76  SRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDY----EGQISMKNILDT 131
             +  + + +  G FY++L++P   QFQ ++  +  Y  LK +Y    EG ++ + +LD 
Sbjct: 59  LLE-SSYMNYAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLTFQYLLDR 117

Query: 132 VKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSV-LSRKPT----LSHVP 186
           V+EK                      T  ++    +R+  + SV LS+K      LS V 
Sbjct: 118 VREK--------------------CRTSQTLEMNKNRNSGNFSVKLSQKANSCCDLSTVE 157

Query: 187 SNPQRTLSTPKRSSTLMTESLSFVLARPAEI----KKHTVPIIDATDNIPKMLSLVGLRN 242
              Q T +    SS   ++S S +   P +I    K++T+PII       + LS+ G+RN
Sbjct: 158 DKSQNTSTDSSGSSLECSDSKSALAKSPIDIDHDSKQYTLPIIINAITEEQKLSVFGIRN 217

Query: 243 QGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAET-KISEPFARLLLTMYENGGT 301
            GNTCY+NSM+QCLFG+   RDLF+++       + ++E+  I+   + L   MY+NGG 
Sbjct: 218 MGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAETNSESLSIANDLSLLFKKMYQNGGC 277

Query: 302 SVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD------DLISNNYV 355
           ++IPK+F++    LRPD  IP  QQDTQEFL+ +L+ L  EL  T        LI++   
Sbjct: 278 AIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLERLRVELANTSATVKDRSLIASRSN 337

Query: 356 SDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAI 415
           +  +   K Y+ W    +  N  SPIDL+F+G +E+ L C+ C  ++  +S FY+LSL I
Sbjct: 338 NRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDVESKLICKHCNESASTFSSFYILSLNI 397

Query: 416 PKIAKE---NSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVEN 472
           PK        SK  ++LEDCIN FT  EILTGEN+W CP C   T   Y+  D+  T + 
Sbjct: 398 PKEKSSLFFKSKT-IRLEDCINLFTRKEILTGENSWACPSC--ETKARYNVIDNDKTYQQ 454

Query: 473 RVKN---KSINPLNFFKLHKVLSP-SSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQ 528
           +  N    S  P  F  +    +  +SG            +++ +++ + K+E +++   
Sbjct: 455 KHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKYDNLENEQRHRQQKKSETILS--- 511

Query: 529 LNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGL 588
           ++F+ LPPILVIHLSRF Y+ +KKN + I+YP+ L +   +N  V  Y+LYG INH G  
Sbjct: 512 VSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVT-YRLYGTINHIGSP 570

Query: 589 TKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF--NIEKDEFDSSK 646
             GHYT++VNK+ NH  DL  Q+W  FDD+++         N+ + F    E +   ++ 
Sbjct: 571 RGGHYTALVNKEKNHFTDLELQKWVEFDDDLV--------FNRTDFFKSKTEINSITNND 622

Query: 647 VYVLFYERI 655
            YVLFYERI
Sbjct: 623 AYVLFYERI 631

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  324 bits (831), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 194/459 (42%), Positives = 264/459 (57%), Gaps = 47/459 (10%)

Query: 213 RPAEI----KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           RP  I     K+ +P +  + N+   LS+ GLRN GNTCYINSM+QCLF T   R+LF+S
Sbjct: 417 RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476

Query: 269 EXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDT 328
              YK++I    +  +S  F  L   MY NGG +VIP  FL+  + LRPDL IP  QQDT
Sbjct: 477 NR-YKEYIGTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDT 535

Query: 329 QEFLVILLDILHDELVYTD--------DLISNNYVSDDINLGKEYMPWLQNNLKANGKSP 380
           QEFL++LLD LH+EL            DLI  +  S D+    EY  W   +L+  G S 
Sbjct: 536 QEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSL 595

Query: 381 IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDE 440
           I  IFQGQ+EN L+CQRC  TS NYS F  LSL+IP   +   +  V LEDCI+ F  +E
Sbjct: 596 IHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPN-KRRKFRKLVDLEDCISLFIENE 654

Query: 441 ILTGENAWNCPKCCPTTIETYDEADSPATVE-NRVKNKSINPLNFFKLHKVLSPSSGNXX 499
           +LTGENAWNCPKC  ++     +  S    + ++ KN+S N L F + +           
Sbjct: 655 MLTGENAWNCPKCSSSSNNNTSKRKSRGFFKFSKHKNRSHNDLTFSEYN----------- 703

Query: 500 XXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS-TKKNNAVIT 558
                     +   +  K+  +KL+T K  +FIKLP +L+IHLSRF  +    KNN  I 
Sbjct: 704 ---------HNSSSDDVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIA 754

Query: 559 YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
           YP IL I +KN  +  ++KLYG++NH G L  GHYTS++NK+ +H L+   Q+W+ FDDE
Sbjct: 755 YPAILTITLKNK-EKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDE 813

Query: 619 VIKKLNSNNTINKKESFNIEK--DEFDSSKVYVLFYERI 655
            +K+        +   F+++K  +   SS VYVLFYE+I
Sbjct: 814 TVKQ--------QFNYFDLDKNVNRISSSDVYVLFYEKI 844

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 84  AFVNGSFYLFLIIP--YCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE 141
           +F+ G FY+ L+IP  + +   + N     Y+DLK  YE Q ++ ++L  ++ +S +IL+
Sbjct: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (72%), Gaps = 7/133 (5%)

Query: 524  ITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLIN 583
             +++  NF+ LPP+LVIHLSRFYY+ TKKN  VITYPLILNI++KNN + +KY+LY ++N
Sbjct: 919  FSIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNN-ETLKYRLYAVVN 977

Query: 584  HQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFD 643
            H G L  GHYTS+VNK+ +H L+ N QQWY FDDEV+K   S+  +++        ++  
Sbjct: 978  HNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG------VNKVS 1031

Query: 644  SSKVYVLFYERIE 656
            S  VYVLFYERI+
Sbjct: 1032 SKDVYVLFYERID 1044

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 84/155 (54%), Gaps = 6/155 (3%)

Query: 29  DLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATL-AFVN 87
           +L  LV+ I++ DIK +Y  L+LE               F      K+R +Q  L A++ 
Sbjct: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFS--DEMKNRNKQDALTAYII 72

Query: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147
           G ++L+LIIP   QFQ +NK F  +  LK  YE Q++M N+L  VK++  S+L++D   +
Sbjct: 73  GCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFRKL 132

Query: 148 NRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTL 182
            + + +KRA++ P   +GL  + S  ++     TL
Sbjct: 133 -KDVERKRAFSSPD--NGLDSEISRLTLAGNGSTL 164

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 123/438 (28%), Positives = 184/438 (42%), Gaps = 96/438 (21%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QC+ GT  L  +F+ +   K      K  ++  +++ FARL+  
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 295 MYE-----NGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
           MY+     +   S+ P  F      +   L     QQD QEF   LLD LH++L      
Sbjct: 623 MYKKQVDSSKKDSISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSN 681

Query: 350 ISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNT 401
                +S +    +E +         W +  L  +    +DL FQGQ  + L+C+ C +T
Sbjct: 682 PPLKELSQEAETRRERLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASRLKCKTCNHT 739

Query: 402 SYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETY 461
           S  Y  F +LS+ IP   K+NS+N++ +EDC   FT  E L  +  W CP C        
Sbjct: 740 STTYQPFTVLSIPIP---KKNSQNKITIEDCFKEFTKCENLEIDEQWLCPHC-------- 788

Query: 462 DEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNE 521
            E   P+T +  +     N +   K    L                      NKN     
Sbjct: 789 -EKRQPSTKQLTITRLPRNLIIHLKRFDNL---------------------LNKNN---- 822

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN---IIMKNNIDVVKYKL 578
                   +F+K P   ++ L+ F+ N          +P  +N   + ++  I   KY+L
Sbjct: 823 --------DFVKYP--FLLDLTPFWANDFDG-----VFPPGVNDDELPIRGQIPPFKYEL 867

Query: 579 YGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL-NSNNTINKKESFNI 637
           YG+  H G L  GHYTS V K L+       + W  FDD   +   N  + IN       
Sbjct: 868 YGVACHFGTLYGGHYTSYVKKGLS-------RGWLYFDDTKYRPAKNQTDAIN------- 913

Query: 638 EKDEFDSSKVYVLFYERI 655
                  S  YVLFY R+
Sbjct: 914 -------SNAYVLFYHRV 924

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  118 bits (295), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 124/449 (27%), Positives = 177/449 (39%), Gaps = 119/449 (26%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD---AETKISEPFARLLLT 294
           VGL N GN+CYIN ++QC+F T  L  +F++    K   K+    ++  +S  FA+LL  
Sbjct: 525 VGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLSHNFAKLLKD 584

Query: 295 MYENGGTSVIPKNFLQ----QFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDELVYTD 347
           MYE   +  I K        QF +    +N + KD  QQD  EF   LLD LH++L    
Sbjct: 585 MYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDGLHEDL---- 640

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDL-------------IFQGQIENCLQ 394
           +    N    +++   E M   + NL     S I+              +FQGQ  + L+
Sbjct: 641 NQCGANPPLKELSPEAEKM---RENLSLRVASSIEWERYLTTDFSIIVDLFQGQYASQLR 697

Query: 395 CQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCC 454
           C+ C  TS  Y  F +LS+ +P      S     L DC   FT  E L  +  W CP C 
Sbjct: 698 CKVCNRTSTTYQAFSVLSVPVP------SGKSCGLLDCFIEFTKTENLEVDEQWFCPSC- 750

Query: 455 PTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKN 514
                             + K  S   L   +L + L                       
Sbjct: 751 ------------------KKKQPSTKKLTITRLPRNL----------------------- 769

Query: 515 KNKYKNEKLITLKQLN--------FIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII 566
                   +I LK+ +        F++ P IL   L+ F+ N +   +  +   +   I 
Sbjct: 770 --------IIHLKRFDNMMNKNNIFVRYPQIL--DLTPFWANDS---DGKLPPGITDEIP 816

Query: 567 MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSN 626
            +  +    Y+LYG   H G L  GHYTS V+K         E+ W  FDD V + +   
Sbjct: 817 ARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKG-------PEKGWIYFDDTVYRPVRFQ 869

Query: 627 NTINKKESFNIEKDEFDSSKVYVLFYERI 655
           N             EF S   YVLFY RI
Sbjct: 870 N-------------EFISPSAYVLFYHRI 885

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 119/437 (27%), Positives = 181/437 (41%), Gaps = 94/437 (21%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QC+ GT  L  +F+ +   K      K  ++  +++ FARL+  
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 295 MYE-----NGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
           MY+     +   S+ P  F      +   L     QQD QEF   LLD LH++L      
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 350 ISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNT 401
                +S +    +E +         W +  L  +    +DL FQGQ  + L+C+ CG+T
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASRLKCKICGHT 738

Query: 402 SYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETY 461
           S  Y  F +LS+ IP+   +   N + +EDC   FT  E L  +  W CP C        
Sbjct: 739 STTYQPFTVLSIPIPRKVPQ---NEITIEDCFKEFTKCENLEVDEQWLCPHC-------- 787

Query: 462 DEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNE 521
            +   P+T +  V     N +   K    L                      NKN     
Sbjct: 788 -KKRQPSTKQLTVTRLPRNLIIHLKRFDNL---------------------LNKNN---- 821

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN---IIMKNNIDVVKYKL 578
                   +F+K P   ++ L+ F+ N          +P  +N   + ++  I   KY+L
Sbjct: 822 --------DFVKYP--FLLDLTPFWANDFDG-----VFPPGVNDDELPVRGQIPPFKYEL 866

Query: 579 YGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
           YG+  H G L  GHYT+ V K L        + W  FDD   K + +             
Sbjct: 867 YGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPVKN------------- 906

Query: 639 KDEFDSSKVYVLFYERI 655
           K +  +S  YVLFY R+
Sbjct: 907 KTDVTNSNAYVLFYHRV 923

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score =  115 bits (289), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 112/416 (26%), Positives = 169/416 (40%), Gaps = 101/416 (24%)

Query: 238  VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
            VGL N GN+CY+N ++QCL     L  +F++    K      K  ++  +++ FARL+ +
Sbjct: 735  VGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGILAKSFARLVHS 794

Query: 295  MYENGGTS-----------VIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDEL 343
            MY+NG  S           V P  F      +   L    +QQD QEF   LLD LH++L
Sbjct: 795  MYQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SLFKGSNQQDCQEFCQFLLDGLHEDL 853

Query: 344  VYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQC 395
                       +S +    +E +         W +  L  +    IDL +QGQ  + L+C
Sbjct: 854  NQCGANPPLKELSTEAERMREKLSLRIASSIEW-ERFLTTDFSVIIDL-YQGQYASQLKC 911

Query: 396  QRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCP 455
            Q CG TS  Y  F +LS+ +PK         + L DC N FT  E L  +  W+C +C  
Sbjct: 912  QVCGTTSTTYQTFSVLSVPVPK------NKSIHLLDCFNEFTKTEFLGKDELWSCTEC-- 963

Query: 456  TTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNK 515
                             + K  S   L   +L K L                        
Sbjct: 964  -----------------KKKQPSTKTLTITRLPKNL------------------------ 982

Query: 516  NKYKNEKLITLKQLN--------FIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIM 567
                   +I LK+ +        F+K P  L++ L+ ++ N     +  +   +   +  
Sbjct: 983  -------IIHLKRFDNMLHKNNVFVKYP--LILDLTNYWANDF---DGKLPPGVTEELPA 1030

Query: 568  KNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
            +  I   KY+L G+  H G L  GHYT+ VNK L       +  WY FDD V + +
Sbjct: 1031 RGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVYRSI 1079

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  109 bits (272), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 182/460 (39%), Gaps = 139/460 (30%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CY+N ++QCL GT+ L  +F+ +  YK+ +    +  ++  +++ F++L+ 
Sbjct: 56  VGLVNLGNSCYMNCIIQCLLGTRELVQIFLDDS-YKNHVNLNSRLGSKGVLAKYFSQLIH 114

Query: 294 TMYENG-------GTSVIPKNFLQ--QFSLLRPDLNI---PKDQQDTQEFLVILLDILHD 341
            M +          TS   +N +Q   F +    +N       QQD QEF   LLD LH+
Sbjct: 115 NMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKTTSQQDCQEFCQFLLDGLHE 174

Query: 342 ELVYTDDLISNNYVSDDINLGKEYM--------PWLQNNLKANGKSPIDLIFQGQIENCL 393
           +L       +   +S++    +E +         W +  L  +    +DL FQGQ  + L
Sbjct: 175 DLNQCGGNPALKELSEEAEAIREKLCMRIASSIEW-ERYLTTDFSVIVDL-FQGQYASQL 232

Query: 394 QCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            C+ CG TS  Y  F +LS+ +P+ A      R  L DC   F                 
Sbjct: 233 MCKVCGRTSTTYQPFSVLSVPVPRGA------RCNLLDCFEEF----------------- 269

Query: 454 CPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGK 513
             T IET ++ +  +    +VK  S                                   
Sbjct: 270 --TKIETLEKDEQWSCPRCKVKQPST---------------------------------- 293

Query: 514 NKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI--IMKNNI 571
                        K++   +LP  L+IHL RF  N   KNN  ++YP  L++     N+ 
Sbjct: 294 -------------KKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDF 339

Query: 572 DV-----------------VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYN 614
           D                    Y LY +  H G L  GHYT+ VNK+       ++  W  
Sbjct: 340 DGSLPKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCY 392

Query: 615 FDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
           FDD   +K  S             +DE  ++  YVLFY R
Sbjct: 393 FDDTCWRKAKS-------------EDECITTSAYVLFYHR 419

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 92/321 (28%), Positives = 151/321 (47%), Gaps = 41/321 (12%)

Query: 160 PSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKK 219
           PS  + LS   ++TS+++ K ++   P     T S P+  +      +S  LA P   K 
Sbjct: 533 PSFPTVLSSG-ATTSLINGKDSIPKPP-----TQSLPRLPALPTKPVISSNLASPPHSKS 586

Query: 220 HTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---I 276
           +         +  K+  +VGL N GN+CY+N ++QC+ GT  L  +F++    K      
Sbjct: 587 NNGRSAQVYTDALKLDFIVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSS 646

Query: 277 KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRP-----------DLNIPKDQ 325
           +  ++  +++ FARL+ TMY +   S I K+  ++   ++P            L     Q
Sbjct: 647 RLGSKGVLAKNFARLIHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQ 706

Query: 326 QDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDL-- 383
           QD+QEF   LLD LH++L    +    N    +++L  E    L+ NL     S I+   
Sbjct: 707 QDSQEFCQFLLDGLHEDL----NQCGGNPPLKELSLEAER---LRENLSLRIASSIEWER 759

Query: 384 -----------IFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDC 432
                      +FQGQ  + L+C+ C +TS  Y  F +LS+ +PK     ++ ++ L DC
Sbjct: 760 YLTTDFSVIVDLFQGQYASRLECKVCHHTSTTYQSFSVLSVPLPKKFDPQTR-KIDLIDC 818

Query: 433 INFFTSDEILTGENAWNCPKC 453
            N FT  E L  +  W+CP C
Sbjct: 819 FNEFTKIENLEVDEQWSCPTC 839

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 67/155 (43%), Gaps = 41/155 (26%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------- 566
           +K  + K+L   +LP  L+IHL RF  N   KNN+ I YP  L++               
Sbjct: 841 KKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPG 899

Query: 567 ------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
                  +  I    Y+LYG+  H G L  GHYT+ V+K + +        WY FDD   
Sbjct: 900 VSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTTY 952

Query: 621 KKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           + L      N KE          SS  YVLFY R+
Sbjct: 953 RPLK-----NDKEPI--------SSSAYVLFYTRV 974

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 114/232 (49%), Gaps = 22/232 (9%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QC+ GT  L  +F+ +   K      K  ++  +++ FARL+  
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 295 MYE-----NGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
           MY+     +   S+ P  F      +   L     QQD QEF   LLD LH++L      
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSN 683

Query: 350 ISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNT 401
                +S +    +E +         W +  L  +    +DL FQGQ  + L+C+ C +T
Sbjct: 684 PPLKELSQEAEARREKLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASRLRCKVCNHT 741

Query: 402 SYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           S  Y  F +LS+ IPK   +NS+N++ +EDC   FT  E L  E  W CP C
Sbjct: 742 STTYQPFTVLSIPIPK---KNSQNKITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 65/151 (43%), Gaps = 44/151 (29%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------------- 566
           KQL   +LP  L++HL RF  N   KNN  + YP +L++                     
Sbjct: 798 KQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDDEL 856

Query: 567 -MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL-N 624
            ++  I   KY+LYG+  H G L  GHYT+ V K L       ++ W  FDD   K + N
Sbjct: 857 PIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPVKN 909

Query: 625 SNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
             + IN              S  YVLFY R+
Sbjct: 910 QTDAIN--------------SNAYVLFYHRV 926

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 113/235 (48%), Gaps = 29/235 (12%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CYIN +VQCL GT  L ++F+++  Y+  I    +  ++  +++ FA+L  
Sbjct: 463 VGLENMGNSCYINCIVQCLLGTHELTNIFLNK-SYERHINMNSRLGSKGVLAKYFAKLTH 521

Query: 294 TMYENG-------GTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYT 346
           +MY+N        G  V P  F      +   L     QQD QEF   LLD LH++L   
Sbjct: 522 SMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRESGQQDCQEFCQFLLDGLHEDLNQC 580

Query: 347 DDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
                   +SD+    +E +         W +  L  +    +DL FQGQ  + L+CQ C
Sbjct: 581 GGNPPLKELSDEAEKMREKLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASQLRCQVC 638

Query: 399 GNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           G TS  Y  F +LS+ +P     N      + DC   FT  E L  +  W+CP+C
Sbjct: 639 GLTSTTYQPFSVLSVPVPHAKSCN------IIDCFKEFTKVEKLETDEQWSCPRC 687

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 65/155 (41%), Gaps = 41/155 (26%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII--MKNNID------ 572
           +K  + K+L   +LP  L+IHL RF  N   KNN  + YP  L++     N+ D      
Sbjct: 689 KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPG 747

Query: 573 ------------VVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
                          YKLYG+ +H G L  GHYTS V+K         ++ W  FDD   
Sbjct: 748 VTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDDTSF 800

Query: 621 KKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           + + +               E  +   YVLFY R+
Sbjct: 801 RPVRNAT-------------ECITPNAYVLFYHRV 822

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 110/233 (47%), Gaps = 24/233 (10%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QC+ GT  L  +F++    K      K  ++  ++  FARL   
Sbjct: 583 VGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHI 642

Query: 295 MY------ENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDD 348
           M+      E     V P  F    + +   +    +QQD QEF   LLD LH++L    +
Sbjct: 643 MHQTSYDQEKKAAIVRPTQFRMAIASIN-SMFRNTNQQDCQEFCQFLLDGLHEDLNQCGN 701

Query: 349 LISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGN 400
                 +S++    +E +         W +  L  N    IDL FQGQ  + L+C  C N
Sbjct: 702 NPPLKELSEEAEKKRELLSLRIASSIEW-ERFLTTNFSVIIDL-FQGQYASRLKCSVCSN 759

Query: 401 TSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           TS  Y  F +LS+ +P      +K+ V L DC N FT  E L  +  WNCP C
Sbjct: 760 TSTTYQPFSVLSVPLPT----GTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTC 808

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 69/157 (43%), Gaps = 42/157 (26%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------- 566
           +K  + KQL   +LP  L+IHL RF  N   KN  +I YP  L++               
Sbjct: 810 KKQPSTKQLTITRLPRNLIIHLKRFD-NRMNKNTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 567 -------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEV 619
                   +  I   KY LY + NH G L  GHYTS VNK L+       + WY FDD+ 
Sbjct: 869 VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQ- 920

Query: 620 IKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
                 N  + KK S      E  +S  YVLFY R+ 
Sbjct: 921 ------NYRLVKKTS------EVVNSNAYVLFYRRVH 945

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 116/232 (50%), Gaps = 22/232 (9%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QC+ GT  L  +F+ +   K      K  ++  +++ FARL+  
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 295 MYEN--GGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDL 349
           MY+    G+  I  + + +F L    +N       QQD QEF   LLD LH++L      
Sbjct: 622 MYKEQVDGSKKISISPI-KFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 350 ISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNT 401
                +S +    +E +         W +  L  +    +DL FQGQ  + L+C+ C +T
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASRLKCKVCSHT 738

Query: 402 SYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           S  Y  F +LS+ IP   K+NS+N + +EDC   FT  E L  +  W CP C
Sbjct: 739 STTYQPFTVLSIPIP---KKNSRNNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 42/150 (28%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------------- 566
           KQL   +LP  L++HL RF  N   KNN  + YP +L++                     
Sbjct: 795 KQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDDEL 853

Query: 567 -MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
            ++  I   KY+LYG+  H G L  GHYT+ V K L       ++ W  FDD   K +  
Sbjct: 854 PIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPVK- 905

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFYERI 655
               NK ++ N        S  YVLFY R+
Sbjct: 906 ----NKADAIN--------SNAYVLFYHRV 923

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  102 bits (255), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 118/241 (48%), Gaps = 38/241 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CY++ ++QCL GT+ L  +F++   Y++ I    +  ++  ++  F++L+ 
Sbjct: 488 VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNN-SYQNHINLNSRLGSKGLLARYFSQLIH 546

Query: 294 TMYENG----------GTSVIPKNFLQQFSLLRPDLNIP-KD--QQDTQEFLVILLDILH 340
            MY+ G           T+VIP     QF +    +N   KD  QQD QEF   LLD LH
Sbjct: 547 QMYQYGKDIRKKMGNEKTAVIPT----QFKIACGSINSSFKDNTQQDCQEFCQFLLDGLH 602

Query: 341 DELVYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENC 392
           ++L    +      +S++    +E MP        W +  L  +    +DL FQGQ  + 
Sbjct: 603 EDLNQCGNNPPLKELSEEAEKMREMMPMRLASAIEW-ERYLTTDFSVIVDL-FQGQYASQ 660

Query: 393 LQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPK 452
           LQC+ C  TS  Y  F +LS+ +P      S     L DC   FT  E L  E  W+CP 
Sbjct: 661 LQCKVCQRTSTTYQPFSVLSVPVP------STRTCTLTDCFTEFTKIETLEQEEQWSCPS 714

Query: 453 C 453
           C
Sbjct: 715 C 715

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 56/118 (47%), Gaps = 27/118 (22%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI-----------IMKNNIDV-- 573
           K++   +LP  L+IHL RF  N   KNN  ++YP +L++           +  NN+++  
Sbjct: 723 KKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPS 781

Query: 574 ------VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
                   Y+LYG+  H G L  GHYT+ VNK            W  +DD   +++ S
Sbjct: 782 RGQVPPFNYQLYGIACHDGTLRAGHYTAYVNKGAVLG-------WCYYDDTNWRQIRS 832

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 117/234 (50%), Gaps = 26/234 (11%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           VGL N GN+CY+N ++QCL  T  L  +F++    K      K  ++  +++ FARL+ T
Sbjct: 519 VGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHT 578

Query: 295 MYENGG-TSVIPKN-FLQ--QFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDELVYTD 347
           MY  G     + KN  +Q  QF +    +N + KD  QQD+QEF   LLD LH++L    
Sbjct: 579 MYREGSFKRPLEKNKPIQPIQFKMACGSINSLFKDNTQQDSQEFCQFLLDGLHEDLNQCG 638

Query: 348 DLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCG 399
                  +S+D    +E +         W +  L  +    +DL FQGQ  + L+C+ CG
Sbjct: 639 ANPPLKELSEDAEKMREKLSMRIASSIEW-ERFLTTDFSVIVDL-FQGQYASQLKCKVCG 696

Query: 400 NTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            TS  Y  F +LS+ +P ++         + DC N FT  E L  +  W+CP C
Sbjct: 697 CTSTTYQTFSVLSVPVPHVSS------CHILDCFNEFTKVEKLGTDELWSCPTC 744

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 67/155 (43%), Gaps = 41/155 (26%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------- 566
           +K  + K+L   +LP  L+IHL RF  N   KNN  + YP +L++               
Sbjct: 746 KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 567 ------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
                  +  +   +YKL  + +H G L  GHYT+ VNK +N         W+ FDD   
Sbjct: 805 VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFDDTSY 857

Query: 621 KKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           + +       K E+      E  +   YVLFY R+
Sbjct: 858 RPI-------KNET------ECITPNAYVLFYHRV 879

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 38/241 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CY++ ++QCL GT+ L  +F++   Y++ I    +  ++  ++  F++L+ 
Sbjct: 486 VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNN-SYQNHINLNSRLGSKGVLARYFSQLIH 544

Query: 294 TMYENG----------GTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILH 340
            MY+ G           T+V+P     QF +    +N     + QQD QEF   LLD LH
Sbjct: 545 QMYQQGKDIRKTSGTEKTAVLPA----QFKIACGSINALFRDRSQQDCQEFCQFLLDGLH 600

Query: 341 DELVYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENC 392
           ++L    +      +S+     +E MP        W +  L  +    +DL FQGQ  + 
Sbjct: 601 EDLNQCGNNPPLKELSEKAEKMREMMPMRIASSIEW-ERYLTTDFSVIVDL-FQGQYASQ 658

Query: 393 LQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPK 452
           L+C+ CG TS  Y  F +LS+ +P      S  +  + DC   FT  E L  +  W+CP 
Sbjct: 659 LRCKVCGRTSTTYQPFSVLSVPVP------SSRQCTIIDCFTEFTKVETLDLDEQWSCPD 712

Query: 453 C 453
           C
Sbjct: 713 C 713

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 67/152 (44%), Gaps = 41/152 (26%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI-----------IMKNN--- 570
           + K++   +LP  L+IHL RF  N   KNN  ++Y  +LN+           +M NN   
Sbjct: 719 STKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVE 777

Query: 571 ------IDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLN 624
                 +    Y+LYG+  H G L  GHYT+ VNK            W  +DD   +++ 
Sbjct: 778 LPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKGATLG-------WCYYDDTNWRQIR 830

Query: 625 SNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
           S+N             E+ S   YVLFY RI 
Sbjct: 831 SSN-------------EYISQNAYVLFYHRIH 849

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 154/342 (45%), Gaps = 42/342 (12%)

Query: 132 VKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQR 191
           +  ++V+ L + LSG  R I     + +    +G++ + +ST     K  +         
Sbjct: 465 INARAVAPLSRSLSGSTRGIPTGGIHQKEKFHAGMTLNGNSTDYNISKSEI--------- 515

Query: 192 TLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSL---VGLRNQGNTCY 248
              +  RS     E +      P    K  +P   A     KML L   VGL+N GN+CY
Sbjct: 516 -FDSNNRS-----EMMPSSSLPPISPTKTGIPNKSALHTNDKMLDLDFIVGLQNIGNSCY 569

Query: 249 INSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLLTMYENGGTSVI 304
           +N ++QCL GT  L  +F++   Y+  I    K  ++  +++ FARL+  M+ N     +
Sbjct: 570 LNCIIQCLLGTHELTKIFLNN-FYERHINLNSKLGSKGVLAKYFARLIHLMH-NHANPKL 627

Query: 305 PKNFLQ--QFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDI 359
             N+++  QF +    +N       QQD QEF   LLD LH++L           +S   
Sbjct: 628 KNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSSAA 687

Query: 360 NLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
              +E +         W +  L  +    +DL FQGQ  + LQC+ C +TS  Y  F +L
Sbjct: 688 EKNREKLSLRIASSIEW-ERFLTTDFSVIVDL-FQGQYASRLQCEVCKHTSTTYQPFSVL 745

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           S+ IP++ K     +V + DC   FT  E+L  +  W CP C
Sbjct: 746 SVPIPRVPK---GVKVNILDCFKDFTKLELLDTDEQWLCPTC 784

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 68/151 (45%), Gaps = 41/151 (27%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIM----------------- 567
           + K+L   +LP  L+IHL RF  N+  KNN  I YP IL++                   
Sbjct: 790 STKKLTITRLPRNLIIHLKRFD-NNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDE 848

Query: 568 ---KNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLN 624
              +  I   KYKLYG+ +H G L  GHYT+ V+K   H        WY FDD   + + 
Sbjct: 849 LPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDDTNYRSIK 901

Query: 625 SNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           +             K+E  +S  Y+LFY RI
Sbjct: 902 N-------------KNEPITSSAYLLFYHRI 919

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 117/237 (49%), Gaps = 30/237 (12%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETK----ISEPFARLL 292
           +VGL N GN CY+N ++QCL GT  L  +F+ +  Y +FI  D+       +++ FA L+
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFL-DNTYLNFINFDSSRGSKGLLAKNFAILV 503

Query: 293 LTMYENGG-----TSVIPKNFLQQFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDELV 344
             M+ +G         IP   +Q F  +   +N +  D  QQD QEF   LLD LH++L 
Sbjct: 504 NNMHRHGAFTPPNVRTIPVQTIQ-FKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLN 562

Query: 345 YTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQ 396
                     +SD+    +E M         W +  L  +  + IDL FQGQ  + LQCQ
Sbjct: 563 QNGSKKHLKQLSDEEERMREKMSIRKASALEW-ERFLLTDFSAIIDL-FQGQYASRLQCQ 620

Query: 397 RCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            C +TS  Y  F +LS+ +P++   N      + DC   FT  E L  +  W+CPKC
Sbjct: 621 VCEHTSTTYQTFSVLSVPVPRVKTCN------ILDCFREFTKCERLGVDEQWSCPKC 671

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 67/153 (43%), Gaps = 39/153 (25%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN---------------- 564
           +K  + KQL   +LP  L+I+L RF  N   KNN  + YP  L+                
Sbjct: 673 KKQPSTKQLKITRLPKKLIINLKRFD-NQMNKNNVFVQYPYSLDLTPYWARDFNHEAIVN 731

Query: 565 --IIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
             I  +  +   +Y+LYG+  H G L  GHYTS V K         ++ WY FDD + + 
Sbjct: 732 EDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSLYRP 784

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           +  +              EF +   YVLFYERI
Sbjct: 785 ITFST-------------EFITPSAYVLFYERI 804

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/307 (28%), Positives = 140/307 (45%), Gaps = 52/307 (16%)

Query: 177 SRKPTLSHVPSNPQRTLSTPK---RSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPK 233
           S+ P    +P  P +++ST K    SS     + S + +    + + T P  D       
Sbjct: 563 SKVPNSPQLPPLPSKSVSTNKIVTASSKSHLPNNSILTSTGNHVAESTGPQFD------- 615

Query: 234 MLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFA 289
           +  +VGL N GN+CY+N ++QCL G   L  +F+ +  ++ ++    K  ++  ++  F+
Sbjct: 616 LDFMVGLENMGNSCYLNCIIQCLLGNNELIKIFL-DNSFEKYVNLNSKLGSKGVLARYFS 674

Query: 290 RLLLTMYEN------GGTSVIPKNFLQQFSLLRPDLNIP---KDQQDTQEFLVILLDILH 340
           RL+ TMY N      GG     K    QF +    +N       QQD QEF   LLD LH
Sbjct: 675 RLIHTMYNNARTIKHGGKHAPVKP--AQFKMACGSVNSAFKGGSQQDCQEFCQFLLDGLH 732

Query: 341 DELVYTDDLISNNYVSD--------------DINLGKEYMPWLQNNLKANGKSPIDLIFQ 386
           ++L   +    N  +++               I    E+  +L  +    G      +FQ
Sbjct: 733 EDL---NQCGGNKRLAELTEEAENLREKLSLRIASSIEWERFLTTDFSVIGD-----LFQ 784

Query: 387 GQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGEN 446
           GQ  + LQC+ CG TS  Y  F +LS+ +P  +K  SK    + DC + FT  E L  + 
Sbjct: 785 GQYASRLQCKTCGKTSTTYQPFSVLSIPVP--SKHISK--CSIIDCFDEFTKVENLEVDE 840

Query: 447 AWNCPKC 453
            W+CP+C
Sbjct: 841 QWSCPRC 847

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 68/154 (44%), Gaps = 42/154 (27%)

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI--IMKNNID------- 572
           K  + K+L   +LP  L+IHL RF  N   KNN ++ YP  L++     N+ D       
Sbjct: 850 KQPSTKKLTITRLPRNLIIHLKRFD-NRLNKNNILVQYPFTLDLTTFWANDFDGKLPLNV 908

Query: 573 ----------VVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
                        YKLYG+  H G L  GHYT+ V+K + +        WY FDD   + 
Sbjct: 909 SELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNG-------WYYFDDTSCRP 961

Query: 623 L-NSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           + NS   I              +S  YVLFY+RI
Sbjct: 962 IKNSMEPI--------------TSSAYVLFYKRI 981

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 118/238 (49%), Gaps = 32/238 (13%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLL 292
           +VGL N GN CY+N ++QCL GT  L  +F+ +  Y +FI     K ++  +++ FA L+
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFL-DNTYLNFINFDSSKGSKGLLAKNFATLV 503

Query: 293 LTMYENGGTSVIPKNFLQ------QFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDEL 343
             M+ N  ++ +P N         QF  +   +N I  D  QQD QEF   LLD LH++L
Sbjct: 504 RNMHRN--SAFMPVNSRTTPVQTIQFKKICGHINSIYSDSMQQDCQEFCQFLLDGLHEDL 561

Query: 344 VYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQC 395
                      ++++    +E M         W +  L  +  + IDL FQGQ  + LQC
Sbjct: 562 NQNGGKEHLKQLTEEEEQKREKMTIRKASALEW-ERFLLTDFSAIIDL-FQGQYASRLQC 619

Query: 396 QRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           Q C  TS  Y  F +LS+ +P+I   N      + DC   FT  E L  +  W+CP+C
Sbjct: 620 QACDRTSTTYQTFSVLSVPVPRITTCN------ILDCFREFTKCEKLGIDELWSCPRC 671

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 65/147 (44%), Gaps = 39/147 (26%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN------------------IIMK 568
           KQL   +LP  L+I+L RF  N   KNN  + YP  L+                  I  +
Sbjct: 679 KQLKITRLPKKLIINLKRFD-NQMNKNNVFVQYPYFLDLTPYWARDFNHEAIVNEDIPTR 737

Query: 569 NNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
             I   +Y+LYG+  H G L  GHYTS V K         ++ WY FDD + + +  N  
Sbjct: 738 GQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSIYRPIRFN-- 788

Query: 629 INKKESFNIEKDEFDSSKVYVLFYERI 655
                      DEF +   YVLFYERI
Sbjct: 789 -----------DEFITPNAYVLFYERI 804

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 117/237 (49%), Gaps = 30/237 (12%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD----AETKISEPFARLL 292
           +VGL N GN CY+N ++QCL GT  L  +F+ +  Y +FI  D    ++  +++ FA L+
Sbjct: 428 IVGLENMGNCCYMNCILQCLVGTHDLTRMFL-DNTYLNFINFDNMRGSKGLLAKNFANLV 486

Query: 293 LTMYENGG-----TSVIPKNFLQQFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDELV 344
            TM+ +G      + + P   + QF      +N I  D  QQD QEF   LLD LH++L 
Sbjct: 487 HTMHRHGAFKPLNSRITPVQTI-QFKKTCGHINSIYSDSMQQDCQEFCQFLLDGLHEDLN 545

Query: 345 YTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQ 396
                     +S++    +E M         W +  L  +  + IDL FQGQ  + LQCQ
Sbjct: 546 QNGGKKHLKQLSEEEERTRENMSIRKASALEW-ERFLLTDFSAVIDL-FQGQYASRLQCQ 603

Query: 397 RCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            C +TS  Y  F +LS+ +P+I   N      + DC   FT  E L     W+C +C
Sbjct: 604 ACEHTSTTYQTFSVLSVPVPRIMTCN------VLDCFREFTKCEKLGIGEQWSCSRC 654

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 68/153 (44%), Gaps = 39/153 (25%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN---------------- 564
           +K  + KQL   +LP  L+I+L RF  N   KNN  + YP  L+                
Sbjct: 656 KKQPSTKQLKITRLPKKLIINLKRFD-NQMHKNNVFVQYPCFLDLTPYWARDFNHEAIID 714

Query: 565 --IIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
             I  +  I   +Y+LYG+  H G L  GHYTS V K         ++ WY FDD + + 
Sbjct: 715 EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PQKGWYFFDDTIYRL 767

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           +  NN             EF +   YVLFYERI
Sbjct: 768 IRFNN-------------EFITPNAYVLFYERI 787

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 115/239 (48%), Gaps = 33/239 (13%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CY+N ++QCL GT  L  +F+ +  YK+ +    K  ++  +++ F++L+ 
Sbjct: 495 VGLTNLGNSCYMNCIIQCLLGTHELTQIFLDD-SYKNHVNLNSKLGSKGVLAKYFSQLIH 553

Query: 294 TMYENGG-----------TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDE 342
           TM +              T+V P +F      +   L     QQD QEF   LLD LH++
Sbjct: 554 TMQQQAASASTKQNSGDKTAVQPLHFKVACGSIN-SLFRSSSQQDCQEFCQFLLDGLHED 612

Query: 343 LVYTDDLISNNYVSDDINLGKEYM--------PWLQNNLKANGKSPIDLIFQGQIENCLQ 394
           L       +   +S++    +E +         W +  L  +    +DL FQGQ  + L 
Sbjct: 613 LNQCGGNPALKELSEEAEGIREKLCMRIASSIEW-ERYLTTDFSVIVDL-FQGQYASQLT 670

Query: 395 CQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           C+ CG TS  Y  F +LS+ +P      S ++  + DC   FT  E L  +  W+CP+C
Sbjct: 671 CKVCGRTSTTYQPFSVLSVPVP------SGSKCDIIDCFKEFTKVETLEKDEQWSCPRC 723

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 61/152 (40%), Gaps = 40/152 (26%)

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII--------------- 566
           K  + K++   +LP  LVIHL RF  N   KNN  ++YP  L++                
Sbjct: 726 KQPSTKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGV 784

Query: 567 ----MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
                +  +    Y LY +  H G L  GHYTS V+K        ++  W  FDD   +K
Sbjct: 785 AELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRK 837

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             S             + E  +   YVLFY R
Sbjct: 838 AKS-------------QGECITLSAYVLFYHR 856

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 116/237 (48%), Gaps = 30/237 (12%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLL 292
           +VGL N GN CY+N ++QCL GT  L  +F+ +  Y +FI     + ++  +++ +A L+
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFL-DNTYLNFINFGNTRGSKGLLAKNYATLV 521

Query: 293 LTMYENGG-----TSVIPKNFLQQFSLLRPDLN-IPKD--QQDTQEFLVILLDILHDELV 344
             M+ +G      +   P   L QF  +   +N I  D  QQD QEF   LLD LH++L 
Sbjct: 522 HNMHRHGAFKPPHSRTTPVQTL-QFKKVCGHINSIYSDSMQQDCQEFCQFLLDGLHEDLN 580

Query: 345 YTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQ 396
                     +S+     +E M         W +  L  +  + IDL FQGQ  + LQCQ
Sbjct: 581 QNGGKKHLKQLSEQEERMRESMSIRKASALEW-ERFLLTDFSAIIDL-FQGQYASRLQCQ 638

Query: 397 RCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            C +TS  Y  F +LS+ +P+I   N      + DC   FT  E L  +  W+C KC
Sbjct: 639 ACEHTSTTYQTFSVLSVPVPRIRTCN------ILDCFREFTKCEKLGVDEQWSCSKC 689

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 67/153 (43%), Gaps = 39/153 (25%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILN---------------- 564
           +K  + KQL   +LP  L+I+L RF  N   KNN  + YP  L+                
Sbjct: 691 KKQPSTKQLKITRLPKKLIINLKRFD-NQMNKNNVFVQYPCFLDLTPYWARDFNHESIVN 749

Query: 565 --IIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
             I  +  I   +Y+LYG+  H G L  GHYTS V K         ++ WY FDD V   
Sbjct: 750 EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PQKGWYFFDDSVYCP 802

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           +  N             DEF +   YVLFYERI
Sbjct: 803 IRFN-------------DEFITPNAYVLFYERI 822

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 108/242 (44%), Gaps = 42/242 (17%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLLT 294
           +GL N GN+CY+N ++QCL  +     +F++    K      K  ++  ++  FARL+ T
Sbjct: 608 IGLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINT 667

Query: 295 MYENGGTS--------VIPKNFLQQF----SLLRPDLNIPKDQQDTQEFLVILLDILHDE 342
           MY  G           V P  F        S+ R DL     QQD+QEF   LLD LH++
Sbjct: 668 MYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDL-----QQDSQEFCQFLLDGLHED 722

Query: 343 LVYTD------DLISN-----NYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIEN 391
           L          +L  N       +S  I    E+  +L  +      S I   FQGQ  +
Sbjct: 723 LNQCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTDF-----SVIVDQFQGQYAS 777

Query: 392 CLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
            L+C+ CG TS  Y  F +LS+ +P+    N      + DC N FT  E L  +  W CP
Sbjct: 778 QLRCKVCGGTSTTYQAFSVLSVPVPRGKSCN------IIDCFNEFTKVENLETDELWACP 831

Query: 452 KC 453
            C
Sbjct: 832 HC 833

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 65/155 (41%), Gaps = 42/155 (27%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII-------------- 566
           +K  + K+L   +LP  L+IHL RF  N   KNN  + YP +L++               
Sbjct: 835 KKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPG 893

Query: 567 ------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
                  +  I    YKL  +  H G L  GHYTS V+K         +  W  FDD  I
Sbjct: 894 VTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKI 945

Query: 621 KKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           + L        K S+     E  +S  YVLFY R+
Sbjct: 946 RPL--------KNSY-----ECITSNAYVLFYHRV 967

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 111/242 (45%), Gaps = 39/242 (16%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           +GL N GN+CY+N ++QCL G   L  +F++   Y+  +    +  ++  ++  F++L+ 
Sbjct: 432 IGLVNLGNSCYLNCIIQCLLGCHELSYIFLTN-SYRKHVNVNSRLGSKGLLANYFSQLVQ 490

Query: 294 TMYENG-----------GTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDIL 339
            MY+ G            T+V P     QF L    +N     K QQD QEF   LLD L
Sbjct: 491 KMYQQGKLQAYNNTNMESTAVHPT----QFKLACGSINSLFKGKQQQDCQEFCQFLLDGL 546

Query: 340 HDELVYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIEN 391
           H++L           +S +    +E MP        W +  L  +    +DL FQGQ  +
Sbjct: 547 HEDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEW-ERYLTTDFSVIVDL-FQGQYAS 604

Query: 392 CLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
            L+C+ C +TS  Y  F +LS+ +P+           + DC   FT  E L  +  W CP
Sbjct: 605 QLRCKICAHTSTTYQAFSVLSVPVPR------ARSCTIYDCFKEFTKLETLEKDELWYCP 658

Query: 452 KC 453
            C
Sbjct: 659 YC 660

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 66/158 (41%), Gaps = 42/158 (26%)

Query: 518 YKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII----------- 566
           Y  ++  + KQ+   +LP  L+IHL RF  N   KNN  + YP  L++            
Sbjct: 659 YCKQRQPSTKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEM 717

Query: 567 ---------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
                    ++       Y+L+ + +H G L  GHYTS V+K            W +FDD
Sbjct: 718 PKDNGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDD 769

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
              +K+               KDE+ +   YVLFY R+
Sbjct: 770 VSWRKIR-------------RKDEYITPNAYVLFYRRV 794

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 92.8 bits (229), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 116/260 (44%), Gaps = 34/260 (13%)

Query: 222 VPIIDATDN----IPKM-LSLV-GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF 275
           +P++  T N    +PK+ L    GL N  N+CY+N ++QCL  T  L  L+++       
Sbjct: 436 LPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQI 495

Query: 276 I---KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLR--------PDLNIPKD 324
               K  ++  +S+ FA L+ TMY+         NFL   + L           +     
Sbjct: 496 NVENKLGSKGFLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMNSIYAEST 555

Query: 325 QQDTQEFLVILLDILHDEL-----------VYTDDLISNNYVSDDINLGKEYMPWLQNNL 373
           +QD QEF   LLD LH++L           +  ++      +S  I    E+  +L  N 
Sbjct: 556 EQDCQEFCEFLLDGLHEDLNQCSGNPRPKELSANEAELRESLSMRIASEIEWESFLTTNF 615

Query: 374 KANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCI 433
                SPI  +FQGQ  + LQC  C +TS  Y  F +LS+ +P +   N +    + DC 
Sbjct: 616 -----SPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSMVFSNGQT-CNILDCF 669

Query: 434 NFFTSDEILTGENAWNCPKC 453
             FT  E L  +  W CPKC
Sbjct: 670 KEFTKCERLDNDEKWFCPKC 689

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 64/154 (41%), Gaps = 41/154 (26%)

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI--IMKNNID------- 572
           K I+ KQL   +LP  L+IH  RF  N   KNN  + YP  L++  +  N+ D       
Sbjct: 692 KQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPNF 750

Query: 573 -----------VVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIK 621
                        KYKL  +  H G L  GHYT+ V+K L          W+ FDD   +
Sbjct: 751 NEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-------WFRFDDASYR 803

Query: 622 KLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
            +                 EF +   Y+LFY+RI
Sbjct: 804 PVKFGT-------------EFLTPDAYLLFYQRI 824

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 115/244 (47%), Gaps = 38/244 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CY+N ++QCL GT  L  +F+++  YK+ I    K  ++  +++ F++L+ 
Sbjct: 523 VGLVNLGNSCYMNCIIQCLLGTHELSQMFLND-SYKNHINFNSKLGSKGVLAKYFSQLVH 581

Query: 294 TMY-ENGGT---------------SVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLD 337
            MY +N  T               +V P NF      +   L     QQD QEF   LLD
Sbjct: 582 NMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTIN-SLFRDCSQQDCQEFCQFLLD 640

Query: 338 ILHDELVYTDDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQI 389
            LH++L           +S++    +E +         W +  L  +    +DL FQGQ 
Sbjct: 641 GLHEDLNQCGGNPRLKELSEEAEKIREKLSMRIASSIEW-ERYLTTDFSVIVDL-FQGQY 698

Query: 390 ENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWN 449
            + L+CQ CG TS  Y  F +LS+ +P +   N      + DC   FT  E L  +  W+
Sbjct: 699 ASQLKCQVCGRTSTTYQPFSVLSVPLPSLKSCN------ILDCFQEFTKVETLEKDEQWS 752

Query: 450 CPKC 453
           CP C
Sbjct: 753 CPDC 756

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 66/150 (44%), Gaps = 40/150 (26%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII------------------ 566
           + K++   +LP  L+IHL RF  N   KNN  ++YP  L++                   
Sbjct: 762 STKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTEL 820

Query: 567 -MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
             +  +    YKLY + +H G L  GHYT+ V+K        +++ W  FDD   ++  S
Sbjct: 821 PTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKG-------SQRGWCYFDDTNWRRSRS 873

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           +N             E  +S  YVLFY R+
Sbjct: 874 DN-------------ECITSNAYVLFYHRV 890

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 122/246 (49%), Gaps = 42/246 (17%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLL 292
           ++GL+N GN+CY+N ++QCL GT  L  +F++   ++ +I    K  ++  +++  ++L+
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLN-YSFERYINLNSKLGSKGVLAKNLSKLI 804

Query: 293 LTMY-----ENGGTSVIPK---NFLQ--QFSLLRPDL-NIPKD--QQDTQEFLVILLDIL 339
             MY     +N G     K   NF++  QF +    + N+ K+  QQD QEF   LLD L
Sbjct: 805 HLMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSINNLFKNCSQQDCQEFCQFLLDAL 864

Query: 340 HDELVYTDDLISNNYVSDDINLGKEYM------------PWLQNNLKANGKSPIDLIFQG 387
           H++L    +   +N    +++   E M             W +  L  +    +DL FQG
Sbjct: 865 HEDL----NQCGSNPPLKELSTKAESMREKLSLRIASSIEW-ERYLTTDFSVIVDL-FQG 918

Query: 388 QIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENA 447
           Q  + LQC+ C +TS  Y  F +LS+ IPK      K  + L DC   FT  E L  +  
Sbjct: 919 QYASRLQCKTCIHTSTTYQPFSVLSVPIPK------KKNLNLLDCFKDFTKIENLEVDEQ 972

Query: 448 WNCPKC 453
           W CP C
Sbjct: 973 WFCPNC 978

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 67/149 (44%), Gaps = 41/149 (27%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIM------------------- 567
            K+L   +LP  L+IHL RF  N+  KNN +I YP IL++                     
Sbjct: 986  KKLTITRLPRNLIIHLKRFD-NNLNKNNNLIDYPFILDLTQFWADDFDGELPPGVTDELP 1044

Query: 568  -KNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSN 626
             +  I   KY+LYG   H G L  GHYT+ VNK + +        WY FDD   + +   
Sbjct: 1045 KRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGIRNG-------WYYFDDTNYRPIK-- 1095

Query: 627  NTINKKESFNIEKDEFDSSKVYVLFYERI 655
               N++E          SS  YVLFY RI
Sbjct: 1096 ---NEREPI--------SSNAYVLFYHRI 1113

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 109/235 (46%), Gaps = 29/235 (12%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI----KKDAETKISEPFARLLL 293
           VGL N GN+CYIN ++QCL GT  L ++F++   Y+  I    K  ++  +++ FARL+ 
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNN-SYERHINLNSKLGSKGVLAKHFARLIH 573

Query: 294 TMYENGG-------TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYT 346
            M+++          +V P  F      +   L     QQD+QEF   LLD LH++L   
Sbjct: 574 QMHQSAAFKKSDKNKAVRPYEFKMACGSIN-SLFRESGQQDSQEFCQFLLDGLHEDLNQC 632

Query: 347 DDLISNNYVSDDINLGKEYMP--------WLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
                   +S++    +E +         W +  L  +    +DL FQGQ  + L+C+ C
Sbjct: 633 GGNPPLKELSEEAEKMRERLSMRIASSIEW-ERYLTRDFSVIVDL-FQGQYASQLRCKVC 690

Query: 399 GNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            +TS  Y  F +L+  +P            L DC   FT  E L  +  W CP C
Sbjct: 691 NHTSTTYQPFSILAAPVPHAKS------CYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 69/158 (43%), Gaps = 41/158 (25%)

Query: 518 YKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNII----------- 566
           Y  +K  + K+L   +LP  L+IHL RF  N   KNN ++ YP  L++            
Sbjct: 738 YCKKKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRL 796

Query: 567 ---------MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
                     +  +   KYKLY + +H G L  GHYT+ V+K LN       + WY FDD
Sbjct: 797 PPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN-------KGWYYFDD 849

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
              + + +               E  +S  YVLFY R+
Sbjct: 850 TGYRPMRT-------------PTECITSNAYVLFYHRV 874

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 112/442 (25%), Positives = 174/442 (39%), Gaps = 99/442 (22%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF---IKKDAETKISEPFARLLL 293
           ++GL N  N+CY+N ++QCL     L  + ++    K      K  ++  I + FA+L+ 
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 294 TMYEN---GGTSVIP--------KNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDE 342
            M+      G S+          KN     S +         QQD QEF   LLD LH++
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSG----SQQQDCQEFCEFLLDGLHED 543

Query: 343 LVYTDDLISNNYVSDDINLGKE--------YMPWLQNNLKANGKSPIDLIFQGQIENCLQ 394
           L           ++D     +E         M W +N L  N    IDL F GQ  + L+
Sbjct: 544 LNQCGGNPPARELTDQEERLREGLCMRVASSMAW-ENFLHNNFSLIIDL-FAGQYGSQLR 601

Query: 395 CQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCC 454
           C  C  TS  Y  F +LS+ +P  ++    +R  + DC   FT  E L  +  W CP+C 
Sbjct: 602 CCVCQYTSTTYQPFTLLSVPVPLSSR---VSRCSIIDCFQEFTKCERLDKDEEWFCPQC- 657

Query: 455 PTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKN 514
                   +   P+T + ++     N +  FK                        +  N
Sbjct: 658 --------KRKQPSTKQLKITRLPKNLIIHFKRF---------------------DNMMN 688

Query: 515 KNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNN-IDV 573
           KN              FI+ P    + L+ F+ N     N  +   +  +++ K   +  
Sbjct: 689 KNNI------------FIQYP--YELDLTPFWVNDF---NGELPLGMTNSLLTKGGQVGP 731

Query: 574 VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKE 633
            KY+L  +  H G L  GHYT+ VNK         +  WY FDD       S++ I K  
Sbjct: 732 FKYQLNAVACHMGTLGSGHYTAYVNKG-------PDVGWYYFDD-------SSHRIVKIA 777

Query: 634 SFNIEKDEFDSSKVYVLFYERI 655
           +      E+ +   Y+LFY R+
Sbjct: 778 T------EYMNPDAYLLFYHRV 793

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 99/441 (22%), Positives = 183/441 (41%), Gaps = 103/441 (23%)

Query: 214 PAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXX 271
           P  IKK+  P + AT   PK     GL N G TCY N+ VQ +     L+  LF I++  
Sbjct: 334 PHRIKKNWGPAL-ATSR-PK-----GLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGK 386

Query: 272 YKDFIKKDAETKISEPFARLLLTMYENG---GTSVIPKNFLQQFSLLRPDLNIPKDQQDT 328
           YKD I   + +++    ++ + ++ ENG    + + PK  + +   +   +++  +Q+D+
Sbjct: 387 YKDVISPSSVSQVLAETSKRMWSL-ENGKSKASYINPKKLIGRLEDINCMMSV-WNQEDS 444

Query: 329 QEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388
            E+ + L+  L ++ V     ++ + + D                          IF G 
Sbjct: 445 HEYFMSLISRLQEDSVPRGHKMTESLIYD--------------------------IFGGL 478

Query: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAW 448
           ++  ++C+ CG+ S      Y LSL +        K   K +D     T D+ +TG+   
Sbjct: 479 LQQRVKCKSCGSVSITEQPIYDLSLHL------KGKKLAKGDDS----TVDDSITGDVKN 528

Query: 449 NCPKCCPTTIETYDEADSPA---TVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXX 505
           +      T     D A+ P    ++E  +++   NP    K+                  
Sbjct: 529 SAAPSGST-----DGAELPKRRYSIEKSIRD-FFNPELIKKV------------------ 564

Query: 506 XXXKSDGKNKNKYKNEKLIT----LKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITY 559
                   NK  Y  EK       +K+   ++ P  L++HL +F +N  S+ K    ++Y
Sbjct: 565 -------DNKEGYVCEKCKATTNAIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSY 617

Query: 560 PLILNI----IMKNNIDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYN 614
           PL +++    +       VKY+L  ++ H+G  L+ GHY +   +         +  W  
Sbjct: 618 PLFMDLTEYCVEAAKCLPVKYQLISVVVHEGRSLSSGHYIAHCKQP--------DGTWAT 669

Query: 615 FDDEVIKKLNSNNTINKKESF 635
           +DDE I K+   N + +  ++
Sbjct: 670 YDDEYINKITERNVLKEVNAY 690

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 150/371 (40%), Gaps = 69/371 (18%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM--- 295
           GL N GN C+INS +Q L     L         Y     +D +T  + P    L TM   
Sbjct: 77  GLVNPGNDCFINSSIQALVPLDKL-------TTYLSATLEDEKTASTLPLHNGLATMLLE 129

Query: 296 ---YENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
                +   SV  K F+QQ   +     I + Q D  EF  ++L+ L++E +  D     
Sbjct: 130 LQQLRSDPKSVSSKRFIQQLETIFGG-KISRQQNDAHEFTQLILERLNEENLTLDH---- 184

Query: 353 NYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSY-NYSMFYML 411
                                     + + + F+G + N L C +CG TS+ N   FY+ 
Sbjct: 185 --------------------------ADLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIY 218

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVE 471
            L +P+      +  VKL D +N    +++ T EN ++C  C    + T +E +  + V 
Sbjct: 219 ELTLPQ------QGSVKLSDLVN---GEQMETIEN-YSCMYCKTVAMLT-NEREEKSNVS 267

Query: 472 NRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNF 531
               +  +N L F K    LS    N            S  K        K + +++  F
Sbjct: 268 R--TDAELNILKFLK--GKLSTLLINEELPEHITHYINSYNKGYCNTSEIKSVIVRKSTF 323

Query: 532 IKLPPILVIHLSRFYYNST--KKNNAVITYP---LILNIIMKNN----IDVVKYKLYGLI 582
            + P I +IHLSR  +N     +N   + +    L+   I+K++     + VKYKL  ++
Sbjct: 324 AEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKYKLKSIV 383

Query: 583 NHQGGLTKGHY 593
            H G   +GHY
Sbjct: 384 KHTGSHYQGHY 394

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 105/226 (46%), Gaps = 28/226 (12%)

Query: 239 GLRNQGNTCYINSMVQCL-----FGTKVLRDLFI------SEXXYKDFIKKDAETKISEP 287
           G++N+GN CY+N ++QCL     F  K L + ++      S   ++  + K+   KI + 
Sbjct: 345 GIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVVKNW-AKIIQA 403

Query: 288 FARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD 347
           F ++     EN   +V    F +Q++ L P+      Q D  EF + LL+ +H++  +  
Sbjct: 404 FFQV---SQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHEDSNWGR 459

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSM 407
              S+  +  D     +Y        K N    +D  F+GQI++ L CQ C   S NY  
Sbjct: 460 PQNSDAAMQVD-----DYREAWNLYRKGNSSYIVD-TFKGQIKSQLTCQVCQTQSNNYEP 513

Query: 408 FYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           F +L+L IP ++         + DC+       +LTG++ W C  C
Sbjct: 514 FSILNLPIPLVS------MCHIYDCMKELFKVHVLTGDDRWYCSTC 553

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 57/124 (45%), Gaps = 25/124 (20%)

Query: 534 LPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNI---DVVKYKLYGLINHQGGLTK 590
           +P +L+IH +RF  N   K    + YP +L++   N +     V YKL  +  H G L  
Sbjct: 568 VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 591 GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVL 650
           GHYT+   K+       +E  WY+FDD   K +++   I              S   Y+L
Sbjct: 627 GHYTAYCFKN-------SENGWYHFDDTQCKPVSNGECI--------------SQSAYLL 665

Query: 651 FYER 654
           FY++
Sbjct: 666 FYQK 669

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 106/230 (46%), Gaps = 52/230 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK-------DAETKISEPFAR 290
           +GL N GNTCY+NS +QCL     +RD F+    Y  F K+         +  ++  F  
Sbjct: 321 IGLSNLGNTCYMNSGLQCLVHIPQIRDYFV----YNGFEKEINVNNPLGFQGHMARSFHG 376

Query: 291 LLLTMYENGGTSVIP----------KNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILH 340
           L+ +++   G S+ P          K+ L  F+ +         QQD+QEFL  LLD LH
Sbjct: 377 LIQSLF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLH 429

Query: 341 DELVYTDDLISNNYV-------SDDIN-------LGKEYMPWLQNNLKANGKSPIDLIFQ 386
           ++L   + ++   YV        DDIN       L  E   W  + ++ +  S I  IF 
Sbjct: 430 EDL---NRIVEKPYVEKPSLKPGDDINDFDTIKKLANE--TWKSHLMRND--SIITDIFV 482

Query: 387 GQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRV---KLEDCI 433
           G  ++ L+C  C N S  +  +  L+L +P  +  N++ R+   KL  C+
Sbjct: 483 GMYKSTLECPECSNVSITFDPYNDLTLPLPINSSWNAQVRIFPSKLPPCM 532

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            K++     P + +IHL RF    +   K +A I +P     +   ++ K++     Y L 
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLI 986

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GG+  GHYT+ V        +L +Q WY FDD  + K +   +I          
Sbjct: 987  AVDNHYGGMGGGHYTAYVK-------NLTDQNWYYFDDSRVSKTSPEKSI---------- 1029

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1030 ----AGSAYLLFYLR 1040

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 424 KNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           +    L+DC+N F+  E+L   ++W CP C
Sbjct: 890 EQETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 103/212 (48%), Gaps = 28/212 (13%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARLL 292
            +VGL N GN+CY+NS +QCL     LRD F+     +D    +    + +I++ FA L+
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD--------QQDTQEFLVILLDILHDEL- 343
            +++++  ++      LQ FS       I           QQD+QE L  LLD LH++L 
Sbjct: 356 KSLFDDKASA------LQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDLN 409

Query: 344 -------VYTDDLISNNYVSD-DINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQC 395
                  V   +L S++ V+D D+      + W ++ L+   +S I  +F G  ++ L C
Sbjct: 410 RIMKKPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLR--NESVIVDLFVGLYKSTLTC 467

Query: 396 QRCGNTSYNYSMFYMLSLAIPKIAKENSKNRV 427
             C   S  +  F  L+L +P  +  ++K R+
Sbjct: 468 PACDRVSVTFDPFSDLTLPLPVESFWSAKVRI 499

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (44%), Gaps = 30/136 (22%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLILNIIMKNNI---DVVKYKLYGL 581
            KQ+     P IL IHL RF   ++ + K + V+ +P I  + M  ++   D  +  +Y L
Sbjct: 906  KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFP-ITGLDMSEHLVCHDPNQNSMYDL 964

Query: 582  I---NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
            I   NH GGL  GHYT+ V        +  + +WY FDD  + +  +   I         
Sbjct: 965  IAVDNHYGGLGGGHYTAYVK-------NFMDGKWYYFDDSRVSETEAERAI--------- 1008

Query: 639  KDEFDSSKVYVLFYER 654
                 S   Y+LFY R
Sbjct: 1009 -----SGAAYLLFYRR 1019

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 417 KIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           K   E  K  + L DC+  F+  E+L   ++W CP C
Sbjct: 862 KHRSEQEKGHISLTDCLELFSKSEVLGAADSWYCPNC 898

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 92/201 (45%), Gaps = 32/201 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA----ETKISEPFARLLL 293
           VGL N GNTCY+NS +QCL     +RD F     YK+ I  D     +  I+  F+ L+ 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYF-KFGAYKNEINLDNPLGFQGNIANAFSALVQ 456

Query: 294 TMYENG---GTSVIPKNFL-------QQFSLLRPDLNIPKDQQDTQEFLVILLDILHDEL 343
            +Y+N      S  P  F        Q FS           QQD+QEFL  LLD LH++L
Sbjct: 457 NLYKNQFIPSASYAPSQFKLTIGHYNQMFSGYF--------QQDSQEFLAFLLDGLHEDL 508

Query: 344 --------VYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQC 395
                   V    L   + V+D   + +     L+ +LK N    IDL F G  ++ L+C
Sbjct: 509 NRIKDKPYVEKPSLADGSDVNDYNIIARLAADTLEAHLKRNDSIIIDL-FVGLYKSTLKC 567

Query: 396 QRCGNTSYNYSMFYMLSLAIP 416
             C + S  +  +  L+L IP
Sbjct: 568 PVCNHVSITFDPYCDLTLPIP 588

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL IHL RF    +   K + V+ +P     L  +I+ K+   +  Y L 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ +        +L + +WY FDD  + +     ++          
Sbjct: 1056 AVDNHYGGLGGGHYTAYIK-------NLIDNKWYYFDDSRVSETVPERSV---------- 1098

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1099 ----AGSAYLLFYMR 1109

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 417 KIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           ++ ++  +  + LED +N F   E+L   ++W CPKC
Sbjct: 952 ELGQDKEEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 83/180 (46%), Gaps = 11/180 (6%)

Query: 29  DLPSLVDSIFQHDIKDYYTKLRLERXXXXXXXXXXXXXXFKVYTSHKSRKRQATLAFVNG 88
           +L   V  I+Q+DIK    +LRL +              F  +     R   A  A++ G
Sbjct: 18  ELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLP-SGRYDDALSAYIVG 76

Query: 89  SFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE---QDLS 145
            +YL+LIIP   QFQTKNK ++ Y D KI Y+ + +M N+   V+ +  SIL+   Q+  
Sbjct: 77  CYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPE 136

Query: 146 GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRTLSTPKRSSTLMTE 205
              R I + RA+   S++    +D ++       P      S  QR LS  K   +L  E
Sbjct: 137 PTKRVIPRGRAF---SVKDDTPKDYNTIEF----PIRERKSSTTQRPLSMAKPYDSLPME 189

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 103/447 (23%), Positives = 171/447 (38%), Gaps = 152/447 (34%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM 295
            L GL N G+TC+++S++Q L     + +  +S+  + +   K++   +S     +++  
Sbjct: 136 GLFGLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNSSLCMSCALDAMIIEF 195

Query: 296 YENGGTSVIPKNFLQQ-------------FSLLRPDLNIPKD-----QQDTQEFLVILLD 337
           Y  G + + P +                  SLL   L I ++     QQD  EFL   L+
Sbjct: 196 Y--GQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKINENFAGYSQQDAHEFLQYFLN 253

Query: 338 ILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQR 397
            LH +  Y  D   N                 +NN      S    IFQG++++ + C  
Sbjct: 254 QLHQD--YKRDSSHNEQ---------------ENNCPCVAHS----IFQGELKSSIVCPE 292

Query: 398 CGNTSYNYSMFYM-LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPT 456
           C N S      +M LSL I        K++  L  C++ F   E L   N ++C +C   
Sbjct: 293 CQNDSKTIIDPFMDLSLDI--------KDKTDLYQCLDSFHKKEKLHDFN-YHCSRC--- 340

Query: 457 TIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKN 516
                              N S++P+  F ++K                           
Sbjct: 341 -------------------NTSLDPIKQFTINK--------------------------- 354

Query: 517 KYKNEKLITLKQLNFIKLPPILVIHLSRF--YYNSTK-KNNAVITYPLILNIIMKNNIDV 573
                            LPP+LV+ L RF  + N T  K N  + YPL LN  M++  D 
Sbjct: 355 -----------------LPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLN--MRDYCDR 395

Query: 574 --------VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
                   + Y+L G+++H G + +GHY  +        L +N+ +W+ F+D +I     
Sbjct: 396 NTNQETPDIIYELTGILSHIGSINEGHYVVV--------LKINDGRWFKFNDSMISV--- 444

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFY 652
                      I++DE    + Y+LFY
Sbjct: 445 -----------IKEDEALKQQAYLLFY 460

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 98/449 (21%), Positives = 160/449 (35%), Gaps = 138/449 (30%)

Query: 219 KHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK 278
           K +VP+    D       L GL N G+TC+++S++Q L     +    +++  +     +
Sbjct: 123 KSSVPLAKGRD------GLCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQVHFSRCDIQ 176

Query: 279 DAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD-----QQDTQEFLV 333
           D+ +  S    R++   Y     +           LL     I ++     QQD  EF  
Sbjct: 177 DSASCFSCALDRIVSNFYGPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQ 236

Query: 334 ILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCL 393
             L+ LH + V              +   K   P   N +  +        FQG + + +
Sbjct: 237 FFLNQLHADHV-------------RVTGKKSSKPEECNCISHSA-------FQGSLRSSI 276

Query: 394 QCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            C  C + S N +   M+ L++        KN+ KL DC+  F   E LT  N   CP C
Sbjct: 277 LCTDCHDGS-NITFDPMMDLSL------EIKNKNKLVDCLKSFHEGETLTDFNH-RCPNC 328

Query: 454 CPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGK 513
                          +V+N +K  +I  L                               
Sbjct: 329 --------------GSVQNPIKQMTIAKL------------------------------- 343

Query: 514 NKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYY----NSTKKNNAVITYPLILNII--- 566
                                PP+LV+ L RF +    NS K N   I YP  LN+    
Sbjct: 344 ---------------------PPVLVLQLKRFEHLMNGNSVKLNEK-IAYPTYLNMAPFC 381

Query: 567 ---MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
                  +  + Y+L  +I+H+G + +GHYTS+          +   QW+ F+D +I   
Sbjct: 382 HQSESRPVPDMMYELVAVISHEGSVNQGHYTSMC--------KIPGGQWFRFNDSMI--- 430

Query: 624 NSNNTINKKESFNIEKDEFDSSKVYVLFY 652
                       +I ++E    + Y+LFY
Sbjct: 431 -----------VSISEEEALRQQAYLLFY 448

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 90/202 (44%), Gaps = 34/202 (16%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARLLLT 294
           +GL N GNTCY+NS +QCL      +D F+     K+   ++    +  I+  FA ++  
Sbjct: 346 IGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQA 405

Query: 295 MY---ENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHD---------- 341
           ++    +  TS  P+NF      L   +     QQD+QEFL  LLD LH+          
Sbjct: 406 LFGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLNRIIEKPY 464

Query: 342 ----ELVYTDDLISNNYV---SDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQ 394
               EL  TDD      +   +DD         W ++ L+ +  S I  +F G  ++ L 
Sbjct: 465 VEKPELTSTDDTAEFKVIKKLADDT--------WGKHKLRND--SVITDLFVGLYKSTLI 514

Query: 395 CQRCGNTSYNYSMFYMLSLAIP 416
           C  C  TS  +  +  L+L +P
Sbjct: 515 CPVCKKTSVTFDPYNDLTLPLP 536

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 21/34 (61%)

Query: 420 KENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           + + + ++ L DC+  F++ E+L   ++W CP C
Sbjct: 955 RASGEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 58/135 (42%), Gaps = 29/135 (21%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    + + K    + +P     +   ++ KN      Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V K+++        +WY FDD  + +     +I          
Sbjct: 1056 AVDNHYGGLGGGHYTAYV-KNID-------GKWYYFDDSRVSETLPERSI---------- 1097

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1098 ----AGSAYLLFYRR 1108

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 104/226 (46%), Gaps = 29/226 (12%)

Query: 213 RPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXY 272
           +P E   H      A + +       GL N GNTCY+NS +QCL     LRD F+ +  Y
Sbjct: 339 KPIEGHHHWASNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYD-GY 397

Query: 273 KDFIKKD----AETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD---- 324
           ++ I ++        ++  F+ L+  +++N   SV+ +N     S+ +  +         
Sbjct: 398 ENEINEENPLGYHGYVARAFSDLIQKIFQN-RLSVMQRNGAFPPSMFKSTVGHFNSMFSG 456

Query: 325 --QQDTQEFLVILLDILHDELVYTDDLISNNYVS----------DDINLGKEYM--PWLQ 370
             QQD+QEFL  LLD LH++L   + +I   Y+           DD N+ K+     W +
Sbjct: 457 YMQQDSQEFLAFLLDSLHEDL---NRIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTW-E 512

Query: 371 NNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIP 416
            +LK N     DL F G  ++ L C  C N S  +  +  ++L +P
Sbjct: 513 MHLKRNCSVITDL-FVGMYKSTLYCPECKNVSITFDPYNDVTLPLP 557

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    +   K +A + +P     L  N++ K++     Y LY
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLY 1051

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V    N+       +WY FDD  + +    N+I          
Sbjct: 1052 AVDNHYGGLGGGHYTAYVKNFANN-------KWYYFDDSRVTETVPENSI---------- 1094

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1095 ----AGSAYLLFYIR 1105

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 417 KIAKENSKNR-VKLEDCINFFTSDEILTGENAWNCPKC 453
           K  + N+K R + L+DC+  F+  EIL   ++W CP C
Sbjct: 947 KSERSNAKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 26/209 (12%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARLLLT 294
            GL N GN+CY+NS +QCL     L+D F+     +D   ++    +  +++ FA L+ +
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 295 MYENGGTSVI---PKNFL----QQFSLLRPDLNIPKDQQDTQEFLVILLDILHDEL--VY 345
           +++   +S     P+ F     QQ S+    L     QQD+QEFL  LLD LH++L  + 
Sbjct: 394 LFDERSSSAFAFSPREFKSIIGQQNSMFAGFL-----QQDSQEFLAFLLDGLHEDLNRII 448

Query: 346 TDDLISNNYVSDDINLGKEYM-------PWLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
               +    +S D ++    +        W ++ L+ N    +DL F G  ++ L C  C
Sbjct: 449 EKPFVEKPELSPDEDVNNREVIHRLASKTWDKHKLR-NDSVILDL-FVGLYKSTLTCPVC 506

Query: 399 GNTSYNYSMFYMLSLAIPKIAKENSKNRV 427
             TS  +  +  L+L +P  +   SK R+
Sbjct: 507 DKTSVTFDPYSDLTLPLPVESIWTSKVRI 535

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 30/136 (22%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLILNIIMKNNI---DVVKYKLYGL 581
            KQ+     P IL IHL RF   ++ + K + V+ +P I  + M +++   D  +  LY L
Sbjct: 937  KQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFP-ICGLNMSDHLVCEDAEQNNLYDL 995

Query: 582  I---NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
            +   NH GGL  GHYT+     ++        +WY FDD  + + +   ++         
Sbjct: 996  VAVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRVSETDPETSV--------- 1039

Query: 639  KDEFDSSKVYVLFYER 654
                 S   Y+LFY R
Sbjct: 1040 -----SGAAYLLFYRR 1050

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 420 KENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           +   + R+ L DC+  F+  E+L+  ++W CP C
Sbjct: 896 QHEGERRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+ + LKQL     P IL +HL RF Y+   ++N      I YPL L +  K++  V K 
Sbjct: 582 ERTVGLKQL-----PKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKN 636

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H GG  + GHY +I   D+          W  +DDE ++      +I+++  
Sbjct: 637 YELNGIVIHMGGGPQHGHYVAICKHDM--------FGWLLYDDETVE------SIDEETV 682

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
           F    DE D +  YVLF++ ++
Sbjct: 683 FKFVGDEKDMTTAYVLFFKEVD 704

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query: 381 IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDE 440
           +  +FQG + N ++C  C N + +  +F  L  AIP     N    V ++D ++ F   E
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIPV----NEDEEVNIQDMLSNFNQRE 562

Query: 441 ILTGENAWNCPKC 453
           +L G N + C  C
Sbjct: 563 MLNGANKFYCDSC 575

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + GL N GNTCY NS++QCLF    LR
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELR 158

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 102/225 (45%), Gaps = 27/225 (12%)

Query: 213 RPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXY 272
           +P E   H      A + +       GL N GNTCY+NS +QCL     LRD F+ +  Y
Sbjct: 339 KPIEGNHHWPSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYD-GY 397

Query: 273 KDFIKKD----AETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD---- 324
           +D I ++        ++  F+ L+  +++N   S++ +N     S+ +  +         
Sbjct: 398 EDEINEENPLGYHGYVARAFSDLVQKLFQN-RMSIMQRNAAFPPSMFKSTIGHFNSMFSG 456

Query: 325 --QQDTQEFLVILLDILHDELVYTDDLISNNYV-------SDDIN----LGKEYMPWLQN 371
             QQD+QEFL  LLD LH++L   + +I   Y         DD+N    + K      + 
Sbjct: 457 YMQQDSQEFLAFLLDSLHEDL---NRIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEM 513

Query: 372 NLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIP 416
           +LK N     DL F G  ++ L C  C N S  +  +  ++L +P
Sbjct: 514 HLKRNCSVITDL-FVGMYKSTLYCPECQNVSITFDPYNDVTLPLP 557

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    +   K +A + +P     L   ++ K++   + Y LY
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLY 1055

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V        +  + +WY FDD  + +    N+I          
Sbjct: 1056 AVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPENSI---------- 1098

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1099 ----AGSAYLLFYIR 1109

 Score = 38.5 bits (88), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 417 KIAKENSKNR-VKLEDCINFFTSDEILTGENAWNCPKC 453
           K+ + N+K R + L+DC+  F+  EIL   ++W CP C
Sbjct: 951 KLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 95/208 (45%), Gaps = 18/208 (8%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD----AETKISEPFARL 291
            + GL N GNTCY+NS +QCL     LRD F+ +  +   I  D     +  I++ F+ L
Sbjct: 300 GITGLTNLGNTCYMNSALQCLVHIPELRDYFLYD-GFTSEINSDNPLGYQGNIAKAFSLL 358

Query: 292 LLTMYENGGTSVIPKNFL-QQFSLLRPDLNIPKD---QQDTQEFLVILLDILHDELVYTD 347
           + +++     S   + F    F ++    N       QQD+QEFL  LLD LH++L    
Sbjct: 359 VKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYMQQDSQEFLAFLLDGLHEDLNRVH 418

Query: 348 D--------LISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCG 399
           D        L  N+ V+D   + K      + +L  N     DL F    E+ L+C  C 
Sbjct: 419 DKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRNDSIVTDL-FVALYESTLECPECR 477

Query: 400 NTSYNYSMFYMLSLAIPKIAKENSKNRV 427
           N S  +  +  L+L +P     +SK ++
Sbjct: 478 NVSITFDPYNDLTLPLPVNTTWHSKVKI 505

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 29/134 (21%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPL----ILNIIMKNNIDVVKYKLYG 580
            KQ+     P +L+IHL RF    + + K +  + +P+    +   ++  +     Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 581  LINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKD 640
            + NH GGL  GHYT+ V  +          +W+ FDD  + +    ++I           
Sbjct: 964  VDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPESSI----------- 1003

Query: 641  EFDSSKVYVLFYER 654
               +   Y+LFY R
Sbjct: 1004 ---AGSAYLLFYLR 1014

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 414 AIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           A  K A+   K  + L DC+  F+  E+L+  ++W CP C
Sbjct: 857 ARKKEAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 99/218 (45%), Gaps = 50/218 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK-------DAETKISEPFAR 290
           +GL N GNTCY+NS +QCL     LRD F+    YK F K+         +  ++  FA 
Sbjct: 342 IGLNNLGNTCYMNSALQCLVHIPQLRDYFL----YKVFEKEINLDNPLGYQGHVARSFAI 397

Query: 291 LLLTMYEN---GGTSVIPKNF---LQQF-SLLRPDLNIPKDQQDTQEFLVILLDILHDEL 343
           L+  ++++      S  P  F   +  F S+    L     QQD+QEF+  LLD LH++L
Sbjct: 398 LIQNLFKDELLPSLSYSPTTFKSTVGHFNSMFSGYL-----QQDSQEFIAFLLDGLHEDL 452

Query: 344 -------------VYTDDLISNNYV----SDDINLGKEYMPWLQNNLKANGKSPIDLIFQ 386
                        +  +D +SN  V    +DD         W  + L+ +  S I  IF 
Sbjct: 453 NRITNKPVVEKPSLKPEDDVSNQEVIKKLADDT--------WNSHLLRND--SIITDIFV 502

Query: 387 GQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSK 424
           G  ++ L C  C N S  +  +  L+L +P   K N+K
Sbjct: 503 GLYKSTLHCPECDNLSVTFDPYNDLTLPLPVDTKWNTK 540

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 62/136 (45%), Gaps = 30/136 (22%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYPLI---LNIIMKNNIDVVKYKLYGL 581
            KQL     P IL+IHL RF   S+   K +  + +P+    L+  + NN D  K  +Y L
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNN-DESKSTIYDL 1001

Query: 582  I---NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
            +   NH GGL  GHYT+ V        +  +++WY FDD  + +     +I         
Sbjct: 1002 VSVDNHYGGLGGGHYTAYVK-------NFVDKKWYYFDDSRVTETVPERSI--------- 1045

Query: 639  KDEFDSSKVYVLFYER 654
                 +   Y+LFY R
Sbjct: 1046 -----AGSAYLLFYMR 1056

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 422 NSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           + + ++ L+DC+N F   E+L   ++W CP C
Sbjct: 904 DGEKKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 94/210 (44%), Gaps = 18/210 (8%)

Query: 234 MLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLL 293
           M  +VGL N GNTCY+NS +QCL     LRD F     Y+  I  D     +   A    
Sbjct: 285 MTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFY-GGYEQEINLDNPLGYNGTVATAFG 343

Query: 294 TMYENGGTSVIPKNFLQQFSLLRPDLNIPKD--------QQDTQEFLVILLDILHDELVY 345
            + +N  +    +   Q +S  R  + + +         QQD+QEFL  LLD LH++L  
Sbjct: 344 NLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDLNR 403

Query: 346 TDD--------LISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQR 397
             D        L ++  ++D+ N  K+      +   A   S I+ +F G  ++ L+C  
Sbjct: 404 IHDKPYIEKPTLETSEELADE-NAVKQLAKKTWDAHLARNDSVINDLFVGMYKSTLKCPT 462

Query: 398 CGNTSYNYSMFYMLSLAIPKIAKENSKNRV 427
           C N S  +  +  L+L +P     N K ++
Sbjct: 463 CKNISITFDPYNDLTLPLPISTVWNKKVKI 492

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 34/140 (24%)

Query: 527 KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPL--------ILNIIMKNNIDVVKY 576
           KQL     P IL+IHL RF    + + K +AV+ +P+        +++ +++   D   Y
Sbjct: 879 KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVE---DGCIY 935

Query: 577 KLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFN 636
            L+ + NH GGL  GHYTS V  ++++       +WY FDD  +   +   ++       
Sbjct: 936 DLFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDDSRVSSTDPKKSV------- 981

Query: 637 IEKDEFDSSKVYVLFYERIE 656
                  +   Y+LFY + E
Sbjct: 982 -------AGSAYLLFYCKRE 994

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 423 SKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           S N + L+ C+  F+  E+L   ++W CPKC
Sbjct: 841 SPNIITLDSCLKLFSKPEVLGINDSWYCPKC 871

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 120/483 (24%), Positives = 199/483 (41%), Gaps = 88/483 (18%)

Query: 188 NPQRTLSTPKRSSTLMTESLSFVL---ARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQG 244
           NP+        S  L+T SL  +L   +R   +KK  + I + +  + +  +  GL N  
Sbjct: 25  NPRMWSRRAVSSGLLLTASLYVLLPSVSRAFNVKKGPLSI-EESKRLDRFTT--GLLNAR 81

Query: 245 NTCYINSMVQCLFGTKVLR---DLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGT 301
           N C++NS +Q L   + L    + F+      D  +     +++   A L+  ++E    
Sbjct: 82  NDCFLNSSLQALVPIESLTTYLNQFVEALHSVDEGQVFELERLAPLHANLIKLLHELQSL 141

Query: 302 SVIP-----KNFLQQFS-LLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYV 355
            V P     KN ++     LR  ++   DQ D  EF  ILL+ LH E +           
Sbjct: 142 IVKPQTVSAKNIVKTLEDTLRRKMS--SDQNDAHEFTQILLETLHSEYIK---------- 189

Query: 356 SDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYN-YSMFYMLSLA 414
                        LQ+N++  G  P    F+G   N L C +C   S   +S F ML +A
Sbjct: 190 -------------LQSNIEI-GSFP----FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVA 231

Query: 415 IPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRV 474
           +P    E      KL D I   + DEI+ G   ++C  C    I   +E       E   
Sbjct: 232 VPGNYSE------KLTDLI-LHSQDEIIEG---YSCLYCKVNMI-LKNEKYLNQLPEYSQ 280

Query: 475 KNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKL 534
           + +SI  LNF + +++L+    N               KN     N K   +K+   IK 
Sbjct: 281 EEQSI--LNFLR-NQILTLYI-NDDLPADVSFYVDHYSKNGCVTANFKSNIIKKNAVIKE 336

Query: 535 PPILVIHLSRFYYNSTK--KNNAVITYPLILNI---IMKNN----IDVVKYKLYGLINHQ 585
           P  L++HLSR  +N     ++   + Y   LN+   +M N+     + +KY+L  ++ H 
Sbjct: 337 PASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELKSVVKHT 396

Query: 586 GGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF-NIEKDEFDS 644
           G   +GHY                 Q Y    +++K+ N++  +N+        +D+FD+
Sbjct: 397 GSHVQGHY-----------------QCYRKKPDLMKERNTDTIVNRSPMIKKYSQDKFDA 439

Query: 645 SKV 647
           SK+
Sbjct: 440 SKI 442

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 110/249 (44%), Gaps = 41/249 (16%)

Query: 206 SLSFVL-ARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           S  FV+  +P +   H        +N+      +GL N GNTCY+NS +QC+    + RD
Sbjct: 297 SFDFVIETKPKQKSSHWPSNFLIYNNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRD 356

Query: 265 LFISEXXYKDFIKKDAETK-------ISEPFARLLLTMYENGGTSVIP------KNFLQQ 311
            F+    Y  F K+  E         ++  F+ L+ +++ +  TS         K+ L  
Sbjct: 357 YFL----YGTFQKEVNEGNPLGYQGYMARAFSDLIQSLFGDNITSTTAYSPSYFKSTLGH 412

Query: 312 F-SLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVS----------DDIN 360
           F S+    L     QQD+QEFL  LLD LH++L   D      YV           +D +
Sbjct: 413 FNSMFSGYL-----QQDSQEFLAFLLDSLHEDLNRID---KKPYVEKPSLPLTANLNDFD 464

Query: 361 LGKEYM--PWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKI 418
           + K      W  + L+    S I  +F    ++ L+C  C NTS  +  +  L+L +P  
Sbjct: 465 VVKRLADDTWKAHLLR--NDSVITDLFVAMYKSTLKCPECQNTSVTFDPYNDLTLPLPVA 522

Query: 419 AKENSKNRV 427
           +  ++K ++
Sbjct: 523 SIWHTKVKI 531

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 58/135 (42%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNSTKKNNAVIT--YPLI-----LNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    +  +  V T  +P+       +++ K +     Y L 
Sbjct: 973  KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLI 1032

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+       ++ + N+ +WY FDD  +       +I          
Sbjct: 1033 AVDNHYGGLGGGHYTA-------YAKNANDNKWYYFDDSRVSVTAPEKSI---------- 1075

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1076 ----AGSAYLLFYVR 1086

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 424 KNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           +  + L+DC+  F+  EIL+  ++W CP C
Sbjct: 936 ERHITLDDCLKLFSKPEILSSNDSWYCPHC 965

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 92/212 (43%), Gaps = 29/212 (13%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEX-----------XYKDFIKKDAETKISE 286
           +GL N GNTCY+NS +QCL     LRD F+               YK ++ K   + +  
Sbjct: 323 MGLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQN 382

Query: 287 PFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYT 346
            F     T+ + G  S    N  +        +     QQD+QEFL  LLD LH++L   
Sbjct: 383 LFGD---TITKQGTNSSFGPNHFKSTVGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRI 439

Query: 347 DDLISNNYVS----DDIN-------LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQC 395
            +  S    S    DD N       L  E   W  + L+ +  S I  +F G  ++ L+C
Sbjct: 440 INKPSTEKPSLKEGDDYNDPAVIKSLADE--TWKMHLLRND--SVITDLFVGMYKSTLEC 495

Query: 396 QRCGNTSYNYSMFYMLSLAIPKIAKENSKNRV 427
             C N S  +  +  L+L +P  +  +SK R+
Sbjct: 496 PECTNVSITFDPYSDLTLPLPVDSTWSSKVRI 527

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 30/136 (22%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLILNIIM------KNNIDVVKYKL 578
            K++     P +L+IHL RF    + + K +A + +P I N+ M      K++     Y L
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDL 964

Query: 579  YGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
            Y + NH GGL  GHYT+ V   +++       +WY FDD  + + +   ++         
Sbjct: 965  YAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRVYETDPEKSV--------- 1008

Query: 639  KDEFDSSKVYVLFYER 654
                 S   Y+LFY R
Sbjct: 1009 -----SGSAYLLFYLR 1019

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 421 ENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           + S   + L DC+N F+  E+L   ++W CP C
Sbjct: 866 DGSDKEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 17/113 (15%)

Query: 520 NEKLITLKQLNFIKLPPILVIHLSRFYYN---STKKNNAVITYPLILNIIMKNNID---- 572
           N K   ++QL   KLPP+LV+ L RF ++   S+ K N  I +P  L++      D    
Sbjct: 329 NTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGE 388

Query: 573 --VVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
              + Y+L GLI+HQG + +GHYTSI          +   QW+ F+D ++  +
Sbjct: 389 TPAIVYELIGLISHQGSVNQGHYTSICK--------IPGGQWFKFNDSMVTAV 433

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 90/204 (44%), Gaps = 34/204 (16%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK-------DAETKISEPF 288
            ++GL N GNTCY+NS +QCL     L + F+    YK + ++         +  ++  F
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFL----YKGYEREININNPLGHKGDVAHAF 392

Query: 289 ARLLLTMYE---NGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVY 345
             LL +++       T   P+NF          L     QQD+QEFL  LLD LH++L  
Sbjct: 393 GHLLYSLFAPSYGQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDL-- 449

Query: 346 TDDLISNNYV-------------SDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENC 392
            + +I   YV             +D I L    M W  + +K    S I  +F G  ++ 
Sbjct: 450 -NRVIEKPYVNKPEFPNDGQIDDTDQIVLLAANM-W--DYIKKRNDSVIMDLFVGLYKST 505

Query: 393 LQCQRCGNTSYNYSMFYMLSLAIP 416
           L C  C + S  +  +  L+L +P
Sbjct: 506 LVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 62/137 (45%), Gaps = 32/137 (23%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPL-------ILNIIMKNNIDVVKYK 577
            KQ+     P IL+IHL RF    + + K +A + +P+        L+   +   DV  Y 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDV--YD 993

Query: 578  LYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNI 637
            L  + NH GGL  GHYT+       +  +  + +WY FDD  + +++  N+I        
Sbjct: 994  LIAVDNHYGGLGGGHYTA-------YCRNFIDGKWYYFDDSRVNEVSPENSI-------- 1038

Query: 638  EKDEFDSSKVYVLFYER 654
                  +   Y+LFY R
Sbjct: 1039 ------AGSAYLLFYRR 1049

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 411 LSLA-IPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           LSL+ + K   +  K+ + L+ C+  F+  EIL   ++W CP C
Sbjct: 885 LSLSEVRKTRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 94/439 (21%), Positives = 175/439 (39%), Gaps = 89/439 (20%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLR----DLFISEXXYKDFIKKDAET-KISEPFARLLL 293
           GL N G TCY N+ VQ +     ++    D+ + +  Y   I K++ +  ++E   ++ L
Sbjct: 345 GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLLGK--YDSTISKNSVSYTLAETSKKMWL 402

Query: 294 TMYEN-----GGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVY 345
            + +N       + + PK+ + +      D+N       Q+D+ E+ + L+  L ++ V 
Sbjct: 403 PLSKNYKKNSPASYINPKHLISRLD----DINCMMSEWQQEDSHEYFMSLMSRLQEDSVP 458

Query: 346 TDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNY 405
               +  + + D                          IF G ++  + C+ CG+TS   
Sbjct: 459 KGHKLIESIIYD--------------------------IFGGLLKQIVTCKSCGSTSKTE 492

Query: 406 SMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEAD 465
             FY LSL + K  +    N   LED  +  ++    T  N         T  ++     
Sbjct: 493 QPFYDLSLHL-KGKRRLDSNPDLLEDNNSSTSAACSSTNSNT--------TIAQSSSSHS 543

Query: 466 SPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI- 524
             A + N   + ++N LN       +  S  +           +  G     Y  EK   
Sbjct: 544 VSANIHNATPDAAVNDLNSVNRRFSIEKSIRDFFNPELIKVDKEQKG-----YVCEKCHK 598

Query: 525 ---TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII-MKNNIDV-VKYK 577
               +K  + ++ P  L++HL +F +N  S+ K    ++YP+ L++    ++ D+ VKY+
Sbjct: 599 TTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQ 658

Query: 578 LYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFN 636
           L  ++ H+G  L+ GHY +   +         +  W  +DDE I K++            
Sbjct: 659 LLSVVVHEGRSLSSGHYIAHCKQP--------DGNWATYDDEYINKIS------------ 698

Query: 637 IEKDEFDSSKVYVLFYERI 655
            E+D       Y L Y R+
Sbjct: 699 -ERDVLKEPNAYYLLYTRL 716

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 99/208 (47%), Gaps = 37/208 (17%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD----AETKISEPFARL 291
            + GL N GNTCY+NS +QCL     LRD F+    ++D I  +     +  ++  F+ L
Sbjct: 291 GITGLYNLGNTCYMNSALQCLVHIPELRDYFLY-NCFEDEINCNNPLGYQGYVARAFSGL 349

Query: 292 LLTMYE----NGGTSVIP-------KNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILH 340
           +  ++     + G+++ P       K+ +  F+ +         QQD+QEF+  LLD LH
Sbjct: 350 VQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFSGYM----QQDSQEFITFLLDGLH 405

Query: 341 DELVYTDDLISNNYV----------SDDINLGKEYMP--WLQNNLKANGKSPIDLIFQGQ 388
           ++L   + ++   Y+          S+D N+ K      W + +L+ N     DL F G 
Sbjct: 406 EDL---NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTW-KLHLQRNDSVITDL-FVGL 460

Query: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIP 416
            E+ LQC  C N S  +  +  L+L +P
Sbjct: 461 YESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLI-----LNIIMKNNIDVVKYKLY 579
            KQ+     P +L+IHL RF    + + K + V+ +P+        ++ K +     Y L 
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+       ++ ++++ +WY FDD  + +      I          
Sbjct: 974  AVDNHYGGLGGGHYTA-------YAKNVDDSKWYYFDDSRVTETTPERGI---------- 1016

Query: 640  DEFDSSKVYVLFYER 654
                +S  Y+LFY R
Sbjct: 1017 ----ASSAYLLFYVR 1027

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 20/34 (58%)

Query: 420 KENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           ++  + ++ L DC+  F+  E+L   ++W CP C
Sbjct: 873 QQEEEKKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           ++++ LK     KLP IL +HL RF Y+  +  N      ITYPL L +  K +  V  K
Sbjct: 540 QRVVGLK-----KLPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKK 594

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H GG  + GHY S+   D           W  FDDE ++      T+++ + 
Sbjct: 595 YELTGVVLHMGGGPQHGHYVSVCKTD--------NFGWLFFDDETVE------TLDEPQV 640

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
            N   D   S+  YVLFY+  +
Sbjct: 641 LNFTGDTTTSTTAYVLFYKETD 662

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           + G  N GNTCY NS++QCLF     R+
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRN 140

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 22/131 (16%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL  L + L D   +TD+   N  ++D  ++         N L++N    I+ +
Sbjct: 425 HQDAHEFLNFLFNDLSD---FTDNY--NRKLADTRDV--------PNQLRSNF---INDL 468

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVK-LEDCINFFTSDEILT 443
           FQG   + ++C  C + + +   F    L  P I  E+SK+    +++ +  F   E+L 
Sbjct: 469 FQGTQTSKVRCLTCDSVTSHDERF----LDFP-IELEDSKDAATDIQEQLREFCQTELLH 523

Query: 444 GENAWNCPKCC 454
           G N + C +CC
Sbjct: 524 GANKFYCNECC 534

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 94/450 (20%), Positives = 164/450 (36%), Gaps = 141/450 (31%)

Query: 219 KHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK 278
           K ++P+    D       L GL N G+TC+++S++Q L     +    +++  Y     +
Sbjct: 123 KSSLPVAKGRD------GLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSRCDIQ 176

Query: 279 DAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD-----QQDTQEFLV 333
           D+ +  S    ++++  Y     +           LL       K+     QQD  EFL 
Sbjct: 177 DSSSCFSCALDQIVMNFYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQ 236

Query: 334 ILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKA-NGKSPIDLIFQGQIENC 392
             L+ LH               +D + +        Q N+KA N    +   FQG + + 
Sbjct: 237 FFLNQLH---------------ADHVRVA-------QTNVKAENCNCILHTAFQGSLRSS 274

Query: 393 LQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPK 452
           + C  C + S N +   M+ L++      + KN+  L +C+  F   E LT  N  +C  
Sbjct: 275 ILCTDCQDGS-NITFDPMMDLSL------DIKNKSTLVECLQSFHKGERLTDFNH-HCSS 326

Query: 453 CCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDG 512
           C               +V+N +K  +I  L                              
Sbjct: 327 C--------------GSVQNPIKQMTIAKL------------------------------ 342

Query: 513 KNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNII--- 566
                                 PP+LV+ L RF +    +  K N  ITYP  LN+    
Sbjct: 343 ----------------------PPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFC 380

Query: 567 ----MKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
                ++  D+V Y+L  +I+ +G + +GHYT +          +   QW+ F+D +I  
Sbjct: 381 HHSEARSVPDMV-YELVAVISQEGSVNQGHYTCMCK--------VPGGQWFRFNDTMIVS 431

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFY 652
           +   + + +              + Y+LFY
Sbjct: 432 ITEEDVLRQ--------------QAYLLFY 447

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 91/206 (44%), Gaps = 36/206 (17%)

Query: 235 LSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARL 291
           L + GL N GNTCY+NS +QC+    V R+ F+     K+    +    +  ++E F+ L
Sbjct: 318 LEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSEL 377

Query: 292 LLTMYENGGTSVIPKNFLQQFSLLRPD-----------LNIPKDQQDTQEFLVILLDILH 340
           +  ++ +          L QFS   P+           +     QQD+QEFL  LLD LH
Sbjct: 378 IRCLFGDK---------LVQFSAYAPNHFKATIGHFNSMFSGYLQQDSQEFLAFLLDSLH 428

Query: 341 DELVYTDDLISNNYV-------SDDINLGKEYMPWLQNNLKAN---GKSPIDLIFQGQIE 390
           ++L   D      YV       + D+N  +       +  KA+     S I  +F G  +
Sbjct: 429 EDLNRID---KKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRNDSVITDLFVGLYK 485

Query: 391 NCLQCQRCGNTSYNYSMFYMLSLAIP 416
           + L+C  C N S  +  +  L+L +P
Sbjct: 486 STLECPECQNISITFDPYNDLTLPLP 511

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYPLI-----LNIIMKNNIDVVKYKLY 579
            KQ+     P +L+IHL RF    +   K + V+ +P+       +++ K++     Y L 
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLI 989

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+       ++ +  + +WY FDD  + +  + N+I          
Sbjct: 990  AVDNHYGGLGGGHYTA-------YAKNSTDGKWYYFDDSRVTETVAENSI---------- 1032

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1033 ----TGAAYLLFYLR 1043

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 421 ENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           E     + L DC+N F+  EIL+  ++W CP C
Sbjct: 890 EEKNKEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 99/230 (43%), Gaps = 31/230 (13%)

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFI-- 267
           +  +P E   H V      + +       GL N GNTCY+NS +QCL     LRD F+  
Sbjct: 333 IEVKPVEGNHHWVSNHFVYNKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYN 392

Query: 268 ---------SEXXYKDFIKKDAETKISEPFARLLLTMYENGG-TSVIPKNFLQQFSLLRP 317
                    +   Y  ++ +     I + F   L  M  NG     + K+ +  F+ +  
Sbjct: 393 GYEKEINEENPLGYHGYVARAFSDLIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFS 452

Query: 318 DLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVS-------DDIN----LGKEYM 366
                  QQD+QEFL  LLD LH++L   + +I   Y+        DD+N    + K   
Sbjct: 453 GYM----QQDSQEFLAFLLDSLHEDL---NRIIKKAYIEKPSLSPDDDVNDWNVIKKLAD 505

Query: 367 PWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIP 416
              + +LK N +S I  +F G  ++ L C  C + S  +  +  ++L +P
Sbjct: 506 DTWELHLKRN-RSVITDLFVGMYKSTLYCPECKDVSTTFDPYNDVTLPLP 554

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 60/135 (44%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    +   K +  + +P     L  +++ K++     Y LY
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYDLY 1054

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V        +  + +WY FDD  + +    N++          
Sbjct: 1055 AVDNHYGGLGGGHYTAYVK-------NFMDNKWYYFDDSRVTETVPENSV---------- 1097

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1098 ----AGSAYLLFYIR 1108

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 417 KIAKENSKNR-VKLEDCINFFTSDEILTGENAWNCPKC 453
           K+ + N+K R + L DC+  F+  EIL   ++W CP C
Sbjct: 950 KLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 94/200 (47%), Gaps = 30/200 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD----AETKISEPFARLLL 293
           VGL N GNTCY+NS +QCL      +D F+    Y+  I  D     +  I+  F  L+ 
Sbjct: 349 VGLGNLGNTCYMNSALQCLVHIPEFKDYFLYN-AYEKEINVDNPLGHKGHIAWAFGTLIQ 407

Query: 294 TMY---ENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLI 350
           +++    N  +S  P++F      L   +     QQD+QEFL  LLD LH++L   + ++
Sbjct: 408 SLFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDL---NRIV 463

Query: 351 SNNYV-------SDDIN-------LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQ 396
              YV       +DD+        L  +   WL++ L+ N    +DL F G  ++ L C 
Sbjct: 464 DKPYVEKPELNPTDDVTEFETIKKLADD--TWLKHKLR-NDSVILDL-FVGLYKSTLICP 519

Query: 397 RCGNTSYNYSMFYMLSLAIP 416
            C   S  +  +  L+L +P
Sbjct: 520 TCKKVSTTFDPYNDLTLPLP 539

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLI-----LNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    + + K   ++ +P+        ++ K++     Y L 
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLI 1030

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V   L++       +WY FDD  + +     +I          
Sbjct: 1031 AVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERSI---------- 1073

Query: 640  DEFDSSKVYVLFYER 654
                +   Y+LFY R
Sbjct: 1074 ----AGSAYLLFYRR 1084

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 426 RVKLEDCINFFTSDEILTGENAWNCPKC 453
           ++ L DC+  F++ E+L   ++W CP C
Sbjct: 936 KITLHDCLTLFSTPEVLGATDSWYCPSC 963

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 96/436 (22%), Positives = 162/436 (37%), Gaps = 125/436 (28%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ L     ++  LF +    YK  I   + T++    A     M+
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQSVTQV---LAETTKRMW 181

Query: 297 ENGGTS---VIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDLI 350
            N  +    + PK  + +      D+N       Q+D+ E+ + L+  L ++ V     +
Sbjct: 182 SNESSKNQFINPKKLIGRLD----DINCMMSEWQQEDSHEYFMSLISRLQEDSVPRGHKL 237

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
           + + + D                          IF G +   + C+ CG  S      Y 
Sbjct: 238 TESILYD--------------------------IFGGLLRQEVTCKSCGEVSKTEQPIYD 271

Query: 411 LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATV 470
           LSL +    K+NS                    GE+A N       + E  +E     ++
Sbjct: 272 LSLHLK--GKKNSSQ------------------GESAKN-------SSEYEEEPQRRFSI 304

Query: 471 ENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKY---KNEKLITLK 527
           E  +++       FF    +                  K+D   K  Y   K  K     
Sbjct: 305 EKSIRD-------FFNPELI------------------KADKATKEGYVCEKCHKTTNAS 339

Query: 528 QLNFI-KLPPILVIHLSRFYYN--STKKNNAVITYPLILNII--MKNNIDV--VKYKLYG 580
           + NF+ + P  L++HL +F +N  S+ K    ++YP+ L++    +N+     VKY+L  
Sbjct: 340 KHNFLLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLIS 399

Query: 581 LINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
           ++ H+G  L+ GHY +   +         +  W  +DDE I K++             EK
Sbjct: 400 VVVHEGRSLSSGHYIAHCKQP--------DGSWSTYDDEYINKIS-------------EK 438

Query: 640 DEFDSSKVYVLFYERI 655
                   Y L Y R+
Sbjct: 439 QMLKEPGAYYLVYTRL 454

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 69/143 (48%), Gaps = 29/143 (20%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAV-----ITYPLILNIIMKNNIDVV- 574
           E+L+ LKQL     P  L +HL RF Y S K+N  +     I YPL LN+    N +V  
Sbjct: 547 ERLVGLKQL-----PDTLTLHLKRFKY-SEKQNCNIKLFNNIHYPLTLNVCSSINSEVCQ 600

Query: 575 KYKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTIN-KK 632
           KY+L G++ H GG  + GHY S+            +  W  FDDE ++ +     +    
Sbjct: 601 KYELAGIVVHMGGGPQHGHYVSLCKH--------QKFGWLLFDDETVEAVKEETVLEFTG 652

Query: 633 ESFNIEKDEFDSSKVYVLFYERI 655
           ES N+       +  YVLFY+ +
Sbjct: 653 ESANM-------ATAYVLFYKAV 668

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           + G  N GNTCY NS++QCL+    LR+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRE 166

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 99/449 (22%), Positives = 168/449 (37%), Gaps = 110/449 (24%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ +     ++  LF I    Y D I   + T +S   A     M+
Sbjct: 334 GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYSDTI---SPTSVSTVLAETSRRMW 390

Query: 297 -------ENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYT 346
                  +  GT + P   + +      D+N       Q+D+ E+ + L+  L ++ V  
Sbjct: 391 FPNEILKKKIGTYIDPNKLICRLD----DINCMMSEWQQEDSHEYFMSLMSRLQEDSVPK 446

Query: 347 DDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYS 406
              ++ + + D                          IF G ++  + C+ CG+ S    
Sbjct: 447 GHKMTESIIYD--------------------------IFGGLLKQAVTCKSCGSISKTEQ 480

Query: 407 MFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTT----IETYD 462
            FY LSL +        KN+  L       TS       N  N  +   TT    +E  +
Sbjct: 481 PFYDLSLHL------KGKNKSDLNINSEANTS-------NGGNTTQDSSTTENGSLEVGN 527

Query: 463 EADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEK 522
              +   V  + K  ++N    F + K +                 + D + K  Y  EK
Sbjct: 528 GKAATQQVSAQAKQLAVN--RKFSIEKSI--------KDFFNPELIRVDNEQKG-YVCEK 576

Query: 523 LI----TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII---------M 567
                   K+ + ++ P  L++HL +F +N  S+ K    ++YP+ L++           
Sbjct: 577 CHKTTNAAKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTKYCDKEATPK 636

Query: 568 KNNIDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSN 626
             ++  VKY+L  ++ H+G  L+ GHY +   +         +  W  +DDE I K+   
Sbjct: 637 GQDVLPVKYQLISVVVHEGRSLSSGHYIAHCKQP--------DGSWSTYDDEYINKI--- 685

Query: 627 NTINKKESFNIEKDEFDSSKVYVLFYERI 655
                      E+D    S  Y L Y R+
Sbjct: 686 ----------TERDVLRESNAYYLVYTRL 704

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 31/135 (22%)

Query: 526 LKQLNFIKLPPILVIHLSRFYYNSTKKN---NAVITYPLILNI-----IMKNNIDVVKYK 577
           +KQL   KLPP+LV+ L RF + +  +N   NA I +P  LN+       +NN  ++ Y+
Sbjct: 323 IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSII-YE 381

Query: 578 LYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNI 637
           L G+I+H G + +GHY +        +L L+   W+ F+D ++               +I
Sbjct: 382 LNGVISHIGTVNEGHYIA--------TLKLDSNNWFKFNDSMVT--------------SI 419

Query: 638 EKDEFDSSKVYVLFY 652
            ++E    + Y+LFY
Sbjct: 420 SEEEVLKDQAYLLFY 434

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 90/198 (45%), Gaps = 23/198 (11%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARLLLT 294
            GL N GNTCY+NS +QCL     LRD F+      +  +++       ++  F+ L+  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 295 MYENGGTSV-----IPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
           ++ N  +S+      P +  +        +     QQD+QEFL  LLD LH++L   + +
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDL---NRI 480

Query: 350 ISNNYVS-------DDIN----LGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
           I   Y+        DD+N    + K      + +LK N     DL F G  ++ L C  C
Sbjct: 481 IKKAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNCSVITDL-FVGLYKSTLYCPEC 539

Query: 399 GNTSYNYSMFYMLSLAIP 416
            N S  +  +  ++L +P
Sbjct: 540 KNVSITFDPYNDVTLPLP 557

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYPLIL-----NIIMKNNIDVVKYKLY 579
            KQ+     P IL++HL RF    +   K +A + +P+       +++ K++     Y LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V        +  + +WY FDD  + +    N+I          
Sbjct: 1058 AVDNHYGGLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVPENSI---------- 1100

Query: 640  DEFDSSKVYVLFYER 654
                S   Y+LFY R
Sbjct: 1101 ----SGSAYLLFYIR 1111

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 411 LSLAIPKIAKENSKNRV-KLEDCINFFTSDEILTGENAWNCPKC 453
           + L   K+ + N+K R+  L+DC+  F+  EIL   ++W CP C
Sbjct: 947 IELENAKLERSNAKERIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 70/143 (48%), Gaps = 29/143 (20%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAV-----ITYPLILNIIMKNNIDVV- 574
           E+L+ LKQL     P  L +HL RF Y S K+N  +     I YPL LN+    N +V  
Sbjct: 550 ERLVGLKQL-----PDTLALHLKRFKY-SEKQNCNIKLFNNIRYPLTLNVCSSINSEVCQ 603

Query: 575 KYKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTIN-KK 632
           KY+L G++ H GG  + GHY S+   +        +  W  FDDE ++ +     +    
Sbjct: 604 KYQLAGIVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTG 655

Query: 633 ESFNIEKDEFDSSKVYVLFYERI 655
           ES N+       +  YVLFY+ +
Sbjct: 656 ESPNM-------ATAYVLFYKAM 671

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 215 AEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           A I   ++P  D ++ +       G  N GNTCY NS++QCL+    LR+
Sbjct: 124 ATIASESMPYGDGSNKV------FGYENFGNTCYCNSVLQCLYNLSSLRE 167

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 49/137 (35%), Gaps = 31/137 (22%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSP---- 380
            QD  EF   LL+ L +            Y+       +E    L+N    NG       
Sbjct: 432 HQDAHEFFNFLLNELSE------------YIE------RENQNMLENGNSVNGSGGLNKN 473

Query: 381 ---IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFT 437
              I+ +FQG + N ++C  C N +     F    + +             ++  +  + 
Sbjct: 474 ANFINNLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEV------QGDEETDIQAILKSYH 527

Query: 438 SDEILTGENAWNCPKCC 454
             E+L G N + C +CC
Sbjct: 528 QREMLNGSNKFYCDECC 544

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 68/140 (48%), Gaps = 29/140 (20%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAV-----ITYPLILNIIMKNNIDVV- 574
           E+L+ LKQL     P  L +HL RF Y S K+N  +     I YPL LN+    N +V  
Sbjct: 549 ERLVGLKQL-----PDTLALHLKRFKY-SEKQNCNIKLFNDIHYPLTLNVCSSINSEVCQ 602

Query: 575 KYKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTIN-KK 632
           KY+L G++ H GG  + GHY S+   ++          W  FDDE ++ +     +    
Sbjct: 603 KYELSGIVVHMGGGPQHGHYVSLCKHEI--------FGWLLFDDETVEAVKEEAVLEFTG 654

Query: 633 ESFNIEKDEFDSSKVYVLFY 652
           ES N+       +  YVLFY
Sbjct: 655 ESPNM-------ATAYVLFY 667

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           + G  N GNTCY NS++QCL+    +R+
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRE 167

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 30/74 (40%), Gaps = 6/74 (8%)

Query: 381 IDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDE 440
           I  +FQG + N ++C  C N +     F    + +             ++  +  +   E
Sbjct: 476 ISNLFQGTLTNQIKCLTCDNVTSRDEPFLDFPIEV------QGDEETDIQAILKSYHQRE 529

Query: 441 ILTGENAWNCPKCC 454
           +L G N + C KCC
Sbjct: 530 MLNGPNKFYCDKCC 543

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 101/453 (22%), Positives = 176/453 (38%), Gaps = 130/453 (28%)

Query: 219 KHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK 278
           K  VP ++  D       L GL N G+TC+++S++Q L       +  IS+   K    +
Sbjct: 124 KTVVPSVERRD------GLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQ 177

Query: 279 DAETKISEPFARLLLTMYENGGTS---VIPKNFLQQF-SLLRPDLNIPKD-----QQDTQ 329
           D ++ IS    +++   Y +   S   V P+     F  LL     I ++     QQD  
Sbjct: 178 DPKSCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYSQQDAH 237

Query: 330 EFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQI 389
           EF   LL+ LH +         N+ +SDD+     +                   FQG +
Sbjct: 238 EFWQFLLNQLHHDFQVCSGKGVNDAISDDLCTCIAHST-----------------FQGLL 280

Query: 390 ENCLQCQRCGNTS-YNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAW 448
           ++ + C  C N S      F  LSL I        K++  L +C++ F   E L   N +
Sbjct: 281 KSSIVCPDCQNDSKTTIDPFMDLSLDI--------KDKSNLYNCLDSFHKKERLHDFN-Y 331

Query: 449 NCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXX 508
           +CP C                        +I  L+ +KL  VL                 
Sbjct: 332 HCPNC-------------------NTSQDAIKRLSIYKLPSVLVLQLK------------ 360

Query: 509 KSDGKNKNKYKNEKLI---TLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNI 565
                     + E L+   +LK  +FI+ PP L +   R Y +S                
Sbjct: 361 ----------RFEHLLNGNSLKLNDFIEYPPYLNM---RDYCSSG--------------- 392

Query: 566 IMKNNIDV--VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
              +++DV  + Y+L G++ H+G + +GHY +        +  +  +QW+ F+D ++   
Sbjct: 393 --DSDVDVPDLIYELIGVVAHKGTVNEGHYVA--------TTKVAGRQWFKFNDSMV--- 439

Query: 624 NSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
              +++ ++E+ N         + Y+LFY  ++
Sbjct: 440 ---SSVTQEEALN--------EQAYLLFYSVLQ 461

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 67/141 (47%), Gaps = 25/141 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           E+ + LKQL     P  L +HL RF Y+ TK +N      + YPL L++    +  V  K
Sbjct: 603 ERSVGLKQL-----PHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKK 657

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H GG  + GHY S+   D           W  FDDE ++      ++++K  
Sbjct: 658 YELSGIVVHMGGGPQHGHYVSLCKND--------NFGWLLFDDETVE------SVSEKTV 703

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
            +   D    +  YVLFY  +
Sbjct: 704 LDFVGDSSTLTTAYVLFYREL 724

 Score = 38.5 bits (88), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 26/130 (20%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL  LL+ L D            Y+++    GK+      N +K         I
Sbjct: 494 HQDAHEFLNFLLNELSD------------YLNNGAKSGKDDEEHSLNFIKD--------I 533

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           FQG + N ++C  C N +     F    + +P  ++        ++  +  F   E+L+G
Sbjct: 534 FQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDSE------TDIQALLQNFDQREMLSG 587

Query: 445 ENAWNCPKCC 454
            N + C  CC
Sbjct: 588 PNKFYCNVCC 597

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 227 ATDNIP---KMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263
           +T+N+P       + G  N GNTCY NS++QCL+     R
Sbjct: 117 STENMPYGDGSNKVFGFENFGNTCYCNSVLQCLYNMTEFR 156

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 15/114 (13%)

Query: 526 LKQLNFIKLPPILVIHLSRFYYNSTKKN---NAVITYPLILNI----IMKNNIDVVKYKL 578
           +KQL   +L P LV+ L RF + ++ +N   N  + +PL L++            + Y+L
Sbjct: 339 IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 579 YGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
            G+++H G + +GHYT++        L LN  +W+ F+D +I  +++ + + ++
Sbjct: 399 SGVVSHSGTVNEGHYTAV--------LQLNSGEWFKFNDSMISVVSAEDVLREQ 444

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 24/151 (15%)

Query: 516 NKYKNEKLITLKQ----LNFIKLPPILVIHLSRFYYNSTKKNNAV----ITYPLILNIIM 567
           NK+   +  TL++    +   KLP  L +HL RF Y+     N      I YPL LN+  
Sbjct: 603 NKFYCSQCCTLQEAQRTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSS 662

Query: 568 KNNIDVVK-YKLYGLINHQGGL-TKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
                + K YKL G++ H G    +GHY +I   D        +  W  FDDE       
Sbjct: 663 SFTSSISKKYKLQGIVVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETA----- 709

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFYERIE 656
            + IN++E  +   DE   +  YVLFYE ++
Sbjct: 710 -SWINEEEVLSFIGDEKSQNTAYVLFYEEVK 739

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 6/36 (16%)

Query: 222 VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLF 257
           +P  D ++ I       G  N GNTCY NS++QCL+
Sbjct: 145 IPFGDGSNKI------FGYENFGNTCYCNSVLQCLY 174

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 156/369 (42%), Gaps = 65/369 (17%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           + GL N GNTC++NS++Q L  +K L      +   ++  + + + K +E    LLL + 
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELAAFL--DNVIENGSENNGDIKFTETLRELLLIL- 113

Query: 297 ENGGTSVIPKNFLQQFSLLRPDLNIPK-------DQQDTQEFLVILLDILHDEL------ 343
                    K + +   LL+   N P        DQ+D QEF   +L  L   +      
Sbjct: 114 --NKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTE 171

Query: 344 -------VYTDDLISNNYVS-DDI-NLGKEYMPWLQ---NNLKANGK----SPIDLI--F 385
                  +   DL  +  +  DD+ N+G  Y+P  Q   N++  N      SP  LI   
Sbjct: 172 KKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLITPL 231

Query: 386 QGQIENCLQCQRCG-NTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
            G     + C  CG N    YS+F  LSL +P  ++  +++ +KL + +N +   EI+ G
Sbjct: 232 DGITAERIGCLTCGENGGIRYSVFSGLSLNLP--SESLNQSTLKLSELLNEWVKPEIIEG 289

Query: 445 ENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXX 504
                C +C    + ++        ++++++N +I      KL   ++            
Sbjct: 290 ---VECNRCSLNAVRSH--------LQDQIQNDTIPE----KLKIAINQRLNLLTEILSK 334

Query: 505 XXXXKSDGKNKNKYKNEKLI----TLKQLNFIKLPPILVIHLSRFYYNS----TKKNNAV 556
               + D K   KY  E ++      KQ+   + PP L IH++R  ++      +KNNA 
Sbjct: 335 PVIEEDDYK---KYHTENMVRKCSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNAR 391

Query: 557 ITYPLILNI 565
           + +   LN+
Sbjct: 392 VLFKTRLNL 400

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 69/143 (48%), Gaps = 29/143 (20%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAV-----ITYPLILNIIMKNNIDVV- 574
           E+L+ LKQL     P  L +HL RF Y S K+N  +     I YPL LN+    N  V  
Sbjct: 547 ERLVGLKQL-----PDTLTLHLKRFKY-SEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQ 600

Query: 575 KYKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTIN-KK 632
           KY+L G++ H GG  + GHY S+   +        +  W  FDDE ++ +     +    
Sbjct: 601 KYELAGIVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTG 652

Query: 633 ESFNIEKDEFDSSKVYVLFYERI 655
           ES N+       +  YVLFY+ +
Sbjct: 653 ESPNM-------ATAYVLFYKAM 668

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           + G  N GNTCY NS++QCL+    LR+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRE 166

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 19/130 (14%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EF   LL+ L + +   +  I+    + DIN   E          +  K+ I  +
Sbjct: 431 HQDAHEFFNFLLNELSEYIERENKKIA----ASDINSDSE---------PSKSKNFISDL 477

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           FQG + N ++C  C N +     F    + +             +++ +  +   E+L G
Sbjct: 478 FQGTLTNQIKCLTCDNITSRDEPFLDFPIEV------QGDEETDIQEILKSYHQREMLNG 531

Query: 445 ENAWNCPKCC 454
            N + C +CC
Sbjct: 532 SNKFYCDECC 541

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 68/143 (47%), Gaps = 27/143 (18%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           E+++ LKQL     P IL +HL RF Y+  +K+N      I YPL L++    N  V  K
Sbjct: 546 ERMVGLKQL-----PHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKK 600

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G++ H G G   GHY  I           NE+  W  +DDE ++      +I ++ 
Sbjct: 601 YELSGVVIHMGSGPQHGHYVCICR---------NEKFGWLLYDDETVE------SIKEET 645

Query: 634 SFNIEKDEFDSSKVYVLFYERIE 656
                    D +  YVLFY+  +
Sbjct: 646 VLQFTGHPGDQTTAYVLFYKETQ 668

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 68/142 (47%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           E+++ LKQL     P  L +HL RF Y+  +  N      + YPL L++    +  +  K
Sbjct: 533 ERIVGLKQL-----PHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKK 587

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H GG  + GHY S+   D        +  W  FDDE ++      ++ +K  
Sbjct: 588 YELTGVVIHMGGSPQHGHYVSLCKND--------KFGWLLFDDETVE------SVTEKTV 633

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
                D  + +  YVLFY+ ++
Sbjct: 634 LEFTGDSSNQATAYVLFYKELD 655

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 40/138 (28%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDL- 383
           QQD  EFL  LL+ L +                          +LQN++      P D+ 
Sbjct: 422 QQDAHEFLNFLLNELSE--------------------------YLQNHISHPSNKPTDIP 455

Query: 384 -------IFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFF 436
                  +FQG + N ++C  C N +     F  L   I     EN    + ++D +  +
Sbjct: 456 FKNYVIDLFQGVLTNRIKCLTCDNITSRDEPF--LDFPIGVKGDEN----IDIQDVLRCY 509

Query: 437 TSDEILTGENAWNCPKCC 454
            + E+L G N + C +CC
Sbjct: 510 HTREMLNGSNKFYCSQCC 527

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+    LR
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 99/257 (38%), Gaps = 46/257 (17%)

Query: 209 FVLARPAEIKKHTVPIIDATDNIPKML---SLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           F+    AEI       +     +P  L    L GL N G+TC+++S++Q +       + 
Sbjct: 101 FMADLVAEIPASQWDTVMEKTELPASLHRDGLQGLVNMGSTCFMSSIIQTIIHNPYFVED 160

Query: 266 FISEXXYKDFIKKDAETKISEPFARLLLTMYENG-GT---SVIPKNFLQQFSLLRPDLNI 321
            +S     +   K     +S     +    Y NG GT   S + K F+   +LL    +I
Sbjct: 161 LLSHKHCNNCDIKSGTKCVSCALDEIACDFYGNGPGTGKSSSVSKGFV---NLLSASWHI 217

Query: 322 -----PKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKAN 376
                   QQD  E+   LL+ LH +                   G    P        +
Sbjct: 218 NHHLVGSSQQDAHEYWQFLLNQLHTDHARV--------------FGSSKAP--------D 255

Query: 377 GKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFF 436
            +     IFQG ++N LQC +CG +         LSL I        KN  KLEDC++ F
Sbjct: 256 CQCITHRIFQGYLKNTLQCSQCGFSKTTIDPIMDLSLEI--------KNNPKLEDCLDHF 307

Query: 437 TSDEILTGENAWNCPKC 453
             +E LT +  + C  C
Sbjct: 308 QREETLT-DFHYECQSC 323

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 31/137 (22%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI------IMKNNIDVVK 575
            +KQL   K P +LVI L RF +     + K N  + +PL LN+      I    I  + 
Sbjct: 329 VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           Y L  +++HQG + +GHYT++   +        + QW+ F+D V+  +     + +    
Sbjct: 389 YDLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTEEQVLEQ---- 436

Query: 636 NIEKDEFDSSKVYVLFY 652
                     + Y+LFY
Sbjct: 437 ----------QAYLLFY 443

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 162/385 (42%), Gaps = 84/385 (21%)

Query: 239 GLRNQGNTCYINSMVQCLFGTK--------VLRDL-FISEX------XYKDFIKKDAETK 283
           GL N+GN C+INS +Q L G++        VLR L F++E        Y   + +     
Sbjct: 70  GLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNENPKQEGNRYALPLHQVMAEF 129

Query: 284 ISEPFARLLLTMYENGGTSVIPKN--FLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHD 341
           I +  A   L   E+    ++     F Q+ S         + Q D QEF  +LL++LH+
Sbjct: 130 IYDLQAPTFLNTVESSDKIIVTMESIFKQKMS---------RRQNDAQEFTQLLLEVLHN 180

Query: 342 ELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCG-N 400
           E  Y + +   N++++++++     P                 F+G+  + L C +CG N
Sbjct: 181 E--YQELIRLMNFITNNLDIPT--YP-----------------FEGKYCHELTCLKCGRN 219

Query: 401 TSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIET 460
           +      F +L+L +P      ++  + L++ I+   SD I      ++C  C  + I  
Sbjct: 220 SEVKMFDFDILTLNLP------AQPSISLDELISGSNSDVI----EGFSCTVCKVSAILG 269

Query: 461 YDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKN 520
                +P T   R   KS        L ++      N            S   +    +N
Sbjct: 270 GTGTHNPNT---RSLIKS--------LKEIFPELKINTELDEPLNSFVDSYSHDGVITRN 318

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITY--------PLILN--IIMK 568
            K   +K+  F+++P IL+IHL+R  +N  S  +N   I Y         L+++   +M+
Sbjct: 319 IKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSVMR 378

Query: 569 NNIDVVKYKLYGLINHQGGLTKGHY 593
           NNI   +Y L   I H G  + GHY
Sbjct: 379 NNI---QYTLSSAIKHSGSHSMGHY 400

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQL     P IL +HL RF Y+  K  N      + YPL LN+    +  + K 
Sbjct: 637 ERIVGLKQL-----PHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKA 691

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H G   + GHY S+   D        +  W  FDDE ++      ++++   
Sbjct: 692 YELTGVVIHMGSSPQHGHYVSLCKND--------KFGWLLFDDETVE------SVSESTV 737

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
                D  + +  YVLFY+ I+
Sbjct: 738 LEFTGDPNNQATAYVLFYKEIK 759

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 50/130 (38%), Gaps = 36/130 (27%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
           QQD+ EFL  LL+ L D                       Y+P   NN   N       +
Sbjct: 538 QQDSHEFLNFLLNELRD-----------------------YLPSTTNNFITN-------L 567

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           FQG + N ++C  C N +     F    + +    + N      +E  +  + + E+L G
Sbjct: 568 FQGILTNQIKCLTCDNITSRDEPFLDFPIGVKDDEETN------IETLLRNYHTREMLNG 621

Query: 445 ENAWNCPKCC 454
            N + C +CC
Sbjct: 622 SNKFYCNQCC 631

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 237 LVGLRNQGNTCYINSMVQCLF 257
           + G  N GNTCY NS++QCL+
Sbjct: 171 VFGYENFGNTCYCNSVLQCLY 191

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 19/106 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LK     KLP  L++HL RF Y+  + +N      I YPL+L +   +N D+ K 
Sbjct: 512 ERIVGLK-----KLPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKS 566

Query: 576 YKLYGLINH-QGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G++ H  GG   GHY SI   +        +  W  FDDEV+
Sbjct: 567 YDLTGIVLHLGGGPQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           + G  N GNTCY NS++QCL+    LRD  I
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRDNVI 141

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 25/141 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNN----AVITYPLILNIIMK-NNIDVVK 575
           E+ + LK     KLP  L++HL RF Y+  + +N    + + YPLIL +       D +K
Sbjct: 510 ERAVELK-----KLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIK 564

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H G G   GHY ++   +        +  W  +DDE ++      +++++  
Sbjct: 565 YELSGIVIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVE------SVSEETV 610

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
                DE   S  YVLFY+++
Sbjct: 611 LKFIGDEKTQSTAYVLFYKKL 631

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+L+ LK L     P  L +HL RF Y+  K  N      I YPLILN     +  V K 
Sbjct: 556 ERLVGLKSL-----PKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKS 610

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H G G   GHY S+ + +L          W  FDDE ++ ++ +  ++   S
Sbjct: 611 YRLQGVVVHMGNGPHHGHYVSLCHTEL--------FGWLLFDDETVESVDESYVLDFVGS 662

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
                     +  YVLFY  I+
Sbjct: 663 HE------SPTTAYVLFYSEID 678

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 237 LVGLRNQGNTCYINSMVQCLF 257
           + G  N GNTCY NS++QCL+
Sbjct: 160 VFGYENFGNTCYCNSVLQCLY 180

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 25/123 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNIIMKNNIDVVK-------- 575
           KQL   KL P+L+    RF +    S+ K N VI +PL LN  MK+  DV +        
Sbjct: 345 KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLN--MKDYCDVEQRDDSNSKP 402

Query: 576 ---YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
              Y+L G+I H G + +GHYT+I          + E QW  F+D ++  + S  T+ K+
Sbjct: 403 DLIYELIGIICHTGTVNEGHYTAICK--------IPEGQWIKFNDSMVTII-SEETMLKE 453

Query: 633 ESF 635
           +++
Sbjct: 454 QAY 456

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 54/134 (40%), Gaps = 19/134 (14%)

Query: 219 KHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK 278
           K  +P++   D       L GL N G+TCY++ ++QCL          +++  +K     
Sbjct: 124 KSCIPLMSKRD------GLSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTH 177

Query: 279 DAETKISEPFARLLLTMYENGGTS-----VIPKNFLQQFSLLRPDLNIPKD-----QQDT 328
           D  T IS     ++   Y   G S     V   N      LL     I ++     QQD 
Sbjct: 178 DPTTCISCALDSIVTDFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGYSQQDA 234

Query: 329 QEFLVILLDILHDE 342
            EF   LL+ LH E
Sbjct: 235 HEFWQFLLNRLHSE 248

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 81/200 (40%), Gaps = 24/200 (12%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA---ETKISEPFARLLLT 294
           +GL N G+TC+INS++QCL     LRD F+      +   +++     +++  FA ++  
Sbjct: 351 MGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQA 410

Query: 295 MYENGGT---SVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLIS 351
           ++ +      +    NF       RP L  P  QQD+ E +  LL  LH++L    +   
Sbjct: 411 LFGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRAPEGPR 469

Query: 352 NNYVSDDINLGKEYMPWLQNNLKANGK---------------SPIDLIFQGQIENCLQCQ 396
                +   +G           +  G+               S I  +F G +++ L C 
Sbjct: 470 VGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSVITDLFAGMLKSTLTCL 529

Query: 397 RCGNTSYNYSMFYMLSLAIP 416
            C  +S  +       LA+P
Sbjct: 530 TCRRSSVTFDP--CTELAVP 547

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 39/145 (26%)

Query: 527  KQLNFIKLPPILVIHLSRF--YYNSTKKNNAVITYPLILNIIMKNNIDVVK--------- 575
            +Q+     P IL++HL RF  +Y+ST K N  + +PL   + M  ++             
Sbjct: 967  RQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLT-GLDMSPHLPCRDGDGDGDGDD 1025

Query: 576  ------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTI 629
                  Y L  + NH GGL  GHYT+ V   ++        +WY FDD  ++++++ +  
Sbjct: 1026 GGRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVDAESVA 1078

Query: 630  NKKESFNIEKDEFDSSKVYVLFYER 654
                          SS  Y+LFY R
Sbjct: 1079 --------------SSFGYLLFYRR 1089

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 410 MLSLAIPKIAKENS---KNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           M+++ + ++  E +   K    LEDC++ FT+ E+L   ++W CP C
Sbjct: 913 MVNVELERVRHERAGRQKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 87/207 (42%), Gaps = 35/207 (16%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA----ETKISEPFARLLL 293
           +GL N GNTCY+NS +QCL       + F+    Y+  I  D     +  ++  F +L+ 
Sbjct: 414 LGLVNLGNTCYMNSALQCLIHLPKFNEYFLL-NGYQKEINLDNPIGYQGNVANAFGKLIH 472

Query: 294 TMYEN------------GGTSVIPKNFLQQF----SLLRPDLNIPKDQQDTQEFLVILLD 337
            ++E                S  P NF        S+    L     QQD+QEFL  +LD
Sbjct: 473 KLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL-----QQDSQEFLAFILD 527

Query: 338 ILHDEL--------VYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQI 389
            LH++L        V    L  N+   D   + K      + +LK N     DL F G  
Sbjct: 528 GLHEDLNRILKKPFVEKPSLPENSNYKDYKVIKKLADDTWEAHLKRNDSIVTDL-FVGMY 586

Query: 390 ENCLQCQRCGNTSYNYSMFYMLSLAIP 416
           ++ LQC  C N S  +  +  L+L +P
Sbjct: 587 KSTLQCPDCHNVSVTFDPYNDLTLPLP 613

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 59/135 (43%), Gaps = 28/135 (20%)

Query: 527  KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP-----LILNIIMKNNIDVVKYKLY 579
            KQ+     P IL+IHL RF    +   K +AV+ +P     L  +I+  +      Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 580  GLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEK 639
             + NH GGL  GHYT+ V        +  +Q+WY FDD  +   +   +I          
Sbjct: 1164 AVDNHYGGLGGGHYTAYVK-------NFVDQKWYYFDDSRVSLADPQRSI---------- 1206

Query: 640  DEFDSSKVYVLFYER 654
                S   Y+LFY R
Sbjct: 1207 ----SGSAYLLFYVR 1217

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 427  VKLEDCINFFTSDEILTGENAWNCPKC 453
            + L+DC+  F+  EIL  +++W CP C
Sbjct: 1070 ILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 110/283 (38%), Gaps = 47/283 (16%)

Query: 321 IPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSP 380
           I   Q D  E   ++L+ L  E +     + NN    DIN+    +P             
Sbjct: 255 ISTGQNDAHELTQVILETLQKENMKLRKFVKNN----DINVSIPELP------------- 297

Query: 381 IDLIFQGQIENCLQCQRCGNTS-YNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSD 439
               F GQ+ + L C +C N+S  N   F +  L +P+          KL D ++   +D
Sbjct: 298 ----FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQAMS------AKLSDMVSDNQTD 347

Query: 440 EILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXX 499
            I      ++C  C  +TI  Y++    A      K           L   L   + N  
Sbjct: 348 TI----EGYSCLTCKVSTIVNYEKGRGYAKCTQEEKRI------LKTLEDALPDMAINDE 397

Query: 500 XXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVI 557
                     S  K+     + K   +K+   ++ P  LV+HLSR  ++  S ++N+  +
Sbjct: 398 LSDELTSYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGV 457

Query: 558 TYPLIL----NIIMKN---NIDVVKYKLYGLINHQGGLTKGHY 593
            +  IL     +I  N    I+ + YKL  ++ H G  ++GHY
Sbjct: 458 AFDEILESREQVIRHNKCVGINPISYKLKAIVAHSGSHSQGHY 500

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 105/463 (22%), Positives = 170/463 (36%), Gaps = 99/463 (21%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDL---FI-----SEXXYKDFIKKDAET-----KIS 285
           GL N+GN CY NS++Q L       D    F+     +E       K D E       ++
Sbjct: 73  GLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGIDENEISSAGLEKTDTEALLLHRALA 132

Query: 286 EPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVY 345
           +   +L + ++E     +  K+ +      +    + + Q D  EFL +LL+ LH EL  
Sbjct: 133 DLLRKLQMVIFEPTNADI--KHLVSVLEW-KVSGRLSRAQNDAHEFLQVLLEQLHVEL-- 187

Query: 346 TDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQI---ENCLQCQRCGNTS 402
                SN++ +                  ++ K P    F G I     CLQCQ    T+
Sbjct: 188 -----SNSHKT------------------SSCKFP----FAGTIIESYKCLQCQH--ETA 218

Query: 403 YNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYD 462
              S F +    +P+      K  + L D +    S+EI+   + + C  C   ++ T +
Sbjct: 219 PKKSTFNIFEAPLPQ------KYEIDLNDVL-MRNSNEII---DDYKCMVCLIRSVITLE 268

Query: 463 EADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEK 522
            A   +     +K K         L K L   + N            +  K   K    +
Sbjct: 269 RAHGFSGTAESIKGK------LLALEKKLPDITINEEFDIELQNYLDTYCKYGFKNNVAR 322

Query: 523 LITLKQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYPLILNIIMKNNIDV------- 573
              LKQ  F+  P I VIHLSR  YN     +N   + +   L+                
Sbjct: 323 RSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTK 382

Query: 574 -VKYKLYGLINHQGGLTKGHYTSIVNKDL-----------NHSLDLNEQQWYNFDDEVIK 621
            V+Y+L  ++ H G    GHY  +  K +           N    + E++    D    +
Sbjct: 383 RVRYRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRR 442

Query: 622 K---------LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
                     L S+  + +K   +I  ++     VY+LFYERI
Sbjct: 443 MKSTTIYPFWLISDTNVKEKRISDIVNEQ---KSVYMLFYERI 482

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI-------IMKNNIDVVK 575
           K + F   PPIL + L RF Y+       K N    +P  +++        ++ N +  K
Sbjct: 384 KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           Y L+G++ H G ++ GHY +++  DL       + QWY FDDE + K+        +E+F
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDL-------QDQWYRFDDEKVWKVTKKQVF--EENF 494

Query: 636 NIEK 639
            + K
Sbjct: 495 GMNK 498

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 83/217 (38%), Gaps = 47/217 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAET-KISEPFARL 291
           K+   VG RNQG TCY+NS++Q  F TK  R L          I  + E+   S P A  
Sbjct: 202 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYQ-------IPTENESPNDSVPLA-- 252

Query: 292 LLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLIS 351
           L   +     S IP + L+       D      Q D QE   IL+D L + +  T     
Sbjct: 253 LQRAFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGT----- 307

Query: 352 NNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                                    GK  ++ +F G++++ ++C      S     F+ L
Sbjct: 308 ----------------------PVEGK--LNELFVGKMKSYIKCINVDYESSRVEDFWDL 343

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAW 448
            L        N KN   LE+    +   E++ GEN +
Sbjct: 344 QL--------NVKNLKGLEESFKNYIEIELMNGENQY 372

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 66/136 (48%), Gaps = 32/136 (23%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYN---STKKNNAVITYPLILNIIMKNNIDV-----VKY 576
            +K+L   KLP +LV+ L RF ++   ++ K N ++ +PL LN  M+N  D      + +
Sbjct: 348 AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLN--MRNYCDGDDVPDIIF 405

Query: 577 KLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFN 636
           +L G+I H+G + +GHY +       H        W+ F+D ++               +
Sbjct: 406 ELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVS--------------S 443

Query: 637 IEKDEFDSSKVYVLFY 652
           I ++E    + Y+LFY
Sbjct: 444 ITEEELLQEQAYLLFY 459

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 103/242 (42%), Gaps = 45/242 (18%)

Query: 231 IPKML---SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEP 287
           IPK+     L GL N G+TC+++S+VQCL          I++   +    +D  + IS  
Sbjct: 127 IPKLERRDGLQGLLNMGSTCFMSSIVQCLIHNPYFFQFSINQLHSQRCPLQDPLSCISCA 186

Query: 288 FARLLLTMY-------------ENGGTSVIPKNFLQQF-SLLRPDLNIPKD-QQDTQEFL 332
             R++   Y              N  TS     F+  F S  + + N+    QQD  E+ 
Sbjct: 187 LDRMVWEFYGHPELIKNGEDDSNNSRTSDEYAGFIGLFVSSWKINENLAGYFQQDAHEYW 246

Query: 333 VILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENC 392
             LL+ LH+     D ++S+N   D+ N  +     L + +  +        FQG +++ 
Sbjct: 247 QFLLNQLHN-----DYMVSHNKSPDETNFAE-----LCDCIAHS-------TFQGSLKSS 289

Query: 393 LQCQRCGNTSYNYSMFYM-LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
           + C  C   S      +M LSL I        K++  L +C++ F   E L   N ++C 
Sbjct: 290 IVCPECKMDSKTTKDPFMDLSLDI--------KDKSNLYECLDSFHKMEQLHDFN-YHCD 340

Query: 452 KC 453
           +C
Sbjct: 341 RC 342

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/409 (23%), Positives = 157/409 (38%), Gaps = 99/409 (24%)

Query: 238 VGLRNQGNTCYINSMVQCLFG-----------TKVLRDLFISEXXYKDFIKKDAE----- 281
           VGL N GN C+I S +Q L G             +LR+L+  +  +     ++ E     
Sbjct: 68  VGLINNGNDCFITSSLQSLAGIPRFVEYLKEINSILRELYKPDFKFDLSRNEEGENLTTG 127

Query: 282 ---------------TKISEPFARL---LLTMYENGGTSVIPKNFLQQFSLLRPDLNIPK 323
                          T + E    L   L+++ EN  T + PK  ++    +     I  
Sbjct: 128 EIMDASRCGSQLSLSTILHESLLSLVSDLVSIRENKKT-ISPKLVVKTLETIFKS-KISS 185

Query: 324 DQQDTQEFLVILLDIL---HDELV-YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKS 379
            Q D  EF ++LL  L   H +LV YT ++        D+N+ K   P            
Sbjct: 186 QQNDAHEFTLVLLQTLQEEHSKLVNYTKNM-------PDLNIPK--FP------------ 224

Query: 380 PIDLIFQGQIE---NCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFF 436
                FQGQ     +CLQC R    SY  S  ++  L +P+ + E           +   
Sbjct: 225 -----FQGQTSKFLSCLQCHRLSKPSYQES--FIRELMVPQRSSEK---------LMKIL 268

Query: 437 TSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFF-KLHKVLSPSS 495
            +DE    E  ++C  C    I  +++  +        KN S + L     L    + +S
Sbjct: 269 ANDETEIIE-GYSCLICQVRAILNHEKYRT-------FKNCSQDELRILDALKNYANDAS 320

Query: 496 GNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNST--KKN 553
            N           K   K+K +  N K   +K+   ++LP +LVIHLSR  +N     +N
Sbjct: 321 INEDLPIKVEQYIKHYAKDKLRTSNVKSTVIKKDIAVQLPEVLVIHLSRSTFNGMTYTRN 380

Query: 554 NAVITYPLILNIIMKNNID--------VVKYKLYGLINHQGGLTKGHYT 594
              + +   + +    +I+         ++Y L  ++ H G  ++GHY 
Sbjct: 381 PCNVEFEETIKLAEYTSIEKGPSAEYRQIEYHLKSVVKHTGSHSRGHYV 429

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (47%), Gaps = 27/140 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           E+++ LKQL     P IL +HL RF Y+  +K+N      I YPL L++    +  V  K
Sbjct: 544 ERIVGLKQL-----PYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKK 598

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G++ H G G   GHY  I           NE+  W  +DDE ++      +I ++ 
Sbjct: 599 YELSGVVIHMGSGPQHGHYVCICK---------NEKFGWLLYDDETVE------SIREET 643

Query: 634 SFNIEKDEFDSSKVYVLFYE 653
                    D +  YVLFY+
Sbjct: 644 VLQFTGHPGDQTTAYVLFYK 663

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 67/149 (44%), Gaps = 40/149 (26%)

Query: 526 LKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI---IMKNNIDVVK---- 575
           +KQL   KL P+LV  L RF +    +T K N  I YPL LN+      +N D  +    
Sbjct: 365 IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 576 --------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNN 627
                   Y+L  +I+H+G + +GHY  +V         +N+ QW+ F+D ++       
Sbjct: 425 SENVPDMIYELTSIISHKGTVNEGHYIVVV--------KVNDGQWFKFNDSMVSA----- 471

Query: 628 TINKKESFNIEKDEFDSSKVYVLFYERIE 656
                    I ++E    + Y+LFY   +
Sbjct: 472 ---------ITEEEALKQQAYLLFYSVFQ 491

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 68/139 (48%), Gaps = 25/139 (17%)

Query: 521  EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
            E+++ LKQL     P  L +HL RF Y+  +  N      + YPL L++    N ++ K 
Sbjct: 951  ERIVGLKQL-----PKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKR 1005

Query: 576  YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
            Y+L G++ H GG  + GHY +I   D        +  W   DDE ++      TI+++  
Sbjct: 1006 YELNGIVVHMGGGPQHGHYVAICKND--------KFGWLLMDDETVE------TISEETV 1051

Query: 635  FNIEKDEFDSSKVYVLFYE 653
               + D  D +  YVLFY+
Sbjct: 1052 LRCKGDSKDLTTAYVLFYK 1070

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 197 KRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCL 256
           +RS++++  +++ +    + ++  T P+I   D   K+    G  N GNTCY NS++QCL
Sbjct: 479 ERSASII-PTITTIDHNHSALQPRTNPLIPFGDGSNKVF---GYENFGNTCYCNSVLQCL 534

Query: 257 FGTKVLR 263
           +    LR
Sbjct: 535 YNMTNLR 541

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 16/139 (11%)

Query: 325 QQDTQEFLVILLDILHDELVYT------DDLISNNYVSDDIN-LGKEYMPWLQNNLKANG 377
            QD  EFL  LL+ L D ++           I+NN  +D  N L + +    Q     N 
Sbjct: 812 HQDAHEFLNFLLNELSDYMIKCINEENLKKTIANNPNTDTHNTLTQSHTSNNQQEEDNNL 871

Query: 378 KSPIDLI---FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCIN 434
               D I   F+G + N  +C  C N +     F    L  P   K++++  ++ E  + 
Sbjct: 872 PRMSDFISDLFRGTLINKTRCLTCDNVTSREEPF----LDFPIEVKDDTETNIQTE--LK 925

Query: 435 FFTSDEILTGENAWNCPKC 453
            +   E+L G N + C +C
Sbjct: 926 SYHQREMLNGSNKFYCDEC 944

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 67/137 (48%), Gaps = 32/137 (23%)

Query: 526 LKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI--IMKNNID-----VVK 575
           +KQ    KLPP+LV+ L RF +      +K N  I +P IL++   +K+N +      + 
Sbjct: 341 IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           Y+L G+I+H G + +GHY +           +   +W+ F+D ++ K+            
Sbjct: 401 YELIGIISHTGSVNEGHYVAFCK--------IENGEWFKFNDSMVTKI------------ 440

Query: 636 NIEKDEFDSSKVYVLFY 652
            +EKD     + Y+LFY
Sbjct: 441 -LEKDVL-KEQAYLLFY 455

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 68/140 (48%), Gaps = 27/140 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQL     P  L +HL RF Y+  + +N      ++YPL L +    N  + K 
Sbjct: 558 ERVVGLKQL-----PKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKN 612

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G++ H GG  + GHY S+           NE+  W  FDDE ++       I+++ 
Sbjct: 613 YELSGIVVHMGGGPQHGHYISLCK---------NEKFGWLLFDDETVE------AISEQA 657

Query: 634 SFNIEKDEFDSSKVYVLFYE 653
                 D+   +  YVLFY+
Sbjct: 658 VLQYTGDKDTMTTAYVLFYQ 677

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 15/130 (11%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL+ LL+ + D L   +    N+ + D  + G+     ++N         +  I
Sbjct: 438 HQDAHEFLIFLLNEISDFLDKQNKNALNSKIYDS-SQGRRNSGTVKNF--------VSDI 488

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           FQG + N ++C  C NT+     F    L  P   +EN    + +++ +  F   E+L G
Sbjct: 489 FQGTLTNRIKCLTCDNTTARDEPF----LDFPIEVQENVD--IDIQEILESFHQKEMLHG 542

Query: 445 ENAWNCPKCC 454
            N + C +CC
Sbjct: 543 PNKFYCDECC 552

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRD 264
           + G  N GNTCY NS++QCL+     R+
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRN 176

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 148/377 (39%), Gaps = 103/377 (27%)

Query: 287 PFARLLLTMYENGGTSVIPKNFLQQFSLLRP-----DLNIPKDQQDTQEFLVILLDILHD 341
           P  R L +M E    +V     L  + LL       +  I   Q D  E   ++L+ L  
Sbjct: 253 PLHRSLASMLEQLQRTVTSPRHLSIWPLLHSLEVIFNARISSGQNDAHELTQVILETLQK 312

Query: 342 ELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI---FQGQIENCLQCQRC 398
           E         NN + +                  N K P+D+    F+G++ + L C  C
Sbjct: 313 E---------NNKIRE---------------FAKNQKLPVDIPEIPFRGKVADHLVCTAC 348

Query: 399 GNTS-YNYSMFYMLSLAIP-----KIAKENSKNRVKLEDCINFFTS--DEILTGENAWNC 450
            N+S    + F ML LA+P     K+A+  S N+V+  +  +  T    +IL  E   + 
Sbjct: 349 RNSSKVRVTQFNMLPLAVPQAITAKLAEMVSDNQVESIEGYSCLTCKVGKILENEKGRDT 408

Query: 451 PKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKS 510
                ++ ET  E ++ A++     N +IN     +L   +                   
Sbjct: 409 -----SSYETT-EQNTLASLARAFPNLTINDDVSEELMNYI------------------- 443

Query: 511 DGKNKNKYKNEKLIT-------LKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPL 561
                N Y  + L+T       +K+   +  P +L+IHLSR  +N T   +N   + +  
Sbjct: 444 -----NGYNRDGLVTSQLKSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDE 498

Query: 562 ILNI---IMKNN----IDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYN 614
           IL +   +++N+    I+ V Y+L  ++ H G  ++GHY                 Q Y 
Sbjct: 499 ILQLQEQVIQNDRCVGINSVNYELKAIVKHAGSHSQGHY-----------------QCYR 541

Query: 615 FDDEVIKKLNSNNTINK 631
              + +K ++++  IN+
Sbjct: 542 HKPDFVKDIDTHAVINR 558

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/427 (20%), Positives = 163/427 (38%), Gaps = 84/427 (19%)

Query: 235 LSLVGLRNQGNTCYINSMVQCLFGTKVLR----DLFISEXXY-KDFIKKDAETKISEPFA 289
           L   GL N G TCY N+ VQ +     ++    D+  +   Y  D IK ++ + I    +
Sbjct: 300 LKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRNNKDYITDIIKPNSVSYILSQTS 359

Query: 290 RLLLTMYENGGTSVIPKNF---------LQQFSLLRPDLNIPKDQQDTQEFLVILLDILH 340
           + +    ++  TS    N+         L+Q + +  +      Q+D+ E+ + L+  L 
Sbjct: 360 KKMW-WKDSKKTSKTSANYIDPKKLIAALEQINCMMSEWQ----QEDSHEYFMSLMSRLQ 414

Query: 341 DELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGN 400
           ++ V     ++ + + D                          IF G ++  + C+ CG 
Sbjct: 415 EDSVPKGKKMTESIIYD--------------------------IFGGLLKQEVTCKSCGE 448

Query: 401 TSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIET 460
            S     FY LSL +      +  N           ++D   T     N P      IE 
Sbjct: 449 ISKTEQPFYDLSLHLKGKHNRHQTN-----------STDSATT-----NYPAGNSNKIEE 492

Query: 461 YDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKN 520
               +  A   N   N+ +NP N  +       S              K D K K  Y  
Sbjct: 493 SSTKEGAADSVNNANNQ-LNPENGIQDASTSRFSIEKSIGDFFNPELIKMD-KEKKGYVC 550

Query: 521 EKLI----TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII-----MKN 569
           EK       +K+   ++ P  L++HL +F +N  S+ K    ++YP+ L++       K+
Sbjct: 551 EKCKKTTNAVKRNTILRAPETLLVHLKKFRFNGQSSSKMKQAVSYPMFLDLTSYCDKTKS 610

Query: 570 NIDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
            + +V Y+L  ++ H+G  L+ GHY +   +         +  W  +DDE    ++  N 
Sbjct: 611 KL-LVMYQLISVVVHEGRSLSSGHYIAHCKQP--------DGTWATYDDEYTNIISERNV 661

Query: 629 INKKESF 635
           + +  ++
Sbjct: 662 LKEPNAY 668

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 37/143 (25%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI------------IMKN 569
            +KQL   KLP +LV+ L RF +    S +K +  I +P  LN+            I   
Sbjct: 345 AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 570 NIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTI 629
            +  + Y+L G+++H+G + +GHY +           ++  QW+ F+D ++         
Sbjct: 405 KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------- 448

Query: 630 NKKESFNIEKDEFDSSKVYVLFY 652
                 +I ++E    + Y+LFY
Sbjct: 449 ------SISQEEVLKEQAYLLFY 465

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 22/119 (18%)

Query: 526 LKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNIIMKNNIDVVK------- 575
           ++QL   KLPP+L++ L RF +    ++ K N  I++PL LN  MK+    V        
Sbjct: 349 IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLN--MKDYCKPVDCLHPVPN 406

Query: 576 --YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
             YKL  +I+H G + +GHYT+I          +N   W  F+D ++  ++  + + ++
Sbjct: 407 MMYKLSAIISHHGTVHQGHYTTICR--------INGDIWAKFNDSMVTVISEEDMLKEQ 457

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 101/254 (39%), Gaps = 57/254 (22%)

Query: 221 TVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA 280
           ++P +D  D       L+GL N G+TC+++S++Q L     +    + +        +D+
Sbjct: 125 SIPSVDGKD------GLLGLVNMGSTCFMSSVIQTLVHIPHVLQHVLKQTHQSTCDIQDS 178

Query: 281 ETKISEPFARLLLTMYENGGTSVIPKNFLQQFS---------------LLRPDLNIPKD- 324
              +S     ++  +Y     + + K+ + Q+S               LL     I K+ 
Sbjct: 179 IACVSCAVDEIVANLYGYPKPNAVTKSSVGQYSHISSTFSRQQKGFIDLLTCSWKINKNL 238

Query: 325 ----QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSP 380
               QQD  EF   LL+ LH + V      SNN                     +N +  
Sbjct: 239 AGYTQQDAHEFWQFLLNQLHSDHVRAHKPSSNN---------------------SNCECI 277

Query: 381 IDLIFQGQIENCLQCQRCG-NTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSD 439
           + L+FQG +E+ + C  C  N+         LSL I        +N+  L +C+N F   
Sbjct: 278 LHLLFQGYLESNIACSECHTNSKTTVDPIMDLSLGI--------QNKSTLHECLNSFHKR 329

Query: 440 EILTGENAWNCPKC 453
           E LT  N + C KC
Sbjct: 330 EPLTDFN-YCCKKC 342

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 41/145 (28%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNIIMKNNIDV-------- 573
            +KQL   KLP +LV+ L RF +    S +K +  I +P  LN  MKN            
Sbjct: 345 AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEKDKHSE 402

Query: 574 ------VKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNN 627
                 + Y+L G+++H+G + +GHY +           ++  QW+ F+D ++       
Sbjct: 403 NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS------ 448

Query: 628 TINKKESFNIEKDEFDSSKVYVLFY 652
                   +I ++E    + Y+LFY
Sbjct: 449 --------SISQEEVLKEQAYLLFY 465

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 25/141 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+L+ LK+L     P  L IHL RF Y+     N      I YP+ L +    +  V K 
Sbjct: 519 ERLLGLKEL-----PKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKD 573

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L GL+ H G G   GHY S+           ++  W  FDDE ++       I++   
Sbjct: 574 YELGGLVVHIGIGPQHGHYISVCK--------TSDYGWLLFDDETVE------CISEDTV 619

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
            +   D   +   YVLFY+ I
Sbjct: 620 LSFVGDSNSAGTAYVLFYKEI 640

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD 264
           GL N GNTCY NS++QCL+     R+
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRE 157

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 66/138 (47%), Gaps = 19/138 (13%)

Query: 509 KSDGKNKNKY---KNEKLITLKQLNFI-KLPPILVIHLSRFYYNST--KKNNAVITYPLI 562
           K D  NK  Y   K  K     + NFI + P  L++HL +F +N T   K    ++YP+ 
Sbjct: 571 KVDKANKEGYVCEKCHKTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMF 630

Query: 563 LNI--IMKNNIDV--VKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
           L++    +N+     VKY+L  ++ H+G  LT GHY +   +         +  W  +DD
Sbjct: 631 LDVTEFCENSKTTLPVKYQLISVVVHEGRSLTSGHYIAHCKQP--------DGSWSTYDD 682

Query: 618 EVIKKLNSNNTINKKESF 635
           E I K++    + +  ++
Sbjct: 683 EYINKISERQMLKEPGAY 700

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 91/242 (37%), Gaps = 53/242 (21%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ L     ++  LF +    YK  I  ++ T++    ++ + +  
Sbjct: 378 GLLNHGVTCYTNAAVQALIHIPAIQHYLFDVLRGEYKSTISPNSVTQVLAETSKRMWSTD 437

Query: 297 ENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDLISNN 353
            +    + PK  + +      D+N       Q+D+ E+ + L+  L ++ V     ++ +
Sbjct: 438 ASKNQFINPKKLIGRLE----DINCMMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTES 493

Query: 354 YVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSL 413
            + D                          IF G +   + C+ CG  S      Y +SL
Sbjct: 494 ILYD--------------------------IFGGMLRQEVTCKSCGEVSKTEQPIYDISL 527

Query: 414 AI--------PKIAK------ENSKNRVKLEDCINFFTSDEIL----TGENAWNCPKCCP 455
            +           AK      E  + R  +E  I  F + E++      +  + C KC  
Sbjct: 528 HLKGKKNSDSADTAKNSSDFEEEPQRRFSIEKSIRDFFNPELIKVDKANKEGYVCEKCHK 587

Query: 456 TT 457
           TT
Sbjct: 588 TT 589

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 27/142 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQ+     P IL +HL RF Y+  + +N      I YPL L++    +  V K 
Sbjct: 549 ERIVGLKQV-----PYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKR 603

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G++ H G G   GHY  I           NE+  W  +DDE ++      +++++ 
Sbjct: 604 YELSGVVIHMGSGPQHGHYVCICK---------NEKFGWLLYDDETVE------SVSEET 648

Query: 634 SFNIEKDEFDSSKVYVLFYERI 655
                    D +  YVLFY+ I
Sbjct: 649 VLKFTGHSGDQTTAYVLFYKEI 670

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 114/295 (38%), Gaps = 72/295 (24%)

Query: 384 IFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILT 443
           IF G ++  + C+ CG  S     FY LSL +    K +S          N  T+   L 
Sbjct: 569 IFGGLLKQLVTCKSCGEVSKTEQPFYDLSLHLKGKRKLHSSEE-------NVGTTTNALA 621

Query: 444 GENAWNCPKCCPTTIE-------TYDEADSPATVENRVKNKSINP--LNFF--KLHKVLS 492
             ++ N  +     +        T D   S A+ E   +  SI     +FF  +L KV  
Sbjct: 622 DTDSSNAKQTQDNLVANSISSKTTSDTNTSFASQEGLTRRFSIEKSIRDFFNPELIKV-- 679

Query: 493 PSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI----TLKQLNFIKLPPILVIHLSRFYYN 548
                               K K  Y  EK        K+   ++ P  L+IHL +F +N
Sbjct: 680 -------------------DKEKKGYVCEKCNKTTNATKRSTILRAPETLLIHLKKFRFN 720

Query: 549 --STKKNNAVITYPLILNIIM-----KNNIDVVKYKLYGLINHQG-GLTKGHYTSIVNKD 600
             S+ K    ++YP+ L++       K++I  VKY+L  ++ H+G  L+ GHY +   + 
Sbjct: 721 GTSSSKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQLLSVVVHEGRSLSSGHYIAHCKQP 780

Query: 601 LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
                   +  W  +DDE I K++             E++       Y L Y R+
Sbjct: 781 --------DGSWATYDDEYINKIS-------------EREMLKEPNAYYLLYTRL 814

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 66/153 (43%), Gaps = 32/153 (20%)

Query: 514 NKNKYKNEKLI----TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNIIM 567
           NK  Y  EK       LK    I+ P  LV+HL +F +N  S+ K    ++YP+ L++  
Sbjct: 567 NKEGYTCEKCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTE 626

Query: 568 KNNIDV----VKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKK 622
             +  +    V+Y+L  ++ H+G  L+ GHY +   +         +  W  +DDE I K
Sbjct: 627 YCHESISSLPVRYQLISVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYINK 678

Query: 623 LNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           ++             EK        Y L Y R+
Sbjct: 679 IS-------------EKQLLKEPNAYFLVYTRL 698

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/247 (19%), Positives = 90/247 (36%), Gaps = 65/247 (26%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFIS--EXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ +     ++          +KD +K +    +S   A   + M+
Sbjct: 363 GLLNHGVTCYTNAAVQAMVHIPAIQHYLFQLLRGNFKDTVKSNC---VSMLLAETTMRMW 419

Query: 297 ENGGTS---VIPK---NFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLI 350
            +  T    + P    N L+  + +    N    Q+D+ E+ + L+  L ++ V     +
Sbjct: 420 SSDSTKNTYINPDKLINALEDINCMMSAWN----QEDSHEYFMSLMSRLQEDSVPKGHKM 475

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
           + + + D                          +F G ++  ++C  CG  S      Y 
Sbjct: 476 TESIIYD--------------------------VFGGLLQQSVKCSNCGEISTTEQPIYD 509

Query: 411 LSLAIP----------KIAKEN-----------SKNRVKLEDCINFFTSDEILT---GEN 446
           LSL +            + ++N           SK R  +E  I  F + E++     + 
Sbjct: 510 LSLHLKGRKTTDQDQNSVGQDNSIDNSVDQQQSSKRRFSIEKSIRDFFNPELIKRVDNKE 569

Query: 447 AWNCPKC 453
            + C KC
Sbjct: 570 GYTCEKC 576

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 30/140 (21%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPLILNII------MKNNIDVVKY 576
            +K+ + I+ P  L+ HL +F +N T   K    ++YP+ L++        K+++  VKY
Sbjct: 490 AVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTEYCESNEKDHVVPVKY 549

Query: 577 KLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           +L  ++ H+G  L+ GHY  IV+          +  W  +DDE I K+            
Sbjct: 550 QLTTVVVHEGRSLSSGHY--IVH------CKQPDGTWATYDDEYINKIT----------- 590

Query: 636 NIEKDEFDSSKVYVLFYERI 655
             E+D       Y L Y R+
Sbjct: 591 --ERDVLKEPNAYYLLYTRL 608

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 40/187 (21%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKI-SEPFARLLL-- 293
           GL N G TCY N+ VQ +     ++  LF I    Y+  I +D+ + + +E   ++ L  
Sbjct: 265 GLLNHGVTCYTNAAVQAIVHIPAIQHYLFDILRGKYESTISRDSVSYVLAETSKKMWLPQ 324

Query: 294 --TMYENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDD 348
             +  +NG   + PK  + +      D+N       Q+D+ E+ + L+  L ++ V    
Sbjct: 325 DRSKKKNGPHHINPKKLIARLD----DINCMMSEWQQEDSHEYFMSLMSRLQEDSVPKGH 380

Query: 349 LISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMF 408
            ++ + + D                          IF G ++  + C+ CG+ S     F
Sbjct: 381 KMTESIIYD--------------------------IFGGLLKQVVTCKSCGSVSKTEQPF 414

Query: 409 YMLSLAI 415
           Y LSL +
Sbjct: 415 YDLSLHL 421

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 102/419 (24%), Positives = 154/419 (36%), Gaps = 94/419 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLFG-----------TKVLRD------LFISEXXYKDF----- 275
            GL N  N C+ NS +Q L             T+V+R       L +      DF     
Sbjct: 84  TGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRSTRQALGLLVPRDDAADFSDHGG 143

Query: 276 -IKKDAETKISEPFARLLLTMYENG----GTSVIPKNFLQQFSLLRPDLNIPKDQQDTQE 330
              K + +  ++P A        NG    G  V P        LL PDL +        E
Sbjct: 144 MPSKKSASPFTDPAAVSANCAAANGKEPEGNHVTPD-------LLLPDLRM-------HE 189

Query: 331 FLVILLDILHDE-----------LVYTDDLISNNYVSDDINLGKEYMPWLQNNLK----- 374
            L I++  L              L++T + I N  +S   N   E+   L   L+     
Sbjct: 190 ALSIMIHNLQQPVKNYTQTSLQPLLHTLEQIHNAKISSGQNDAHEFSQILFETLEKERLA 249

Query: 375 ----------ANGKSPIDLIFQGQIENCLQCQRCGNTS-YNYSMFYMLSLAIPKIAKENS 423
                     ++ + P +  FQG +   L C RC N+S  N   F M SL +P+++  + 
Sbjct: 250 LKTFLEKQQLSDIRIP-EFPFQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQMSSASL 308

Query: 424 KNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLN 483
           K+ +       F    E + G   ++C  C    I   +       V    + K      
Sbjct: 309 KDMM-------FDNQTETIEG---YSCISCRLRAILNNERQRDYHNVSQEERAK------ 352

Query: 484 FFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLS 543
              L K+L     N           KS  K+     + K   LK+   +  P +L++HLS
Sbjct: 353 LDDLAKLLPRICINDDLPEPLELYVKSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLS 412

Query: 544 RFYYNSTK--KNNAVITYP--LILN---IIMKNNIDV--VKYKLYGLINHQGGLTKGHY 593
           R  ++     KN+  + +P  LILN   I     I V  V+YKL  +I H G   +GHY
Sbjct: 413 RSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVHCVRYKLQAMIKHTGTHFQGHY 471

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 90/439 (20%), Positives = 156/439 (35%), Gaps = 137/439 (31%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ +     ++  LF +    +K  I   + T++    ++ + +  
Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQSVTQVLAETSKRMWSPE 422

Query: 297 ENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDLISNN 353
            N  T + PK  + +      D+N       Q+D+ E+ + L+  L ++ V     ++ +
Sbjct: 423 PNKNTYINPKKLIGRLD----DINCMMSEWQQEDSHEYFMSLMSRLQEDSVPRGHKLTES 478

Query: 354 YVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSL 413
            + D                          IF G +   + C+ CG  S     FY LSL
Sbjct: 479 IIYD--------------------------IFGGLLHQKVTCKSCGGVSKTEQPFYDLSL 512

Query: 414 ----------AIPKIAKENSKNRVKLEDCINFFTSDEILT--GENAWNCPKCCPTTIETY 461
                      +P+  ++  + R  +E  I+ F + E++    ++ + C KC  TT    
Sbjct: 513 HLKGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPELIKVDKKDGYVCEKCHKTT---- 568

Query: 462 DEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNE 521
                     N +K  SI      +  + L                              
Sbjct: 569 ----------NAIKRNSI-----LRAPETL------------------------------ 583

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIM----KNNIDVVKYK 577
            LI LK+  F                +S+K   AV +YP+ L++      +     VKY+
Sbjct: 584 -LIHLKKFRFNGT-------------SSSKMKQAV-SYPMFLDMSEYCEDQQKTLPVKYQ 628

Query: 578 LYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFN 636
           L  ++ H+G  L+ GHY +   +         +  W  +DDE I K+             
Sbjct: 629 LISVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYINKI------------- 667

Query: 637 IEKDEFDSSKVYVLFYERI 655
            EK        Y L Y R+
Sbjct: 668 TEKQMLKEPGAYYLIYTRL 686

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 37/143 (25%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI------------IMKN 569
            +KQL   +LP +LV+ L RF +    S +K +  I +P  LN+                
Sbjct: 345 AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 570 NIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTI 629
            +  + Y+L G+++H+G + +GHY +           ++  QW+ F+D V+         
Sbjct: 405 KVPDIIYELIGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVT-------- 448

Query: 630 NKKESFNIEKDEFDSSKVYVLFY 652
                 +I + E    + Y+LFY
Sbjct: 449 ------SIAQGEVLKEQAYLLFY 465

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 99/247 (40%), Gaps = 43/247 (17%)

Query: 219 KHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKK 278
           K TVPI++  D       L GL N G+TC+++S++QCL          +S+         
Sbjct: 124 KTTVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVG 177

Query: 279 DAETKISEPFARLLLTMY-----ENGGTSVIPKNFLQQF-SLLRPDLNIPKD-----QQD 327
             +   S    +++  +Y     +    S    N    F  LL     I ++     QQD
Sbjct: 178 SPDKCFSCALDKIIQELYGVLNTDQPSPSSSATNRQTGFIYLLTCAWKINQNLAGYSQQD 237

Query: 328 TQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQG 387
             EF   +++ +H    YT D  +   + D +N                 +  +  +F+G
Sbjct: 238 AHEFWQFIINQIHQS--YTHDSPNAKEI-DRVN-------------NKRCECIVHSVFEG 281

Query: 388 QIENCLQCQRCG-NTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGEN 446
            +E+ + C  C  N+      F  LSL I        K++ KL +C++ F   E L   N
Sbjct: 282 SLESSIVCPGCQKNSKTTIDPFMDLSLDI--------KDKKKLYECLDSFHKKEQLKDFN 333

Query: 447 AWNCPKC 453
            ++C +C
Sbjct: 334 -YHCGEC 339

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 65/145 (44%), Gaps = 39/145 (26%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI--------------IM 567
            +KQL   +LP +LV+ L RF +    + +K +  I +P  LN+              I 
Sbjct: 345 AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 568 KNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNN 627
              +  + Y+L G+++H+G + +GHY +           ++  QW+ F+D ++       
Sbjct: 405 NGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS------ 450

Query: 628 TINKKESFNIEKDEFDSSKVYVLFY 652
                   +I ++E    + Y+LFY
Sbjct: 451 --------SISQEEVLKEQAYLLFY 467

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
           UBP3Ubiquitin-specific protease involved in transport
           and osmotic response; interacts with Bre5p to
           co-regulate anterograde and retrograde transport between
           the ER and Golgi; involved in transcription elongation
           in response to osmostress through phosphorylation at
           Ser695 by Hog1p; inhibitor of gene silencing; cleaves
           ubiquitin fusions but not polyubiquitin; also has mRNA
           binding activity
          Length = 912

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 73/161 (45%), Gaps = 43/161 (26%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I   RF + N+  K+NA+  Y                   LI+
Sbjct: 763 VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELII 822

Query: 564 ------NIIMKNN---IDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWY 613
                 +I +KNN   ID  +YKL G+I H G     GHYT+    D+ HS      +WY
Sbjct: 823 PEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTA----DVYHS---EHNKWY 875

Query: 614 NFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             DD  I +L  ++ +   E      +  DS   Y+L Y++
Sbjct: 876 RIDDVNITELEDDDVLKGGE------EASDSRTAYILMYQK 910

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 94/244 (38%), Gaps = 57/244 (23%)

Query: 164 SGLSRDRSSTSVL------SRKPTLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEI 217
           SG +   SST++       S  P LS  P    +    P         S++  +    + 
Sbjct: 379 SGTTAGVSSTNMAAATIGKSSSPLLSKQPQKKDKKYVPPSTKGIEPLGSIALRMCFDPDF 438

Query: 218 KKHTVPIIDATDNIPKMLSLV--GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF 275
             + +   D  + IP + S++  G+ N+ N C+++S++Q L   K   D+          
Sbjct: 439 ISYVLRNKDVENKIP-VHSIIPRGIINRANICFMSSVLQVLLYCKPFIDVI------NVL 491

Query: 276 IKKDAETKISEPFARLL---LTMYENGGTSVIPKNFLQQFS------------------- 313
             ++  +++     +LL   LTMY+        K FL+                      
Sbjct: 492 STRNTNSRVGTSSCKLLDACLTMYKQFDKETYEKKFLENADDAEKTTESDAKKSSKSKSF 551

Query: 314 -------LLRPD------LNIPK-------DQQDTQEFLVILLDILHDELVYTDDLISNN 353
                   ++PD        IPK        Q+D +EFL  LLD LH+EL+   D +++N
Sbjct: 552 QHCATADAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEELISAIDGLTDN 611

Query: 354 YVSD 357
            + +
Sbjct: 612 EIQN 615

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   +   L   K+ + F   PP+L + L RF Y+       K N    +P  +++
Sbjct: 366 DGENQYAAQGYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDL 425

Query: 566 -------IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                  I  +N D   Y L+G++ H G ++ GHY +++   +       E QWY FDD+
Sbjct: 426 SPYLDPEISSSNADSYIYDLHGVLVHTGDISTGHYYTMIKPSI-------EDQWYRFDDD 478

Query: 619 VIKKLNSNNTINK 631
            + ++  N    +
Sbjct: 479 KVWRVTKNQVFEE 491

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 91/240 (37%), Gaps = 51/240 (21%)

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISE 269
           VL  P  +  H     D+     K+   VG +NQG TCY+NS++Q  F TK  R L    
Sbjct: 182 VLKDPTGVLWHNFMNYDSK----KVTGYVGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ- 236

Query: 270 XXYKDFIKKDAET-KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDT 328
                 I  D E+   S P A  L   +     S  P + L+       D      Q D 
Sbjct: 237 ------IPTDKESPNNSVPLA--LQRAFFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDV 288

Query: 329 QEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQ 388
           QE   IL+D L +++  TD                            +GK  ++ +F G+
Sbjct: 289 QELNRILMDRLENKMKGTD---------------------------VDGK--LNEVFVGK 319

Query: 389 IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAW 448
           + + ++C      S     F+ + L        N KN   L++    +   E++ GEN +
Sbjct: 320 MRSYIKCVNVDYESSRVEDFWDIQL--------NVKNLRGLQESFKNYIEVEMMDGENQY 371

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 67/140 (47%), Gaps = 27/140 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVV-K 575
           E+++ LKQL     P IL +HL RF Y+  +++N      I YPL L++    +  +  K
Sbjct: 538 ERIVGLKQL-----PYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKK 592

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G++ H G G   GHY  I           NE+  W  +DDE ++      +I ++ 
Sbjct: 593 YELSGVVIHMGSGPQHGHYVCICK---------NEKFGWLLYDDETVE------SIREET 637

Query: 634 SFNIEKDEFDSSKVYVLFYE 653
                    D +  YVLFY+
Sbjct: 638 VLKFTGHPGDQTTAYVLFYK 657

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 72/161 (44%), Gaps = 42/161 (26%)

Query: 522  KLITLKQLNFI-KLPPILVIHLSRFYYNST-KKNNAVITY-------------------- 559
            K +  K+  FI KLP +L+I L RF + S   K+N +  Y                    
Sbjct: 932  KDVEAKKQTFIDKLPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHEL 991

Query: 560  --PL--ILNIIMKNNIDVVKYKLYGLINHQGGLT-KGHYTS-IVNKDLNHSLDLNEQQWY 613
              P+  + + I+KNN    KYKL  ++ H G     GHYT+ I NKDL        ++W+
Sbjct: 992  LVPVESVSSAILKNNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDL--------KKWF 1043

Query: 614  NFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
              DD  I +L   + +N  +      +  D+   Y+L YE+
Sbjct: 1044 MIDDVNITELEDADVVNGGD------NGLDTRTAYILMYEK 1078

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 23/33 (69%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSD 357
           Q+D +EFL  LLD LH+E++   + +++N + +
Sbjct: 750 QEDAEEFLTQLLDQLHEEIISAIECLTDNEIEN 782

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 61/126 (48%), Gaps = 25/126 (19%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLIL------------NIIMKN 569
            LKQL   KLPP+L++ L RF +     + K N  I YP  L             I   +
Sbjct: 338 ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 570 NIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTI 629
           + D++ Y+L G+I H G + +GHY          S  L   QW  F+D +I  ++ N T+
Sbjct: 398 DSDII-YELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMITIVD-NETV 447

Query: 630 NKKESF 635
            K++++
Sbjct: 448 LKEQAY 453

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 27/137 (19%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII---MKNNIDVVKYKLY 579
            +K  + ++ P  L++HL +F +N  S+ K    ++YP+ L++    ++     +KY+L 
Sbjct: 531 AIKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDYCVEGKELPLKYQLI 590

Query: 580 GLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIE 638
            ++ H+G  L+ GHY     +   H        W  +DDE I  +N             E
Sbjct: 591 TVVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEYINNIN-------------E 629

Query: 639 KDEFDSSKVYVLFYERI 655
           KD       Y L Y R+
Sbjct: 630 KDVLREPNAYYLVYTRL 646

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 81/200 (40%), Gaps = 43/200 (21%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           GL N G TCY N+ VQ +     ++  LF I    + D +  D+   +S  FA +   M+
Sbjct: 292 GLLNHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKHSDKVSPDS---VSYAFAEITKRMW 348

Query: 297 ENGGTS---------VIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD 347
                S         + PK  + +   +   +++ + Q+D+ E+ + L+  L ++ V   
Sbjct: 349 SPQDKSKKKRQSLQYINPKKLIARLDDINCMMSVWQ-QEDSHEYFMSLMSRLQEDSVPRG 407

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSM 407
             ++ + + D                          IF G +E  + C+ CG+ S     
Sbjct: 408 HKLTESILYD--------------------------IFGGVLEQVVTCKSCGSISKTEQP 441

Query: 408 FYMLSLAIPKIAKENSKNRV 427
           FY LSL +   AK+   N V
Sbjct: 442 FYDLSLHL--RAKKKQSNGV 459

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 94/235 (40%), Gaps = 64/235 (27%)

Query: 232 PKMLSLVGLRNQGNTCYINSMVQCLF------------GTKVLRDLFISEXXYK-DFIKK 278
           P      GL N GN+CY+NS++QCLF            G    +D+      +K   IK 
Sbjct: 317 PDQEHGCGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKL 376

Query: 279 DAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDI 338
           +   K+ EP         +N    + PK+F +       + +  + QQD+ EFL  L+D+
Sbjct: 377 NNAMKV-EP---------QNYPEGIRPKSFKKCVGQSHEEFSSGR-QQDSMEFLGYLVDV 425

Query: 339 LHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
           L D+ ++                              NG +P DL+ +  +E+ LQC  C
Sbjct: 426 L-DKKIFK-----------------------------NGSNPNDLM-KFTMEDRLQCTNC 454

Query: 399 GNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           G   Y+      L L +P    EN+  +  +     +F  +E+      + CP C
Sbjct: 455 GKVKYSSEAAESLQLPMP----ENNDPQDLVHIIAQYFNGEEV-----EFTCPHC 500

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 60/120 (50%), Gaps = 15/120 (12%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII----MKNNIDVVKYKL 578
            LK+ + ++ P  L++HL +F +N  S+ K    ++YP+ L++         +  VKY+L
Sbjct: 605 ALKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPVKYEL 664

Query: 579 YGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNI 637
             ++ H+G  L+ GHY +   +         +  W  +DDE I K+     + ++ ++ +
Sbjct: 665 LSVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYINKITEREVLKERNAYYV 716

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 78/199 (39%), Gaps = 40/199 (20%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYEN 298
           GL N G TCY N+ VQ L     ++  ++++     +    +   +S   A     M+ N
Sbjct: 386 GLLNHGVTCYTNAAVQALLHIPAMQH-YLNDILAGKYSSTISSNSVSHVLAETSRRMWHN 444

Query: 299 -----GGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDLI 350
                G + + PK  + +      D+N       Q+D+ E+ + ++  L ++ V     +
Sbjct: 445 DGKKSGNSYINPKKLIARLD----DINCMMSEWQQEDSHEYFMSIMSRLQEDSVPKGHKM 500

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
           + + + D                          IF G ++  + C+ CG  S     FY 
Sbjct: 501 TESIIYD--------------------------IFGGSLKQTVTCKSCGEVSTTEQPFYD 534

Query: 411 LSLAIP-KIAKENSKNRVK 428
           LSL +  K   EN+ N+ K
Sbjct: 535 LSLHLKGKKTDENTVNQEK 553

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
           YER151C (REAL)
          Length = 909

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 45/163 (27%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I L RF + N+  K+NA+  Y                   LI+
Sbjct: 760 VEAKKQTFIDKLPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELII 819

Query: 564 ------NIIMKNN---IDVVKYKLYGLINHQG-GLTKGHYTS-IVNKDLNHSLDLNEQQW 612
                 +I +KN+   +D  +YKL G+I H G     GHYT+ + +K+ N        +W
Sbjct: 820 PEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADVYHKEHN--------KW 871

Query: 613 YNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           Y  DD  I +L  ++ +   E      +  DS   Y+L Y+++
Sbjct: 872 YRIDDVNITELEDDDVLKGGE------EASDSRTAYILMYQKV 908

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 40/170 (23%)

Query: 226 DATDNIPKMLSLV--GLRNQGNTCYINSMVQCLF---------------------GTKVL 262
           D  + IP +LS++  G+ N+ N C+++S++Q L                      GT   
Sbjct: 445 DIENKIP-LLSIIPRGIVNRANICFMSSVLQVLLYCQPFVDVLNVLSTRNTNSRIGTSSC 503

Query: 263 RDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSL--LRPD-- 318
           + L      YK F K++ E K  E       +   +       KNF    ++  ++PD  
Sbjct: 504 KLLDACLTMYKQFDKENYE-KTMENAEDTEKSSENDAKKPSKSKNFHHNTTVEAVKPDEF 562

Query: 319 ----LNIPK-------DQQDTQEFLVILLDILHDELVYTDDLISNNYVSD 357
                 IPK        Q+D +EFL  LLD LH+EL+   D +++N + +
Sbjct: 563 YKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEELISAIDGLTDNEIQN 612

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 68/141 (48%), Gaps = 25/141 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILN-IIMKNNIDVVK 575
           E+ + LKQL     P  L +HL RF Y+  +  N      I YPL L+      +    K
Sbjct: 560 ERKVGLKQL-----PHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKK 614

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L G++ H GG  + GHY S+   D           W  FDDE ++ ++  +T++K   
Sbjct: 615 YELTGIVVHMGGGPQHGHYVSLCKND--------NFGWLLFDDETVEAVHE-STVSK--- 662

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
           F  ++D    +  YVLFY+ I
Sbjct: 663 FIGDRDSL--TTAYVLFYKEI 681

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 221 TVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA 280
           ++P  D ++ +       G  N GNTCY NS++QCL+     R L +        IK+  
Sbjct: 113 SMPFGDGSNKV------FGYENFGNTCYCNSVLQCLYNLTEFRLLLLQHLERDPKIKRKR 166

Query: 281 ETKI 284
           ++++
Sbjct: 167 KSEM 170

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 98/249 (39%), Gaps = 44/249 (17%)

Query: 171 SSTSVLSRKPTLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDN 230
           SS   LS  P+     S P   L    + + ++T+  S +   P+ I K+  P+      
Sbjct: 385 SSKKSLSTPPSEKECKSTPATNLQDFYQFNEIITDEGSII---PSNIIKNWGPVF----- 436

Query: 231 IPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPF 288
               L   GL N G TCY N+ VQ +     ++  LF I    YK+         ++E  
Sbjct: 437 --ANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKNIDPNSVSYTLAETT 494

Query: 289 ARLLLTMYENGGTSVI----PKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELV 344
            R+ L+  + G   VI    P   +++   +   +N P +Q+D+ E+ + L+  L +  V
Sbjct: 495 RRMWLSN-KKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEYFMSLMSKLQENSV 552

Query: 345 YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYN 404
                ++ + + D                          IF G +E  + C+ CG  S  
Sbjct: 553 PIGRNMTESIIYD--------------------------IFGGLLEQTVTCKSCGGVSKT 586

Query: 405 YSMFYMLSL 413
              FY LSL
Sbjct: 587 EQEFYDLSL 595

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 15/106 (14%)

Query: 525 TLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNII----MKNNIDVVKYKL 578
            +K+   ++ P  LV+HL +F +N  ++ K    ++YP+ L+I         +   KY+L
Sbjct: 704 AIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQL 763

Query: 579 YGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
             ++ H+G  L+ GHY +   +         +  W  +DDE+I K+
Sbjct: 764 LSVVVHEGRSLSSGHYIAHCRQP--------DGTWATYDDELINKI 801

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 118/290 (40%), Gaps = 51/290 (17%)

Query: 323 KDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPID 382
           + Q D  EF  +LL+ L  E                     E    L+ + +  G +   
Sbjct: 210 RGQNDAHEFTQLLLETLEKE-------------------HTELSLMLKGDKRLEGLAVPA 250

Query: 383 LIFQGQIENCLQCQRCGNTS-YNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEI 441
              +G + + L C RCG +S  N   F M +L +P     + ++ +       F    E 
Sbjct: 251 FPIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPNATSADLRDML-------FDNQTET 303

Query: 442 LTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKV--LSPS-SGNX 498
           +   + + C  C    I         AT +NR + + ++      + ++  L+PS S N 
Sbjct: 304 I---DDYTCVSCQIRAIL--------ATEKNRGR-QGVDSTELAIIEELARLAPSISINE 351

Query: 499 XXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYN--STKKNNAV 556
                      +  K+       K   +K+   +  P +L++HLSR  +N  S  KN   
Sbjct: 352 DMPPHLAAYVSAYNKDHCITAALKSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCN 411

Query: 557 ITYP--LILN-IIMKNN----IDVVKYKLYGLINHQGGLTKGHYTSIVNK 599
           +T+P  L++N  +++NN    +  V+YKL  +I H G  ++GHY    +K
Sbjct: 412 VTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHIGTHSQGHYACFRHK 461

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 31/119 (26%)

Query: 527 KQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI------------------ 565
           +QL+ +KL PI+VI L RF +    S+ K N  + +PL LN+                  
Sbjct: 353 RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 566 -IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
              K+  D++ Y+L G++ H+G + +GHY +             +  WY F+D V+ K+
Sbjct: 413 KTNKSTPDMI-YELTGIVTHRGTVNEGHYITYTKTA--------DGVWYQFNDSVVMKV 462

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 96/235 (40%), Gaps = 41/235 (17%)

Query: 236 SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM 295
            L GL N G+TCY++S++QCL    +  DL +    Y     +D    +S     ++   
Sbjct: 135 GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDPMKCMSCAIDNIISET 194

Query: 296 YENGGTSVIPKNFLQQFSLLRPDLNIPKD-----QQDTQEFLVILLDILHDELVYTDDLI 350
           Y N  T+  P   L    +L     + K+     QQD  EFL  +L+ +H          
Sbjct: 195 YGNKKTT--PNEGL--VDILNCSWRVNKNLAGYTQQDAHEFLQFILNQMH---------- 240

Query: 351 SNNYVSDDIN-LGKEYMPWLQNNLKANGKSPID----------LIFQGQIENCLQCQRCG 399
            N+Y  ++I+   K+ M         NG S  +           IFQG +++ + C  C 
Sbjct: 241 -NDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHTIFQGFLKSIISCSECK 299

Query: 400 NTSYNYSMFYM-LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
             S      YM LSL +        K +  L +C+  F   E L  +  +NC KC
Sbjct: 300 AQSQTTIDPYMDLSLDV--------KGKSTLYECLESFHRTERL-HDFTYNCKKC 345

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 19/138 (13%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   ++  L   K+ + F   P +L + L RF Y+       K N    +P  +++
Sbjct: 363 DGENQYAAQDYGLQDAKKGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDL 422

Query: 566 IMKNNIDVVK-------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
               + DV++       Y L+G++ H G ++ GHY +++   L       E QWY FDDE
Sbjct: 423 SPYMDKDVLEANPGPRWYGLHGVLVHTGDISTGHYYALIKPGL-------EDQWYRFDDE 475

Query: 619 VIKKLNSNNTINKKESFN 636
            + K++     ++   F+
Sbjct: 476 RVWKVSKKQAFDENFGFD 493

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 81/218 (37%), Gaps = 45/218 (20%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           KM   VG RNQG TCY+NS++Q  F TK  R L       ++  K      +   F +L 
Sbjct: 198 KMTGYVGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQENPKDSVVLALQRAFYQLQ 257

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           ++ Y        P + ++       D      Q D QE   IL+D L   +  T      
Sbjct: 258 VSQY--------PLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGTT----- 304

Query: 353 NYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLS 412
                           ++N L          IF G++++ ++C      S     F+ + 
Sbjct: 305 ----------------VENKLNE--------IFVGKMKSFIKCINVDYESARTEDFWDIQ 340

Query: 413 LAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
           +        N KN   L+D    +   E++ GEN +  
Sbjct: 341 M--------NVKNLKGLKDSFENYIEVELMDGENQYAA 370

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 155/389 (39%), Gaps = 77/389 (19%)

Query: 239 GLRNQGNTCYINSMVQCL-----FGTKVLRDLFISEXXYK-DFIKKDAETK--------- 283
           GL N    CY NS VQ L     F   + + + I E   K + ++KDA+           
Sbjct: 67  GLVNTSTECYANSSVQVLASLSNFTIYLNKVISIFELELKIEKVEKDAKEAFDTYLYKVI 126

Query: 284 -ISEPFARLLLTMYE--NGGTSVIPKNFLQQFSLLRPDLN--IPKDQQDTQEFLVILLDI 338
            +     +LL  + E  +        NF++   +L   ++  I   QQD  E   I+L++
Sbjct: 127 PVHYALCQLLADLQELIDRPRERSVSNFIR---ILEASIHKRITGGQQDANELTQIVLEV 183

Query: 339 LHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRC 398
           L +EL                    E +    N ++ + + P    F+G++ + L C  C
Sbjct: 184 LQNEL--------------------ESLKKYVNRMELSIEVP-RFPFEGKLASYLSCLNC 222

Query: 399 GNTSY-NYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTT 457
           G TS  N S F +L +  P+      +   +LE+ I     D+I      ++C  C    
Sbjct: 223 GQTSIPNISTFNILPIQTPQ------EYSAELEEIIYGNQIDQI----TDYSCLVCQTNA 272

Query: 458 I---ETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKN 514
           I   E  +      T E+ +     + L   ++++ L   + N           K   K 
Sbjct: 273 ILKNEKTNGHKGNTTDEHEIVKYLEDVLPVLRINEELDSKTLNYI---------KYYNKY 323

Query: 515 KNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNS--TKKNNAVITYPLILNIIMKNN-- 570
             K  N K   +K+ + I+ P IL+IHLSR  YN     +N+  + +   ++I  +    
Sbjct: 324 GMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDE 383

Query: 571 ------IDVVKYKLYGLINHQGGLTKGHY 593
                 I++V Y+L  +I H G    GHY
Sbjct: 384 KNENLKIELVDYQLQSIIKHTGTHNSGHY 412

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 18/117 (15%)

Query: 526 LKQLNFIKLPPILVIHLSRFYY---NSTKKNNAVITYPLILNI-----IMKNNIDV--VK 575
           ++QL+  KLPP+L++ L RF +    ++ K N  I + + LN+      M +   V  + 
Sbjct: 352 IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNLT 411

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
           +KL  +I HQG + KGHYT+I          +N   W  F+D ++  ++  + + ++
Sbjct: 412 FKLSAIIPHQGTVDKGHYTTICR--------INGDVWAKFNDSMVTLISEEDMLKEQ 460

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 22/126 (17%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNIIMKNNIDVVK------- 575
           K + F   P +L + L RF Y+       K N    +P  +++    + DV+K       
Sbjct: 386 KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 576 --YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKE 633
             YKL+G++ H G ++ GHY +++  DL         QWY FDDE + K++     +  E
Sbjct: 446 HIYKLHGVLVHTGDISTGHYYTMIKPDLG-------DQWYRFDDERVWKVDRKQVFD--E 496

Query: 634 SFNIEK 639
           +F ++K
Sbjct: 497 NFGLDK 502

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 82/219 (37%), Gaps = 45/219 (20%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VG RNQG TCY+NS++Q  F TK  R L          I  D E K ++     L
Sbjct: 204 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYE-------IPTDEE-KPNDSVPLAL 255

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
              +     S +P + L+       D      Q D QE   IL+D L   +  T      
Sbjct: 256 QRAFYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKGT------ 309

Query: 353 NYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLS 412
                                K  GK  +  +F G++++ ++C+     S     F+ + 
Sbjct: 310 ---------------------KVEGK--LSELFVGKMKSYIKCKNVDYESSRVEEFWDIQ 346

Query: 413 LAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
           L        N K+   L+     +   E++ GEN +  P
Sbjct: 347 L--------NVKDLKNLQQSFENYIEVELMDGENQYAAP 377

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 29/144 (20%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA------VITYPLILNIIMKNNIDVV 574
           E+++ +K L     P IL +HL RF Y  +++NNA       ITYP  L++    +  + 
Sbjct: 541 ERIVGIKHL-----PKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSIS 593

Query: 575 -KYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKK 632
            KY+L G+I H G G   GHY ++   +        +  W  +DDE ++       + +K
Sbjct: 594 KKYELSGIIIHLGAGPQHGHYVAMCKTE--------KFGWLLYDDETVE------AVLEK 639

Query: 633 ESFNIEKDEFDSSKVYVLFYERIE 656
           +      D  D +  Y+LFY+ IE
Sbjct: 640 DVLRHVGDSNDLATAYILFYKTIE 663

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           + G  N GNTCY NS++QCL+    LRD  I
Sbjct: 126 VFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 109/471 (23%), Positives = 173/471 (36%), Gaps = 108/471 (22%)

Query: 226 DATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGT-------KVLRDLFIS-EXXYKDFIK 277
           D+  +I K  + VGL N+GN C+I S +Q L G        K +R + +  E    +  K
Sbjct: 42  DSKQSIGKYTT-VGLINRGNDCFITSSLQGLAGIPRFVEYLKRIRTVLLELETKLSNNAK 100

Query: 278 KDAET------------------KISEPFARLLLTM--YENGGTSVIPKNFLQQF-SLLR 316
            D  T                   + E    L+L +   ++  TS+ PK  +    S+ +
Sbjct: 101 GDNPTVDNTTRHSRLENSSNSLAPLHESLTSLILDLISVKDRKTSISPKIVINTLESIFK 160

Query: 317 PDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKAN 376
               I   Q D  EF +ILL  L +E      LI  +Y     NL     P         
Sbjct: 161 SK--ISSKQNDAHEFTLILLQTLQEE---RSKLI--DYSKQICNLNIPKFP--------- 204

Query: 377 GKSPIDLIFQGQIENCLQCQRC-GNTSYNYSMFYMLSLAIPKIAKENSKNRVKLED---- 431
                   F+G+    L C +C G +  +Y   ++  L++P+   EN  N +  ++    
Sbjct: 205 --------FEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQTSENLSNILAHDETEII 256

Query: 432 ----CINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKL 487
               C+       IL  E   N   C P  I   D   + AT     +N       + K 
Sbjct: 257 DDYSCL-ICQIRAILNHEEYRNFKDCTPDEILMLDRLKNYATKAPINENLPFEVEQYVKR 315

Query: 488 HKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYY 547
           +     S GN                   +  N K   +K+   ++LP IL++HLSR  +
Sbjct: 316 Y-----SKGNL------------------QVSNIKGKVIKKDVVVQLPDILIVHLSRSTF 352

Query: 548 NSTK--------KNNAVIT---YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSI 596
           N           K    IT   Y L  +  +  N   VKY L  ++ H G  + GHY   
Sbjct: 353 NGITYSRNPCNVKFGERITLSEYTLAESGTITENRQ-VKYNLKSVVKHTGSHSSGHYMCY 411

Query: 597 VNKDLNHSLDLNEQQWYNFDDEVIKKLN-SNNTINKKESFNIEKDEFDSSK 646
             K         E ++   D+   ++    NN +NK    N+  +++  S+
Sbjct: 412 RRK--------TEIRFGKEDESSFRRAPVVNNEVNKNREQNVAHNDYKKSR 454

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 72/160 (45%), Gaps = 42/160 (26%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAV---------------ITYPLILNII 566
           +  K+  FI KLP +L+I L RF + N+T K+  V               I Y   L  I
Sbjct: 627 VEAKKQTFIDKLPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHEL-TI 685

Query: 567 MKNNIDVV----------KYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNF 615
            K  I  V          KYKL G++ H G   + GHYT+ V    +  +D    +W+  
Sbjct: 686 PKETISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTADV---YHQEMD----KWFRI 738

Query: 616 DDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           DD  I +LN      K+E     +D FDS   Y+L Y++I
Sbjct: 739 DDVNIAELN------KEEVLKGGEDGFDSRTAYILMYQKI 772

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 103/255 (40%), Gaps = 44/255 (17%)

Query: 146 GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRTLS-TPK------- 197
           GI     KK   ++ S +  L+   S  SV S     S   S P+ +LS TP+       
Sbjct: 229 GIVEDGPKKEKPSKESPKEDLNEAPSPKSVKSWSAIASSAVSKPKVSLSPTPQLKKDKKY 288

Query: 198 -RSSTLMTESLSFVLAR---PAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMV 253
             S+    E L  V  R     +  K+T+  +    N    +   G+ N GN C+++S++
Sbjct: 289 VPSTIKSLEPLGVVALRMCLDQDYIKYTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVL 348

Query: 254 QCLF--------------------GTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLL 293
           Q L                     G+ V   L      Y+ F K+  E +  +P  +  L
Sbjct: 349 QVLLYCKPFISILNVISYRTVAKIGSSVSPSLDACLELYRRFDKQTCENE-KKPVPKSKL 407

Query: 294 TMYENGGTS-----VIPKNFLQQFSLLRP--DLNIPKDQQDTQEFLVILLDILHDELVYT 346
               N G +     + P +F +  S L    DL     Q+D +EFL  LLD LH+E + +
Sbjct: 408 ANGNNVGITPAAEPIKPDDFYKTLSKLPKFRDLRW-GHQEDAEEFLTHLLDQLHEEFITS 466

Query: 347 DDLISNNYVSDDINL 361
            D ++    SD +NL
Sbjct: 467 IDALNE---SDIMNL 478

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 61/131 (46%), Gaps = 20/131 (15%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNST-----KKNN------AVITYPLILNIIMKNNIDVVK 575
           K + F   PPIL + L RF Y+       K N+      +  T P +      +N +   
Sbjct: 378 KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           Y L+G++ H G ++ GHY +++  DL       E QWY FDDE + K+        +E+F
Sbjct: 438 YNLHGVLVHTGDISTGHYYAMIKPDL-------EDQWYRFDDEKVWKVTKKQVF--EENF 488

Query: 636 NIEKDEFDSSK 646
            +++   D  K
Sbjct: 489 GLDRRSEDDLK 499

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 86/217 (39%), Gaps = 47/217 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISE-PFARL 291
           K+   VG RNQG TCY+NS++Q  F TK  R L      YK  I  ++ET  S  P A  
Sbjct: 196 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKL-----VYK--IPTESETPNSSVPLA-- 246

Query: 292 LLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLIS 351
           L   +     S IP + L+       D      Q D QE   IL+D L + ++ T     
Sbjct: 247 LQRAFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMLGT----- 301

Query: 352 NNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                                    GK  +  +F G++++ ++C      S     F+ L
Sbjct: 302 ----------------------PVEGK--LSELFVGKMKSYIKCVNVEYESSRVEDFWDL 337

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAW 448
            L        N KN   L+D    +   E++ GEN +
Sbjct: 338 QL--------NVKNLKCLKDSFENYIEIELMNGENQY 366

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
           YER151C (REAL)
          Length = 910

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 72/161 (44%), Gaps = 43/161 (26%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I   RF + N+  K+NA+  Y                   LI+
Sbjct: 761 VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELII 820

Query: 564 ------NIIMKNNI---DVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWY 613
                 +I +KN+    D   YKL G+I H G G   GHYT+    D+ HS      +WY
Sbjct: 821 PEESMSSITLKNHTSGADDRIYKLTGVIYHHGVGSDGGHYTA----DVYHS---EHNKWY 873

Query: 614 NFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             DD  I +L  ++ +   E      +  DS   Y+L Y++
Sbjct: 874 RIDDVNITELEDDDVLKGGE------EASDSRTAYILMYQK 908

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 65/155 (41%), Gaps = 41/155 (26%)

Query: 239 GLRNQGNTCYINSMVQCLF---------------------GTKVLRDLFISEXXYKDFIK 277
           G+ N+ N C+++S++Q L                      GT   + L      YK F K
Sbjct: 460 GIINRANICFMSSVLQVLLYCEPFIDVLNVLSTRNTNSRIGTSSCKLLDACLTMYKQFDK 519

Query: 278 KDAETKI--SEPFARLLLTMYENGGTSVIPKNFLQQFSL--LRPD------LNIPK---- 323
           +  ET +  ++   R   T  +    S   KNF    +   ++PD        IPK    
Sbjct: 520 ETYETSLESADDNERSTETDAKKPSRS---KNFQHSVNAEAVKPDEFYKTLSTIPKFKDL 576

Query: 324 ---DQQDTQEFLVILLDILHDELVYTDDLISNNYV 355
               Q+D +EFL  LLD LH+EL+   D +S+N +
Sbjct: 577 QWGHQEDAEEFLTHLLDQLHEELISAIDGLSDNEI 611

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 91/410 (22%), Positives = 156/410 (38%), Gaps = 105/410 (25%)

Query: 238 VGLRNQGNTCYINSMVQCLFGT-----------KVLRDL--------------------F 266
           VGL N+GN C+I S +Q L G             +L++L                     
Sbjct: 58  VGLINRGNDCFITSALQALAGIPRFVEYLNGIKSILQELNNPELKSFSRSTRENPTADNI 117

Query: 267 ISEXXYKDFIKKDAETKISEPFARLL--LTMYENGGTSVIPKNFLQQF-SLLRPDLNIPK 323
            ++   ++F   D+ T + E   RL+  L        ++ PK  +    S+ +  ++   
Sbjct: 118 ANDSRLENF--SDSSTPLHESLMRLIADLVSVRESKMTISPKIVVNALESIFKSKMS--S 173

Query: 324 DQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDL 383
            Q D  EF VILL  L +E      L+   +    +N+     P                
Sbjct: 174 KQNDAHEFTVILLQTLQEE---HSRLVK--HTKHMLNVDVPNFP---------------- 212

Query: 384 IFQGQIENCLQCQRC-GNTSYNYSMFYMLSLAIPKIAKEN-----SKNRVKL-ED--CIN 434
            F+G+    L C +C G +  ++   ++  L++P+ + EN     S +  ++ ED  C+ 
Sbjct: 213 -FEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQKSSENLLDILSNDETEIIEDYSCL- 270

Query: 435 FFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVLSPS 494
              +  IL  E   N   C P  +   D     AT        SIN     ++ + ++  
Sbjct: 271 ICRARAILAHEQYRNFKDCAPDELLILDALKDYAT------EASINEDLPLEIDQYINHY 324

Query: 495 SGNXXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNST---- 550
           +                 K+K    N K   +K+   +KLP +LVIHLSR  +N      
Sbjct: 325 T-----------------KDKFCISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSR 367

Query: 551 -------KKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHY 593
                  ++   +  Y  I N+ +  N  +V Y L  ++ H G  ++GHY
Sbjct: 368 NPCNVKFQEEIKLTEYTSIENMKLTENRQIV-YNLKSVVKHTGSHSRGHY 416

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 107/267 (40%), Gaps = 65/267 (24%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD------------------- 279
           GL N GNTC++NS++Q L  +K L + F+ +   K F +++                   
Sbjct: 92  GLVNDGNTCFMNSVLQSLASSKEL-NAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEKD 150

Query: 280 AETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPK-------DQQDTQEFL 332
            + + S  F  LL  +          K + +   LL+   N P        DQ+D QEF 
Sbjct: 151 VDVRFSVAFKELLDKL---NSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFF 207

Query: 333 VILLDILH------DELVYTDDLISNNYVSDDI--------NLGKEYMPWLQ-------N 371
             +L  L       D   + +  I  N + DD         ++G  ++P  Q       N
Sbjct: 208 QNILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLN 267

Query: 372 NLKANGK--------SPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENS 423
           N + + K        +P+D I   +I  CLQC    N    YS+F  LSL +P    EN 
Sbjct: 268 NDENDTKFYTPFKLITPLDGISAERI-GCLQCGE--NGGIRYSVFSGLSLNLP---GENI 321

Query: 424 KNRVKLEDCINFFTSDEILTGENAWNC 450
            + +KL   +  +   EI+ G   + C
Sbjct: 322 GSTLKLTGLLKEWIKPEIIEGVECYRC 348

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 88/233 (37%), Gaps = 55/233 (23%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKV----------LRDLFISEXXYKDFIKKDAETKISEP 287
            G  N GN+CY+NS++QCLF   V          + + F  +  Y     K    KI   
Sbjct: 333 CGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNA 392

Query: 288 FARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD 347
           F +L    Y  G      KN++ Q +      N    QQD  EFL  LL+ L   L   D
Sbjct: 393 F-KLNPENYPEGIKPQSFKNYVGQSNKEFKSNN----QQDATEFLTFLLEQLEKTLFKKD 447

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSM 407
           +  +N                               I +  +E+ +QCQ CGN  Y+Y  
Sbjct: 448 NNPNN-------------------------------IMKFIMEDKIQCQSCGNVKYSYEP 476

Query: 408 FYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIET 460
              + L  P     N +N V  E   NFF  + I      ++CP C  T + T
Sbjct: 477 TEYIQL--PLDGTNNPQNLV--ETLTNFFNGENI-----DFDCPTCKKTVVAT 520

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 84/221 (38%), Gaps = 49/221 (22%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAET-KISEPFARL 291
           K+   VG RNQG TCY+NS++Q  F TK  R L          I  + E    S P A  
Sbjct: 199 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYG-------IPTNGENPNDSVPLA-- 249

Query: 292 LLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLIS 351
           L   +     S  P + L+       D      Q D QE   IL+D              
Sbjct: 250 LQRAFYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDR------------- 296

Query: 352 NNYVSDDINLGKEYMPWLQNNLKA-NGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
                            L+N +K  N +  ++ IF G++++ ++C+     S     F+ 
Sbjct: 297 -----------------LENRMKGTNVEGKLNEIFVGKMKSYIRCKNVDYESSRVEDFWD 339

Query: 411 LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCP 451
           + L        N KN   L++    +   E++ GEN +  P
Sbjct: 340 IQL--------NVKNFKSLQESFENYIEVELMNGENQYAAP 372

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNIIMKNNIDVVK------- 575
           K + F   P +L + L RF Y+       K N    +P  +++    + +++K       
Sbjct: 381 KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 576 YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
           YKL+G++ H G ++ GHY +++   L       E QWY FDDE + K++     +  E+F
Sbjct: 441 YKLHGVLVHTGDISTGHYYAMIKPTL-------EDQWYRFDDEKVWKVDKKQVFD--ENF 491

Query: 636 NIEK 639
            +++
Sbjct: 492 GLDR 495

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 17/115 (14%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNII------MKNNIDVVKY 576
           K + F   PP+L + L RF Y+       K N    +P  +++        K   +   Y
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 577 KLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINK 631
            L+G++ H G ++ GHY +++   L       E QWY FDDE + K+  N    +
Sbjct: 440 NLHGVLVHAGDISTGHYYTLIKPGL-------EDQWYRFDDERVWKVTKNQVFEE 487

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 81/219 (36%), Gaps = 47/219 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           KM   VG RNQG TCY+NS++Q  F TK  R L        +         +   F +L 
Sbjct: 198 KMTGYVGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTENESPNNSVPLALQRSFYQLQ 257

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           ++ +        P + L+       D      Q D QE   IL+D               
Sbjct: 258 VSKF--------PLDTLELTRSFGWDSAEAFTQHDVQELNRILMDR-------------- 295

Query: 353 NYVSDDINLGKEYMPWLQNNLKANG-KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                           L+N +K    +  ++ IF G++++ ++C      S     F+ L
Sbjct: 296 ----------------LENRMKGTSVEGMLNEIFVGKMKSYIKCIDVDYESSRVEDFWDL 339

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
            L        N KN   L++  + +   E+L GEN +  
Sbjct: 340 QL--------NVKNMKGLKESFDNYIEIELLNGENQYQA 370

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 209 FVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263
            + ARPA   +  +P  D T   PK+    GL N GNTCY NS++QCL+  K LR
Sbjct: 76  LLFARPAGKDRRLLPFGDGT---PKVF---GLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 20/119 (16%)

Query: 541 HLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK-YKLYGLINHQGGLTK-GHYT 594
           HL RF Y+   ++N     VI YPL L +    +  V K Y+L G++ H GG  + GHY 
Sbjct: 552 HLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYV 611

Query: 595 SIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYE 653
           +I   +L          W  +DDE ++ +  +  +      N      D +  YVLFY+
Sbjct: 612 AICKHELF--------GWLLYDDETVESVGEDAVLRFIGDVN------DMTTAYVLFYK 656

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 53/132 (40%), Gaps = 34/132 (25%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSP---I 381
            QD  EFL  L+                N +SD + L  + +P          KSP   I
Sbjct: 430 HQDAHEFLNFLM----------------NALSDSLQLQLQRLP---------DKSPENFI 464

Query: 382 DLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEI 441
             +FQG + N ++C  C N + N   F+    AIP    E     + ++D +  F   E+
Sbjct: 465 HTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIPVSEDE----ELNVQDILRDFHQREM 518

Query: 442 LTGENAWNCPKC 453
           L G N + C  C
Sbjct: 519 LNGANKFYCDSC 530

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   +   L   K+ + F   PP+L + L RF Y+       K N    +P  +++
Sbjct: 350 DGENQYAAQGHGLQDAKKGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDL 409

Query: 566 -------IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                  + +++    KY L+G++ H G ++ GHY +++   L       E  WY FDD+
Sbjct: 410 SPYLDPEVQEDSPANAKYNLHGVLVHTGDISTGHYYAMIKPGL-------EDAWYRFDDD 462

Query: 619 VIKKLNSNNTINKKESFN 636
            + ++       +   F+
Sbjct: 463 KVWRVTKKQVFEQNFGFD 480

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           VL  P  +  H     D+     K+   VGL+NQG TCY+NS++Q  + TK  R L
Sbjct: 166 VLRDPTGVLWHNFANYDSK----KVTGYVGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 82/219 (37%), Gaps = 47/219 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VG RNQG TCY+NS++Q  F TK  R L        +         +   F +L 
Sbjct: 200 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQ 259

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           +        S IP + L+       D      Q D QE   IL+D               
Sbjct: 260 V--------SDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDR-------------- 297

Query: 353 NYVSDDINLGKEYMPWLQNNLKANG-KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                           L+NN+K    +  ++ IF G++++ ++C      S     F+ L
Sbjct: 298 ----------------LENNMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARVEDFWDL 341

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
            L        N KN   L++  + +   E++ GEN +  
Sbjct: 342 QL--------NVKNFKNLQESFDNYIEMELMNGENQYAA 372

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 27/131 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNIIMKNNIDVVK------- 575
           K + F   PP+L + L RF Y+       K N    +P  +++    + DV+K       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 576 -------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
                  Y L+G++ H G ++ GHY +++   +       E QWY FDDE + ++     
Sbjct: 442 KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERVWRVTKKQV 494

Query: 629 INKKESFNIEK 639
              +E+F  ++
Sbjct: 495 F--QENFGCDR 503

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 73/149 (48%), Gaps = 28/149 (18%)

Query: 516 NKYKN-EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNI--IMK 568
           N+Y+  E+LI +K+L     P  LV+HL RF Y   K  N      + YP  LNI  +  
Sbjct: 526 NEYQEAERLIGIKEL-----PKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFD 580

Query: 569 NNIDVVKYKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNN 627
           ++I   KY+L  ++ H G   + GHY ++               W  +DDE ++ + S+ 
Sbjct: 581 DSIS-KKYELNSIVVHIGESPQLGHYVTLCKH--------KSYGWLIYDDETVQAV-SDE 630

Query: 628 TINKKESFNIEKDEFDSSKVYVLFYERIE 656
            +++     I  +E  S+  Y+LFYE ++
Sbjct: 631 LVSR-----ILNNEQRSATAYLLFYEEVD 654

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDF 275
           + G +N G TCY NS++Q LF     RD  I      +F
Sbjct: 105 VFGFQNFGYTCYCNSILQALFNIGSFRDGIIGPASIGEF 143

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 26/130 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNIIMKNNIDVVK------- 575
           K + F   PP+L + L RF Y+       K N    +P  +++    + DV+K       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 576 ------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTI 629
                 Y L+G++ H G ++ GHY +++   +       E QWY FDDE + ++      
Sbjct: 442 NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERVWRVTKKQVF 494

Query: 630 NKKESFNIEK 639
             +E+F  ++
Sbjct: 495 --QENFGCDR 502

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 82/219 (37%), Gaps = 47/219 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VG RNQG TCY+NS++Q  F TK  R L        +         +   F +L 
Sbjct: 200 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQ 259

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           +        S IP + L+       D      Q D QE   IL+D               
Sbjct: 260 V--------SDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDR-------------- 297

Query: 353 NYVSDDINLGKEYMPWLQNNLKANG-KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                           L+NN+K    +  ++ IF G++++ ++C      S     F+ L
Sbjct: 298 ----------------LENNMKGTPVEGKLNEIFVGRMKSYIKCINVDYESSRVEDFWDL 341

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
            +        N KN   L++  + +   E++ GEN +  
Sbjct: 342 QM--------NVKNFKNLQESFDNYIEMELMNGENQYAA 372

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 19/133 (14%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   ++  L   K+ + F   P +L + L RF Y+       K N    +P  +++
Sbjct: 362 DGENQYAAQDYGLQDAKKGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDL 421

Query: 566 -------IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                  ++K N     Y L+G++ H G ++ GHY +++  D+         QW+ FDD+
Sbjct: 422 SPYLDPDVLKKNPGPCVYNLHGVLVHSGEISVGHYYAMIKPDVG-------DQWFRFDDD 474

Query: 619 VIKKLNSNNTINK 631
            + ++      ++
Sbjct: 475 KVWRVTKEQAFDE 487

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           K+   +GL+NQG TCY+NS++Q  F TK+ R +
Sbjct: 197 KLTGFIGLKNQGATCYLNSLLQSYFFTKLFRKI 229

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 21/125 (16%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI---IMKNNIDVVK---- 575
           K + F   PP+L + L RF Y+       K N    +P  +++   I K   +  +    
Sbjct: 370 KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 576 -YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
            YKL+G++ H G ++ GHY +++           E QWY FDDE + K+      +  E+
Sbjct: 430 IYKLHGVLVHAGDISTGHYYAMIKPS-------TEDQWYRFDDEKVWKVTKTQVFD--EN 480

Query: 635 FNIEK 639
           F +++
Sbjct: 481 FGLDR 485

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 230 NIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           N  K+   VG +NQG TCY+NS++Q  F TK  R L
Sbjct: 185 NSKKVTGYVGFKNQGATCYLNSLLQSYFFTKYFRRL 220

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
           similar to uniprot|Q01477 Saccharomyces cerevisiae
           YER151C UBP3 Ubiquitin-specific protease that interacts
           with Bre5p to co-regulate anterograde and retrograde
           transport between endoplasmic reticulum and Golgi
           compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 39/158 (24%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRFYY-NSTKKNNAVITY------------------PLIL 563
           +  K+  FI +LP +L+I L RF + N+T K+N+++ Y                   LI+
Sbjct: 682 VEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELII 741

Query: 564 NIIMKNNIDVVK-----YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
            I   ++ +  K     Y L G+I H G     GHYT+    D+ H       +WY  DD
Sbjct: 742 PIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTA----DVYHR---ESDKWYRIDD 794

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
             I +L   + +   E      +  DS   Y+L Y++I
Sbjct: 795 VSIIELEKEDVLKGGE------ESGDSRTAYILMYQKI 826

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 16/121 (13%)

Query: 511 DGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVIT--YPLILNIIMK 568
           +G+N+   ++  L   +++ F   PP+L + L RF Y+        I   Y    +I + 
Sbjct: 357 NGENQYAAQDHGLQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLS 416

Query: 569 NNIDVVK-------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIK 621
           + +D          Y L+G++ H G ++ GHY +++  D + S       WY FDD+ + 
Sbjct: 417 HYLDSAAPKDTPADYILHGVLVHSGDISTGHYYAMIQPDAHGS-------WYRFDDDRVI 469

Query: 622 K 622
           K
Sbjct: 470 K 470

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 81/218 (37%), Gaps = 45/218 (20%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           KM   VG +NQG TCY+NS++Q    TK+ R L        +         +   F  LL
Sbjct: 192 KMTGFVGFKNQGATCYLNSLLQSYHFTKLFRKLVYQIPTEDENPTNSVALALQRAFY-LL 250

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
            T  E   T+ + K+F         D      Q D QE   IL+D L   +  T      
Sbjct: 251 QTSKEPLDTTELTKSFGW-------DTGDAFTQHDVQELNRILMDRLEHRMKGT------ 297

Query: 353 NYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLS 412
                                   GK  I+ +F G++++C++C      S     F+ + 
Sbjct: 298 ---------------------SVEGK--INELFVGKMKSCIKCINVDYESSRVEDFWDIQ 334

Query: 413 LAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
           L        N K+   L++    +   E++ GEN +  
Sbjct: 335 L--------NVKDMKNLQESFEQYIEVELMNGENQYAA 364

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 108/257 (42%), Gaps = 42/257 (16%)

Query: 114 DLKIDYEGQISMKNILDTVKEKSVSILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSS- 172
           +  I + G+I   ++ +T    +   L+Q++ G+ +  + ++ Y    ++ GLS D  S 
Sbjct: 5   EFNIKHMGKIYPISLAETA---TAGHLKQEVEGLTKVPVARQKYM---VKGGLSDDSVSN 58

Query: 173 -TSVLSRKPTLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNI 231
            +SV+     +  + +     +S PK ++  + +     L    +++K         D+ 
Sbjct: 59  LSSVIKAGSNVMLLGTPDADLISKPKGTNHFIED-----LTPDQQMQKF--------DSN 105

Query: 232 PKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARL 291
           P     +GL+N GNTCY+N+ +Q LF    +RDL ++    K   + +   KI     R 
Sbjct: 106 P-----IGLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQDEMHHKIVLEMKRC 160

Query: 292 LLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKD-------QQDTQEFLVILLDILHDELV 344
              +      SV+P   L       P     +D       QQD +E           +L 
Sbjct: 161 FENLENKSYKSVMPLMLLNVLRKCYPQF-AERDAQGGFYKQQDAEELFT--------QLF 211

Query: 345 YTDDLISNNYVSDDINL 361
           +T D++  +  SDD  +
Sbjct: 212 HTFDIVFGDKFSDDFTV 228

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  + +      E +WY F+D+ +
Sbjct: 424 YNLVGIITHQGANSESGHYQAFIRDETD------ENKWYKFNDDKV 463

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 81/219 (36%), Gaps = 47/219 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VG RNQG TCY+NS++Q  F TK  R L        +         +   F +L 
Sbjct: 200 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQ 259

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           +        S IP + ++       D      Q D QE   IL+D               
Sbjct: 260 V--------SDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDR-------------- 297

Query: 353 NYVSDDINLGKEYMPWLQNNLKANG-KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                           L+NN+K    +  +  IF G++++ ++C      S     F+ L
Sbjct: 298 ----------------LENNMKGTPVEGKLSEIFVGKMKSYIKCVNVDYESARVEDFWDL 341

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
            L        N KN   L++  + +   E++ GEN +  
Sbjct: 342 QL--------NVKNFKNLQESFDNYIEMELMNGENQYAA 372

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 60/131 (45%), Gaps = 27/131 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI-------IMKNNIDVVK 575
           K + F   PP+L + L RF Y+       K N    +P  +++       ++K ++D   
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 576 -------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
                  Y L+G++ H G ++ GHY +++   +       E QWY FDDE + ++     
Sbjct: 442 KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERVWRVTKKQV 494

Query: 629 INKKESFNIEK 639
              +E+F  ++
Sbjct: 495 F--QENFGCDR 503

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 41/159 (25%)

Query: 524  ITLKQLNFI-KLPPILVIHLSRFYY-NSTKKNNAVITYPLILNIIMK------NNIDVV- 574
            +  K+  FI KLP +L+IHL RF + N+T K+N++  Y      I K       N ++V 
Sbjct: 875  VEAKKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVI 934

Query: 575  ----------------KYKLYGLINHQG-GLTKGHYTS-IVNKDLNHSLDLNEQQWYNFD 616
                             Y+L G++ H G     GHYT+ I +K+++        +WY  D
Sbjct: 935  PAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADIYHKEVD--------KWYRID 986

Query: 617  DEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
            D  + +L  ++ +   E      +  DS   Y+L Y+++
Sbjct: 987  DVTVTELEKDDVLKGGE------NSTDSRTAYILMYQKL 1019

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
           YER151C
          Length = 795

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 71/157 (45%), Gaps = 39/157 (24%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRFYY-NSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I L RF + N+T K+N++I Y                   L++
Sbjct: 651 VEAKKQTFIDKLPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMI 710

Query: 564 NIIMKNNIDVVK-----YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
            I   ++ + ++     Y L G+I H G     GHYT+    D+ H       +WY  DD
Sbjct: 711 PIESISSTNALRDEDRQYSLSGVIYHHGLSSDGGHYTA----DVYHK---ETDKWYRIDD 763

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             I ++  ++ +   E      D  DS   Y+L Y++
Sbjct: 764 INITEVQKDSVLKGGE------DGVDSRTAYILMYQK 794

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 54/238 (22%)

Query: 164 SGLSRDRSSTSVLSRKPTLSHVPSNPQRTLSTPKR-------SSTLMTESLSFVLAR--- 213
            G+++ +SS S  +R  +LS+V  N   +   P++        ST   E L  V  R   
Sbjct: 275 GGIAKGKSSVSGSARSGSLSNV--NHTSSAQPPQKKDKKYIPPSTKGIEPLGSVALRMCY 332

Query: 214 PAEIKKHTV--PIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLF-------------- 257
             +   +T+  P+++ + +I + ++  G+ N+ N C+++S++Q L               
Sbjct: 333 DPDFIDYTLKNPVLEKSLSI-REVAPRGIINRANICFMSSVMQVLLYCKPFINILNVVGT 391

Query: 258 -------GTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGTSVI----PK 306
                  GT     L      YK F K+  E++  +P  +       N   S+     P 
Sbjct: 392 RNLNARAGTPECTLLDACVNFYKQFDKERLESE-RKPQLKSKQQQTVNSVASIADAIKPD 450

Query: 307 NFLQQFSLLRPDLNIPK-------DQQDTQEFLVILLDILHDELVYTDDLISNNYVSD 357
           +F    S       IPK        Q+D +EFL  LLD LH+E +   D +++N +S+
Sbjct: 451 DFYSALS------KIPKFKDLKWGHQEDAEEFLTHLLDQLHEEFISFIDCLTDNEISN 502

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 27/131 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNIIMKNNIDVVK------- 575
           K + F   PP+L + L RF Y+       K N    +P  +++    + DV++       
Sbjct: 382 KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 576 -------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNT 628
                  Y L+G++ H G ++ GHY +++   +       E QWY FDDE + ++     
Sbjct: 442 KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERVWRVTKKQV 494

Query: 629 INKKESFNIEK 639
              +E+F  ++
Sbjct: 495 F--QENFGCDR 503

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 81/219 (36%), Gaps = 47/219 (21%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VG RNQG TCY+NS++Q  F TK  R L        +         +   F +L 
Sbjct: 200 KVTGYVGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQ 259

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISN 352
           +        S IP + ++       D      Q D QE   IL+D               
Sbjct: 260 V--------SDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDR-------------- 297

Query: 353 NYVSDDINLGKEYMPWLQNNLKANG-KSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                           L+NN+K    +  ++ IF G++++ ++C      S     F+ L
Sbjct: 298 ----------------LENNMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARVEDFWDL 341

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNC 450
            L        N KN   L+   + +   E++ GEN +  
Sbjct: 342 QL--------NVKNFENLQGSFDNYIEMELMNGENQYAA 372

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 17/118 (14%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYPLILNIIMKNNIDV------VKYKL 578
           K+ + ++ P  L++HL +F +N T   K    ++YP+ L++              VKY+L
Sbjct: 634 KRSSILRAPETLLVHLKKFRFNGTTSSKMKQAVSYPMYLDMTEYCETPSGTKQLPVKYEL 693

Query: 579 YGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF 635
             ++ H+G  L+ GHY +   +         +  W  +DDE I K++  N + +  ++
Sbjct: 694 LSVVVHEGRSLSSGHYIAHCRQP--------DGSWATYDDEYINKISELNVLKEANAY 743

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 90/238 (37%), Gaps = 51/238 (21%)

Query: 198 RSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKML-----------SLVGLRNQGNT 246
           + S++  ES+S     P +  +    I D   N+P  +              GL N G T
Sbjct: 355 KKSSITNESVSAPAPAPEQFYQFNETIADQGSNLPSRIIKNWGPEFANRKPKGLLNHGVT 414

Query: 247 CYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDAETKISEPFARLLLTMY-------E 297
           CY N+ VQ +     ++  LF I    YK+ I   +   +S   A   L M+       +
Sbjct: 415 CYTNAAVQAMLHIPAIQHYLFDILRGKYKETI---SPKSVSVMLAETSLRMWALQDKKKK 471

Query: 298 NGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSD 357
           N G  + PK  +     +   ++    Q+D+ E+ + L+  L ++ V     ++ + + D
Sbjct: 472 NLGY-INPKKLIASLETINCMMS-EWQQEDSHEYFMSLMSRLQEDSVPPGHKMTESMIYD 529

Query: 358 DINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAI 415
                                     IF G ++  + C+ CG  S     FY LSL +
Sbjct: 530 --------------------------IFGGLLKQIVTCKSCGGVSTTEQPFYDLSLHL 561

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 61/141 (43%), Gaps = 27/141 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+L+ LK     +LP  L +HL RF Y+  K  N      I YP  L +    +  + K 
Sbjct: 504 ERLVGLK-----RLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKR 558

Query: 576 YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L   + H G G   GHY S+   +           W  FDDE ++ ++    +    S
Sbjct: 559 YELASAVIHLGDGPQYGHYISLCKTET--------FGWLLFDDETVEAVDEQTVL----S 606

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
           F  E    +S   YVLFY  +
Sbjct: 607 FTGE----NSDTAYVLFYNEV 623

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           + G  N GNTCY NS++QC F   V R   +S
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
           YER151C (REAL)
          Length = 905

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 43/161 (26%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRFYY-NSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I   RF + N+  K+NA+  Y                   LI+
Sbjct: 756 VEAKKQTFIDKLPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELII 815

Query: 564 ------NIIMKNNIDVVK---YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWY 613
                 +I +KN+   +    YKL G+I H G     GHYT+    D+ HS      +WY
Sbjct: 816 PEESMSSITLKNHATGIADRNYKLTGVIYHHGISSDGGHYTA----DVYHS---EHNKWY 868

Query: 614 NFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             DD  I +L  ++ +   E      +  DS   Y+L Y++
Sbjct: 869 RIDDVNIIELEDDDVLKGGE------EASDSRTAYILMYQK 903

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 74/175 (42%), Gaps = 54/175 (30%)

Query: 226 DATDNIPKMLSLV--GLRNQGNTCYINSMVQCLF---------------------GTKVL 262
           D  + IP + S++  G+ N+ N C+++S++Q L                      GT   
Sbjct: 441 DTENKIP-LHSIIPRGIINRANICFMSSVLQVLLYCQPFIDVLNVLSTRNTNSRIGTSSC 499

Query: 263 RDLFISEXXYKDFIKKDAETKISEPFARLLLTMYENGGTS-------VIPKNFLQQFSL- 314
           R L      YK F   D ET     + + L +  EN  ++          KNF    +  
Sbjct: 500 RLLDACLTMYKQF---DVET-----YEKSLESANENEKSTETDTKKPTKSKNFQHNATAE 551

Query: 315 -LRPD------LNIPK-------DQQDTQEFLVILLDILHDELVYTDDLISNNYV 355
            ++PD        IPK        Q+D +EFL  LLD LH+EL++  D +S+N +
Sbjct: 552 AVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEELIFAIDGLSDNEI 606

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 66/159 (41%), Gaps = 41/159 (25%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRFYY--NSTKKNNAV---------------ITYPLILNI 565
           +  K+  FI KLP IL+I L RF +  N+ K N                  I+Y   L I
Sbjct: 670 VEAKKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEI 729

Query: 566 --------IMKNNIDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFD 616
                    ++NN     Y+L G+I H G     GHYT+    D+ H      + WY  D
Sbjct: 730 PDETLASSALRNNSSKT-YELSGVIYHHGMSPDGGHYTA----DVFHK---QTKTWYRID 781

Query: 617 DEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           D  I KL  ++ +   E      D  DS   Y+L Y+ +
Sbjct: 782 DVNITKLEDDDVLKGGE------DNMDSRTAYILMYQNV 814

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 59/158 (37%), Gaps = 53/158 (33%)

Query: 239 GLRNQGNTCYINSMVQCLF---------------------GTKVLRDLFISEXXYKDFIK 277
           G+ N  N C+++S++Q L                      G+   + L      YK F K
Sbjct: 375 GIINNANICFMSSVLQVLLYCAPFVDILNVVSTRNMNAKSGSSSAKLLDACLTIYKKFDK 434

Query: 278 KD-------------AETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPK- 323
            +               +K S P A   +T       +V P  F +  S       IPK 
Sbjct: 435 ANYEKEKEKESEKEKPGSKKSSPPAYASIT------EAVNPDEFYRSLS------TIPKF 482

Query: 324 ------DQQDTQEFLVILLDILHDELVYTDDLISNNYV 355
                  Q+D +EFL  LLD LH+EL+   D +S N +
Sbjct: 483 KDLRWGHQEDAEEFLTHLLDQLHEELISAIDSLSENEI 520

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 62/143 (43%), Gaps = 19/143 (13%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYNSTKKN-----------NAVIT 558
           DG+N+   +   L   K+ + F   PP+L + L RF Y+                +++  
Sbjct: 363 DGENQYAAQGHGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDL 422

Query: 559 YPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
            P + +  ++ N     YKL+G++ H G ++ GHY +++           + +WY FDD+
Sbjct: 423 APYMDSEALEQNPGPKIYKLHGVLVHTGDISTGHYYTLIKPS-------TKDEWYRFDDD 475

Query: 619 VIKKLNSNNTINKKESFNIEKDE 641
            + +       +    F+   DE
Sbjct: 476 RVWRATKKQIFDDNFGFDRLPDE 498

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           K+   VG RNQG TCY+NS++Q  + TK  R L
Sbjct: 198 KVTGYVGFRNQGATCYLNSLLQSYYFTKYFRRL 230

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 83/202 (41%), Gaps = 31/202 (15%)

Query: 166 LSRDRSSTSVLSRKPTLSHVPSNPQR----------------TLSTPKRSSTLMTESLSF 209
           LS D ++  + ++   L+ VP + Q+                T+  P  +  L+    + 
Sbjct: 21  LSNDATALDLKTQVEELTQVPRSRQKFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDAN 80

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSL-VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           +L++PAE K   V  +     + +  S  +GL+N GNTCY+N+ +Q LF    L+DL + 
Sbjct: 81  LLSKPAE-KHRFVEDLSPDQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLILQ 139

Query: 269 EXXYKDFIKKDA----ETKISEPFARLLLTMYENGGTSVIPKNFLQ-------QFSLLRP 317
               K     DA      KI     R   T+ +    SV+P   L        QF+   P
Sbjct: 140 YDPSK-VTNSDANDEIHYKIVLELKRTFETLKKRSFKSVLPIMLLNTLRKCYPQFAERDP 198

Query: 318 DLNIPKDQQDTQEFLVILLDIL 339
                K QQD +E    L   L
Sbjct: 199 QGGFYK-QQDAEELFTQLFHTL 219

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  + +      E +WY F+D+ +
Sbjct: 426 YDLIGVITHQGANSESGHYQAFIRDESD------ENKWYKFNDDKV 465

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 66/142 (46%), Gaps = 25/142 (17%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDV-VK 575
           E+++ LK     KLP  L +HL RF Y   K  N      I YPLIL++    N  +  K
Sbjct: 496 ERIVGLK-----KLPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKK 550

Query: 576 YKLYGL-INHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y+L  + ++  GG   GHY SI   D        +  W  FDDE ++      +IN++  
Sbjct: 551 YELISIVVHLGGGPHHGHYVSICKSD--------KFGWLLFDDETVE------SINEETV 596

Query: 635 FNIEKDEFDSSKVYVLFYERIE 656
                D  D +  YVLFY  I+
Sbjct: 597 LKFVGDPEDQTTAYVLFYREID 618

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 34/129 (26%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
           QQD  EFL  LL+ L+D L  +++    N++ D                           
Sbjct: 395 QQDAHEFLNFLLNELNDFLQLSNE---KNFILDQ-------------------------- 425

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           FQG + N ++C  C   + N   F    L  P I  +N    + ++D +N +   EIL G
Sbjct: 426 FQGTLTNQIKCLTCDTLTSNNEPF----LDFP-IEVKNDDEDLNIQDILNKYHQREILNG 480

Query: 445 ENAWNCPKC 453
            N + C +C
Sbjct: 481 TNKFYCNQC 489

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 237 LVGLRNQGNTCYINSMVQCLF 257
           + G  N GNTCY NS++QCLF
Sbjct: 121 IFGYENFGNTCYCNSILQCLF 141

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 68/142 (47%), Gaps = 27/142 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQL     P IL +HL RF Y+ T+  N      I YPL L +    +  + K 
Sbjct: 550 ERIVGLKQL-----PHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKR 604

Query: 576 YKLYGL-INHQGGLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L G+ ++  GG   GHY S+           NE+  W  FDDE ++      ++++  
Sbjct: 605 YELTGIVVHMGGGPHHGHYVSLCK---------NEKFGWLLFDDETVE------SVDESS 649

Query: 634 SFNIEKDEFDSSKVYVLFYERI 655
                 D  D +  YVLFY+ I
Sbjct: 650 VMKFCGDLHDLTTAYVLFYKEI 671

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 51/130 (39%), Gaps = 27/130 (20%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL  LL+ L D L           +SDD             ++     + ID +
Sbjct: 442 HQDAHEFLNFLLNELSDSL--------QRQISDD-------------SIITPNDNFIDRL 480

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           F+G + N  +C  C N +     F    + +      N      +++ ++ F   E+L G
Sbjct: 481 FKGTMTNQTKCLTCDNITSRDEPFLDFPIEV------NGNCETDIQEMLSDFHQKEMLNG 534

Query: 445 ENAWNCPKCC 454
            N + C KCC
Sbjct: 535 SNKFYCDKCC 544

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 214 PAEIKKHTVPIIDA--TDNIP---KMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263
           P E   H  P++    TD +P       + G  N GNTCY NS++QCL+     R
Sbjct: 117 PNESVDHCFPVLSTHTTDLLPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFR 171

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           VL  P  +  H     D+     K    VG RNQG TCY+NS++Q  F TK  RDL
Sbjct: 235 VLEDPTGVLWHNFINYDSK----KETGYVGFRNQGATCYLNSLLQSYFFTKYFRDL 286

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   ++  L   K+ + F   P +L + L RF Y+       K N    +P  +++
Sbjct: 419 DGENQYAAQDYGLQDAKKGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDL 478

Query: 566 IMKNNIDVVK-------YKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
               + +V+K       Y L+G++ H G ++ GHY +++           + +WY FDDE
Sbjct: 479 SPYMDKEVLKKQKGPNNYNLHGVLVHTGDISTGHYYAMIKP-------TTDDKWYRFDDE 531

Query: 619 VIKKLNSNNTINKKESFN 636
            + ++      ++    N
Sbjct: 532 KVWRVTKKQVFDENFGLN 549

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 18/119 (15%)

Query: 166 LSRDRSSTSVLSRKPTLSHVPSNPQR----------------TLSTPKRSSTLMTESLSF 209
           LS D +S  + S+   L+ VPS  Q+                 L  P  +  L+    + 
Sbjct: 21  LSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIKIYPLIKPGSTVMLLGTPDAN 80

Query: 210 VLARPAEIKKHTVPIIDATDNIPKMLSL-VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           ++++PA+ K + +  +     + +   L VG +N GNTCY+N+ +Q L+    LRD+ +
Sbjct: 81  LISKPAK-KNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMIL 138

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  +L+      E +WY F+D+ +
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELD------ENKWYKFNDDKV 469

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 12/101 (11%)

Query: 527 KQLNFIKLPPILVIHLSRFYYNSTKKNNAV--ITYPLILNIIMKNNIDVVK-YKLYGLIN 583
           K + F KLP  L +HL RF  +    +     I YPL L +    +  + K Y+L G++ 
Sbjct: 531 KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 584 HQGGL-TKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKL 623
           H G   T GHY SI   +        +  W  +DDE I+ +
Sbjct: 591 HVGASPTHGHYVSICKHE--------KYGWLMYDDETIESI 623

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 58/152 (38%), Gaps = 22/152 (14%)

Query: 303 VIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLG 362
           V P  F++      P  N    QQD  EFL  LL+ + D         +  Y S+ +   
Sbjct: 395 VSPAEFVKLLKRQNPLFNSTM-QQDAHEFLNFLLNNISD--------FAGKYKSNYLKSS 445

Query: 363 KEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKEN 422
            E    + ++        +   F+G + N ++C  C   S N   F    + I       
Sbjct: 446 NEEECEISHDF-------VKDQFEGVLLNRIKCLTCDCVSANEEPFLDFPIEI------Q 492

Query: 423 SKNRVKLEDCINFFTSDEILTGENAWNCPKCC 454
           +   + ++D    F   EIL G N + C +CC
Sbjct: 493 NDEAINIQDTFRSFYQREILCGPNKFYCNECC 524

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 80/203 (39%), Gaps = 43/203 (21%)

Query: 223 PIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDA 280
           PI+     +   L   GL N G TCY N+ VQ +     ++  LF +    +K+ IK D+
Sbjct: 296 PIVKNWGPVLTNLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLRGSHKNTIKADS 355

Query: 281 ETKISEPFARLLLTMY-----ENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFL 332
            T++    A     M+      N  T + PK  + +      D+N       Q+D+ E+ 
Sbjct: 356 VTQV---LAETSKKMWWRDKKHNKSTYINPKKLISRLD----DINCMMSEWQQEDSHEYF 408

Query: 333 VILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENC 392
           + L+  L ++ V     ++ + V D                          +F G ++  
Sbjct: 409 MSLMSRLQEDSVPKGRKMTESIVYD--------------------------VFGGMLKQI 442

Query: 393 LQCQRCGNTSYNYSMFYMLSLAI 415
           + C+ CG+ S      Y LSL +
Sbjct: 443 VTCKSCGSVSKTEQPIYDLSLHL 465

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 63/138 (45%), Gaps = 19/138 (13%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   +   L   K+ + F   PP+L + L RF Y+       K N    +P  +++
Sbjct: 359 DGENQYAAQRYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDL 418

Query: 566 -------IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                  + K   + + Y L+G++ H G ++ GHY +++   L+        +WY FDD+
Sbjct: 419 SPYLDPEVRKIRPESMMYNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDD 471

Query: 619 VIKKLNSNNTINKKESFN 636
            + ++       +   F+
Sbjct: 472 KVWQVTKKQVFEQNFGFD 489

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLL 292
           K+   VGL+NQG TCY+NS++Q  + TK  R L          I  D ET  +     L 
Sbjct: 194 KVTGFVGLKNQGATCYLNSLLQSYYFTKYFRKLVYH-------IPTDGETPSNSVPLALQ 246

Query: 293 LTMYENGGTSVIPKNFLQQFSLLRP---DLNIPKDQQDTQEFLVILLDILHDELVYTD 347
              Y+   +S      L  F L R    D      Q D QE   IL+D L +++  T+
Sbjct: 247 RAFYKLQRSS----EPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKATE 300

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 88/402 (21%), Positives = 149/402 (37%), Gaps = 96/402 (23%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLF-----------ISEXXYKDFIKKDAETKIS 285
           + GL N GNTC++NS++Q L  +K L D               +    D  K+D +   +
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQEQEQEQEQVGDEKKEDVDIGFT 186

Query: 286 EPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPK-------DQQDTQEFLVILLDI 338
                LL  +          + + +   LL+   N P        DQ+D QEF   +L  
Sbjct: 187 LSLNELLSQL---NAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSE 243

Query: 339 LHDEL---------------------------VYTDDLISNNYVSDDI--NLGKEYMPWL 369
           L   L                           +   DL  +  +  +    +G  Y+P  
Sbjct: 244 LEKNLKSISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIPTE 303

Query: 370 Q-----------NNLKANGKSPIDLI--FQGQIENCLQCQRCG-NTSYNYSMFYMLSLAI 415
           Q           +N +    +P  LI    G     + C +CG N    YS+F  LSL +
Sbjct: 304 QIEPNTSTALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSLNL 363

Query: 416 PKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETY--DEADSPATVENR 473
           P    EN    +KL + +N +   EI+ G     C +C    I+++  D+ +        
Sbjct: 364 P---NENIGMTLKLSNLLNEWIKPEIIDG---VECNRCALEAIKSHLLDQLEQYHNNSTE 417

Query: 474 VKNKSINPL--NFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI----TLK 527
           +  K I+ +      L K+LS                  D ++  K   E ++      K
Sbjct: 418 IPQKLIDAVKDRVECLQKILSKPV--------------IDEEDYKKLHTENMVRKCSKSK 463

Query: 528 QLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           Q+   + PP+L IH++R  ++      +KNN+ + +   LN+
Sbjct: 464 QILISRPPPLLSIHINRSVFDVRTYQIRKNNSRVLFKSKLNL 505

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 10/120 (8%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMYE 297
           VGL+N GNTCY+NS +Q L+  K LRD  ++    ++   ++   ++     R    + +
Sbjct: 60  VGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHHQLVSELRRCFQQLKD 119

Query: 298 NGGTSVIPKNFLQQFSLLRPDLNIPKD-------QQDTQEFLVILLDILHDELVYTDDLI 350
               SV P   L       P     +D       QQD +E    + + L   +V+ D+L+
Sbjct: 120 KPQESVTPMLLLAMLRKCYPQF-AERDQESGFYKQQDAEELFTQIFNSLR--VVFGDNLV 176

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY S +  +++      E +WY F+D+ +
Sbjct: 380 YNLIGVITHQGANSESGHYQSFIRDEVD------ENKWYRFNDDKV 419

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 58/122 (47%), Gaps = 25/122 (20%)

Query: 527 KQLNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI---IMKN-----NIDVV 574
           K + F   PP+L + L RF Y+       K N    +P  +++   I K      N +  
Sbjct: 380 KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 575 KYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
            Y L+G++ H G ++ GHY +++   ++        +WY FDD+ + +      + KK++
Sbjct: 440 IYNLHGVLVHAGDISTGHYYTMIRPGVS-------DEWYRFDDDKVWR------VTKKQA 486

Query: 635 FN 636
           F+
Sbjct: 487 FD 488

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           K+   VG +NQG TCY+NS++Q  F TK  R L
Sbjct: 198 KVTGYVGFKNQGATCYLNSLLQSYFFTKYFRRL 230

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 42/160 (26%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITYPLILNIIMK--------NNIDV 573
           +  K+  FI +LP +L+I L RF + N+  +   ++ Y      I K        +++ +
Sbjct: 687 VEAKKQAFIDRLPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIKYDHDLTI 746

Query: 574 VK------------------YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYN 614
            K                  YKL G++ H G   + GHYT+ V       L  +E++WY 
Sbjct: 747 PKEALSSINAKFLFSDNDTSYKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYR 799

Query: 615 FDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
            DD  + +      INK+E     ++   S   Y+L Y+R
Sbjct: 800 IDDTTVTE------INKEEVVTGGEEGSHSRTAYILIYQR 833

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 95/471 (20%), Positives = 169/471 (35%), Gaps = 120/471 (25%)

Query: 239 GLRNQGNTCYINSMVQCL----FGTKVLRDLFISEXXYKDFIKKDAETKI--SEPFARLL 292
           GL N  N C+INS +Q L    + T  L D  +     ++ ++K+  T +  +   + ++
Sbjct: 66  GLSNPANECFINSSLQALSSLDYLTAYLHDALLLLSPEEEDVEKNEGTGVLLTRSLSDIV 125

Query: 293 --LTMYENGGTSVIPKNFLQQFS-LLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
             L        ++  K F++    + R  ++  + Q D  EF  +L+D L  E V     
Sbjct: 126 GQLQTVTCAPQTLSNKQFVRSLERIFRGRMS--RTQNDAHEFTQLLVDTLESENVTVLAP 183

Query: 350 ISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIEN---CLQCQRCGNTSYNYS 406
           + +                         ++ +   F+G+  +   CL+C++    S    
Sbjct: 184 LCD-------------------------ETALKFPFEGETTSFSVCLKCKQYSEVSAQ-- 216

Query: 407 MFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADS 466
            F +  L +PK      K+   LED +    S+ I      ++C  C  T I T +E+++
Sbjct: 217 KFLIHELVVPK------KSDAHLEDILTDGDSELI----EDYSCLYCQITAILT-NESNT 265

Query: 467 ---PATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKL 523
              P   E  +            L  +L     N           KS  K        K 
Sbjct: 266 TKPPTGFEAEMVGS---------LQSLLPDLKINTALPDTLLDYVKSYRKGNCNTSILKT 316

Query: 524 ITLKQLNFIKLPPILVIHLSRFYYN--STKKNNAVITYPLILNIIMKN----NIDVVKYK 577
             +++      P IL +HLSR  +N  S  +N   + YP  L ++ ++      + + Y+
Sbjct: 317 AIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERITYR 376

Query: 578 LYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESF-- 635
           L  +I H G    GHY                 Q Y    +++K + +  T+N+  +   
Sbjct: 377 LRSMIKHTGTHYSGHY-----------------QCYKHKPDLVKLMGTGVTVNRSPTVLA 419

Query: 636 -------------------------------NIEKDEFDSSKVYVLFYERI 655
                                          N  K   +S  VY+LFYER+
Sbjct: 420 RPPMIQERVKTPKSVRRWPYWFISDAVVRESNAGKMLRESKYVYMLFYERV 470

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 83/212 (39%), Gaps = 45/212 (21%)

Query: 238 VGLRNQGNTCYINSMVQCLF--GTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM 295
            GL N GN+CY+NS++Q L   G       F+      D +      K    + +LL  M
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQ--WIKLLNAM 380

Query: 296 ------YENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
                 Y NG   + P  F +       + +  + QQD  EFL  LLD L          
Sbjct: 381 KHEPKLYANG---IKPTTFKKCIGKNHEEFSSNR-QQDAMEFLTFLLDSL---------- 426

Query: 350 ISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFY 409
              N+ SD+                A   +P DL+ +  +E+ LQC +CG   Y+Y    
Sbjct: 427 -DRNFFSDN---------------SAGASNPNDLM-RFMMEDRLQCNKCGKVKYSYEPAE 469

Query: 410 MLSLAIPKIAKENSKNRVKLEDCINFFTSDEI 441
            + L +    KEN + +  LE    +F    I
Sbjct: 470 AIQLPL----KENDEPQDLLERIKAYFEGQTI 497

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 68/157 (43%), Gaps = 38/157 (24%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITYPLILNIIMKNNIDVV------- 574
           +  K+  FI +LP +L++ L RF + N+  K+N ++ Y  I   I K    +        
Sbjct: 711 VEAKKQTFIDRLPQVLLVQLKRFSFVNNEDKDNNMMNYNSINGRIEKIRKKISYGHELVI 770

Query: 575 ---------------KYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                          KY+L G+I H G     GHYT+ V    N + D    +WY  DD 
Sbjct: 771 PEESLSPHSWSQTNRKYQLTGVIYHHGLSSDGGHYTADV---FNKTAD----KWYRIDDI 823

Query: 619 VIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
            I +L  ++ +   E      D  D+   Y+L Y+++
Sbjct: 824 NITELKKDDVLKGGE------DGTDTRTAYILMYQKL 854

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 29/150 (19%)

Query: 239 GLRNQGNTCYINSMVQCLF---------------------GTKVLRDLFISEXXYKDFIK 277
           G+ N  N C+++S++Q L                      G    + L      Y  F K
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINILNVVSINSNIMKPGVNQTKLLDACIKLYSRFDK 479

Query: 278 KDAET-----KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRP--DLNIPKDQQDTQE 330
           +  E      K +E  ++   + Y    T++ P+ F +  S +    DL     Q+D +E
Sbjct: 480 ESFEAEKEKEKDNESSSKKQSSQYNAKATAISPEEFYKVLSTISKFKDLKW-GHQEDAEE 538

Query: 331 FLVILLDILHDELVYTDDLISNNYVSDDIN 360
           FL  LLD LH+E +   + ++NN V + IN
Sbjct: 539 FLTHLLDQLHEEFISVIESLTNNEVMNLIN 568

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 86/222 (38%), Gaps = 49/222 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLF--GTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLL-- 293
            GL N GN+CY+NS +QCLF  G K      +      + +      K      R  L  
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKE 390

Query: 294 --TMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLIS 351
             T+Y+ G   + PK+F +       + +  + QQD  EF    +D L  +L    D   
Sbjct: 391 EPTIYKQG---IRPKSFKKCIGGSHEEFSSGR-QQDALEFFTYFVDELDKKLFKNSDY-- 444

Query: 352 NNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411
                                      +P DL+ +  +E+ LQCQ C    Y+     ++
Sbjct: 445 ---------------------------NPNDLM-KFMMEDRLQCQECHGVKYSTETSNVI 476

Query: 412 SLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
            L +     + S +   LE+ IN + S E++     + CP C
Sbjct: 477 QLPL-----QESNDAQDLEERINAYFSGEVI----EFKCPNC 509

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 196 PKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSL-VGLRNQGNTCYINSMVQ 254
           P  +  L+  + + ++++PAE K   +  +   + + +   L +G +N GNTCY+NS +Q
Sbjct: 66  PGSTLMLLGTADAGLVSKPAE-KNQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQ 124

Query: 255 CLFGTKVLRDLFIS 268
            L+  K LR+L +S
Sbjct: 125 ALYRIKPLRELILS 138

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y+L G+I HQG  ++ GHY S +  D +      E +WY F+D+ +
Sbjct: 431 YELVGVITHQGANSESGHYQSFIRDDYD------EDKWYKFNDDKV 470

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 94/224 (41%), Gaps = 50/224 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKV-------LRDLFISEXXYKDFIKKDAETKISEPFAR 290
            GL N GN+CYINS++QCL    V       L + F  +  Y     K    K++    +
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAI-K 380

Query: 291 LLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLI 350
           L   +Y +G   + P++F +       + +  + QQD  EFL    D L D+ +++    
Sbjct: 381 LEPELYPSG---IRPRSFKKCIGQAHEEFSSER-QQDALEFLSFFNDTL-DKKIFSRS-- 433

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
                              +NN       P DL+ +  IEN LQC +CG   Y   +   
Sbjct: 434 -------------------ENN-------PSDLM-RYIIENRLQCTKCGKVKYTTDINE- 465

Query: 411 LSLAIPKIAKENSKNRVKLED-CINFFTSDEILTGENAWNCPKC 453
            S+ +P     +S++   L D  + +F  +E+      + CP+C
Sbjct: 466 -SMLVPLEENSDSQHSQSLLDRLVEYFHGEEL-----DFKCPQC 503

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
           Anc_8.202 YER151C
          Length = 829

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 68/159 (42%), Gaps = 45/159 (28%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITY------------------PLIL 563
           +  K+  FI KLP +L+I L RF + ++  K+N +  Y                   LI+
Sbjct: 687 VEAKKQTFIDKLPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELII 746

Query: 564 -------NIIMKNNIDVVKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNF 615
                  N  M N     +Y L G+I H G     GHYT+    D+ HS     ++WY  
Sbjct: 747 PSESVSSNATMSNR----EYSLTGVIYHHGLSPDGGHYTA----DVLHS---ESKKWYRI 795

Query: 616 DDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
           DD  I +L  ++ +   E  N      DS   Y+L Y++
Sbjct: 796 DDVNINELEEDDVLKGGEEDN------DSRTAYILMYQK 828

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYV 355
           Q+D +EFL  LLD LH+ELV + +L+S N +
Sbjct: 508 QEDAEEFLTHLLDQLHEELVASINLLSENEI 538

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           +GL+N GNTCY+N+ +QCLF  + LR++ +
Sbjct: 109 IGLKNLGNTCYLNATLQCLFRIEPLREMIL 138

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y L G+I HQG  ++ GHY + + +D       +E+ WY F+D+ +       TI  KE 
Sbjct: 434 YNLIGIITHQGANSESGHYQAFI-RDRE-----DEEIWYKFNDDKV-------TIVDKEK 480

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
                   +S    +L Y+ +
Sbjct: 481 IETLAGGGESDSALILLYKGL 501

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 9/77 (11%)

Query: 526 LKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPLILNI---IMKNN----IDVVKY 576
           +K+    + P IL++HLSR  +N T   +N+  + +   L+     ++NN    +  +KY
Sbjct: 436 VKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKY 495

Query: 577 KLYGLINHQGGLTKGHY 593
           KL  ++ HQG  ++GHY
Sbjct: 496 KLKSMVKHQGTHSQGHY 512

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 21/112 (18%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM-- 295
           +G +N GNTCY+N+ +Q L+  + LRD+ +      D+ +    T + E   ++++ M  
Sbjct: 109 IGFQNMGNTCYLNATLQALYRIEPLRDMIL------DYNQNSTTTPVDETHKKIVVEMKR 162

Query: 296 -YENGGT----SVIPKNFLQ-------QFSLLRPDLNIPKDQQDTQEFLVIL 335
            +EN  +    SV+P   L        QF+   P     K QQD +E    L
Sbjct: 163 CFENLKSKSYKSVMPMVLLTALRKCYPQFAERDPQSGFYK-QQDAEELFTQL 213

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y+L G+I HQG  ++ GHY S +  D++      E +WYNF+D+ +
Sbjct: 425 YELIGVITHQGANSESGHYQSFIRDDMD------EDKWYNFNDDKV 464

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 61/133 (45%), Gaps = 19/133 (14%)

Query: 511 DGKNKNKYKNEKLITLKQ-LNFIKLPPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           DG+N+   ++  L   K+ + F   PP+L + L RF Y+       K N    +P  +++
Sbjct: 362 DGENQYAAQDYGLQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDL 421

Query: 566 -------IMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                  +  N  +   Y L+ ++ H G ++ GHY +++  ++         QW+ FDD+
Sbjct: 422 SPYLDPDVKDNYPNTCIYNLHCVLVHSGDISAGHYYAMIKPNVT-------DQWFRFDDD 474

Query: 619 VIKKLNSNNTINK 631
            + K+      ++
Sbjct: 475 KVWKVTKTQAFDE 487

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDL 265
           K+   +G +NQG TCY+NS++Q  F TK+ R +
Sbjct: 197 KLTGYIGFKNQGATCYLNSLLQSYFFTKLFRKM 229

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 67/148 (45%), Gaps = 24/148 (16%)

Query: 516 NKYKNEKLITLKQ----LNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIM 567
           NK+  +K   L++    +    LP  L IHL RF Y+  +  NA     I YPL L +  
Sbjct: 495 NKFYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCS 554

Query: 568 KNNIDVVK-YKLYGL-INHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
             +  V K Y+L G+ I+  GG   GHY +I   DL          W  FDDE ++    
Sbjct: 555 SFDSAVCKDYELNGIVIHMGGGPHHGHYVAICKNDL--------FGWLLFDDETVE---- 602

Query: 626 NNTINKKESFNIEKDEFDSSKVYVLFYE 653
             +IN++       D  + +  YVL Y+
Sbjct: 603 --SINEETVLKFIGDANELTTAYVLIYK 628

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 51/130 (39%), Gaps = 26/130 (20%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL  LL+ L D L    +L ++           E  P             I+ +
Sbjct: 400 HQDAHEFLNYLLNELSDTLKRDMELDTDKL---------ESKPTF-----------IEDL 439

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           F+G + N  +C  C   +     F    + I           +K++D +N +   E+LTG
Sbjct: 440 FKGSLCNSTKCFTCDTITARDEPFLDFPIEI------QEDEEIKIQDILNNYKHRELLTG 493

Query: 445 ENAWNCPKCC 454
            N + C KCC
Sbjct: 494 ANKFYCDKCC 503

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLR 263
           + G  N GNTCY NS++QCL+     R
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFR 140

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 110/277 (39%), Gaps = 50/277 (18%)

Query: 324 DQQDTQEFLVILLDILHDELVYTD--------------DLISNNYVSDD--INLGKEYMP 367
           +Q+D QEF   +L  L   + + D              DL SN  +  +   ++G  Y+P
Sbjct: 172 EQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIP 231

Query: 368 --------WLQNNLKANGKSPIDLI--FQGQIENCLQCQRCGNTS-YNYSMFYMLSLAIP 416
                    L  +   N  +P  L+    G +   + C  CG T    YS+   LSL +P
Sbjct: 232 TAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP 291

Query: 417 KIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKN 476
               EN  + +KL   +N +   EI+ G    NC +C    +  +        +EN++K 
Sbjct: 292 S---ENIGDTLKLSQLLNEWCKPEIIEGV---NCYRCSLNAVLEH--------LENQLKT 337

Query: 477 KSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI----TLKQLNFI 532
            S  P       K++S                  D +   K   + ++      KQ+   
Sbjct: 338 MSEKPKGSIP-DKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILA 396

Query: 533 KLPPILVIHLSRFYYNST----KKNNAVITYPLILNI 565
           + PP+L IH++R  +++     KKNN+ + +   LN+
Sbjct: 397 RPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNL 433

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 3/41 (7%)

Query: 239 GLRNQGNTCYINSMVQCLFGT-KVLRDLFISEXXYKDFIKK 278
           GL N+GNTC++NS++Q L  + +++R  F+ E   K F +K
Sbjct: 36  GLVNEGNTCFMNSVLQSLASSHEIVR--FLDEEIIKQFKQK 74

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 76/186 (40%), Gaps = 39/186 (20%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD-LF-ISEXXYKDFIKKDA-ETKISEPFARLLL-- 293
           GL N G TCY N+ VQ +     ++  LF I    Y D I  D+  T ++E   ++ L  
Sbjct: 369 GLLNHGVTCYTNAAVQAMLHIPAVQHYLFDILRGKYNDIISPDSVSTVLAETSKKMWLPN 428

Query: 294 -TMYENGGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVYTDDL 349
             + E   T + PK  + +      D+N       Q+D+ E+ + L+  L +        
Sbjct: 429 NQLKEKNVTFINPKKLISRLD----DINCMMSEWQQEDSHEYFMSLMSRLQE-------- 476

Query: 350 ISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFY 409
                  D +  GK+ +           +S I  IF G ++  + C+ CG  S      Y
Sbjct: 477 -------DSVPKGKKLI-----------ESVIYDIFGGLLKQIVTCKSCGGISKTEQPIY 518

Query: 410 MLSLAI 415
            LSL +
Sbjct: 519 DLSLHL 524

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 18/119 (15%)

Query: 166 LSRDRSSTSVLSRKPTLSHVPSNPQR----------------TLSTPKRSSTLMTESLSF 209
           LS D ++  + S+   L+ VPS+ Q+                +L  P  +  L+    + 
Sbjct: 21  LSTDATAADLKSKVEELTQVPSSRQKYMVKGGLTGEESIQISSLIKPGTTVMLLGTPDAN 80

Query: 210 VLARPAEIKKHTVPIIDATDNIPKML-SLVGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           ++++PA+ K + +  +     + +   S VG +N GNTCY+N+ +Q L+    +RD+ +
Sbjct: 81  LISKPAK-KNNFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMIL 138

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  +L+      E +WY F+D+ +
Sbjct: 431 YNLIGVITHQGANSESGHYQAFIRDELD------ENKWYKFNDDKV 470

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
           complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 40/157 (25%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAVITY--------------------PL 561
           +  K+  FI KLP +L++ L RF + N+T K+N +  Y                     +
Sbjct: 677 VEAKKQTFIDKLPQVLLVQLKRFSFINNTDKDNNMTNYNAYNGRIEKIRKKIKYDHELTI 736

Query: 562 ILNIIMKNNIDV--VKYKLYGLINHQG-GLTKGHYTS-IVNKDLNHSLDLNEQQWYNFDD 617
            L  +   +ID     Y+L G+I H G     GHYT+ + +K+L+        +WY  DD
Sbjct: 737 PLESLSPASIDTKNRAYELTGVIYHHGLSSDGGHYTADVYHKELD--------KWYRIDD 788

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
             I +L  ++ +   E  N      D+   Y+L Y +
Sbjct: 789 VNIIELEKDDVLKGGEDGN------DTRTAYILIYRK 819

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           +G +N GNTCY+NS +Q LF   VL+D+ +
Sbjct: 109 IGFQNMGNTCYMNSTLQALFRVDVLKDMIL 138

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY S + +D N     +E +WY F+D+ +
Sbjct: 436 YDLIGIITHQGANSESGHYQSFI-RDEN-----DEDKWYKFNDDKV 475

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 89/230 (38%), Gaps = 52/230 (22%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKV-------LRDLFISEXXYKDFIKKDAETKISEPFAR 290
           VGL N GN+CY+NS++QC +   +       L   F     Y     K    K++    +
Sbjct: 326 VGLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAM-K 384

Query: 291 LLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLI 350
           +   +Y NG   + P  F +       + +  + QQD  EFL  ++D+L +++       
Sbjct: 385 IESDLYPNG---IKPTAFKKCIGGSHNEFSSNR-QQDAMEFLTYMIDVLDNKIF------ 434

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYM 410
                                N   N    +  I + +I    QCQ+C    Y       
Sbjct: 435 ---------------------NTANNPNDTMRFIMEDKI----QCQKCKGVKYMTEPCEA 469

Query: 411 LSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIET 460
           + L  P I  EN++ +  LE   ++F    I      +NCPKC   T+ T
Sbjct: 470 IQL--PLI--ENTEPQDLLERIHSYFQGTSI-----EFNCPKCKEVTLAT 510

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 16/103 (15%)

Query: 181 TLSHVPSNPQRTL--------STPKRSSTLMTESLSFVLARP-------AEIKKHTVPII 225
           +L+HVP   Q+ +        S    SS +   S   +L  P        +   H +  +
Sbjct: 35  SLTHVPQERQKYMVKGGLTDKSASDLSSVIKAGSTVMLLGTPDANLITKPKTASHFIEDL 94

Query: 226 DATDNIPKMLSL-VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
                + +   L +G +N GNTCY+N+ +Q LF    LR+L +
Sbjct: 95  SPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELIL 137

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 14/79 (17%)

Query: 576 YKLYGLINHQGGLT-KGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y L G+I HQG  +  GHY + + +D N     +E  WY F+D+ +       +I +KE 
Sbjct: 430 YNLVGVITHQGANSDSGHYQAFI-RDEN-----DENVWYKFNDDKV-------SIVEKER 476

Query: 635 FNIEKDEFDSSKVYVLFYE 653
                   +S    +L Y+
Sbjct: 477 VEALAGGGESDSALILMYQ 495

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 23/174 (13%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA-ETKISEPFARLLLTMY 296
           +GL N GNTCY+NS +Q L+    LRD+ +      +    D    K+     R    + 
Sbjct: 109 IGLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQ 168

Query: 297 ENGGTSVIPKNFLQ-------QFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDL 349
           +    SV+P  FL        QF+ +     I K QQD +E    L   L        ++
Sbjct: 169 KKSYESVMPVVFLNLLRKCYPQFAEVDNANGIFK-QQDAEELFTQLFSSL--------NI 219

Query: 350 ISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSY 403
           +     +DD  +        +  +K +       I + +I++ L+C   G T++
Sbjct: 220 VFGEKFTDDFEV------QFRTTIKDSNNEDDVTIKENEIDSKLKCHISGTTNF 267

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY S +  + +      E +WY F+D+ +
Sbjct: 427 YDLIGVITHQGANSESGHYQSFIRDEKD------ENKWYKFNDDKV 466

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPLILN----IIMKN---NID 572
           K   +K+   +  P +L+IHLSR  +N     +N+  + +   L     II KN    ++
Sbjct: 440 KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 573 VVKYKLYGLINHQGGLTKGHY 593
            VKY+L   + HQG  + GHY
Sbjct: 500 NVKYRLRATVRHQGTHSAGHY 520

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 34/216 (15%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLT--- 294
           +G+ N GNTCY+N+ +Q LF    LR+  + E   K  IK+  +T  ++    L +T   
Sbjct: 102 MGIANLGNTCYMNATLQGLFRIDPLREQVL-EFDEKRAIKEGVDTYHAQLVRELKVTFQK 160

Query: 295 MYENGGTSVIP-------KNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD 347
           + +  G ++ P       +    QFS   P     K QQD +E    L   L  + V+  
Sbjct: 161 LKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYK-QQDAEELFTQLFHTL--KTVFGS 217

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSM 407
            L+ N  +        ++   LQ+    +     D+I + + +  LQC   G T++  S 
Sbjct: 218 KLMDNFQI--------DFRTTLQDTTNES-----DVIEKVEDDLKLQCHITGATNFMKS- 263

Query: 408 FYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILT 443
                  I +  +EN   R +L    + ++ ++ +T
Sbjct: 264 ------GIKESLRENITKRSELTGASSTYSVEKKIT 293

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 8/46 (17%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  D +       ++WY FDD+ +
Sbjct: 415 YDLIGVITHQGANSESGHYQAFIRDDAD-------EKWYRFDDDKV 453

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 53/130 (40%), Gaps = 19/130 (14%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLI 384
            QD  EFL  LL+ + D +        N +  ++I   +   P   N+L       +D +
Sbjct: 401 HQDAHEFLNFLLNDISDYI--------NAHSKNNIQAHETTNPMDDNHLNF-----VDRL 447

Query: 385 FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
           F+G + N  +C  C N +Y    F   ++ +             ++  +  +   E+L G
Sbjct: 448 FKGTLTNRTKCLTCDNMTYRNEPFLDFAIEV------QDDGETDIQTTLADYHQKELLNG 501

Query: 445 ENAWNCPKCC 454
            N + C +CC
Sbjct: 502 ANKFYCDECC 511

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 64/139 (46%), Gaps = 27/139 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQL F      L +H+ RF Y+  +  N      I YPL L +    +  V K 
Sbjct: 517 ERVVGLKQLPFY-----LALHMKRFKYSEEQNCNVKLFNRIRYPLDLKVCSTFDASVCKQ 571

Query: 576 YKLYGL-INHQGGLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L GL ++  GG   GHY S+           NE+  W  FDDE ++      T+N+  
Sbjct: 572 YELVGLVVHMGGGPHHGHYVSLCK---------NERFGWLLFDDETVE------TVNEST 616

Query: 634 SFNIEKDEFDSSKVYVLFY 652
                 +  D +  Y+LFY
Sbjct: 617 VLKFVGNSDDLTTAYLLFY 635

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 217 IKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263
           IK    P++   D   K+    G  N GNTCY NS++Q ++    LR
Sbjct: 125 IKPSVTPLLPYGDGSNKVF---GYENFGNTCYCNSVLQVIYNLPELR 168

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 63/156 (40%), Gaps = 41/156 (26%)

Query: 527 KQLNFIKLPPILVIHLSRF-YYNSTKKNNAVITYPLILNIIMK--------NNIDVVK-- 575
           KQ    +LP +L+I L RF + N++ +   +I Y      I K          + + K  
Sbjct: 647 KQAFLDRLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEA 706

Query: 576 ----------------YKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDE 618
                           Y+L G++ H G   + GHYT+ V       L   + +WY  DD 
Sbjct: 707 LSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDD- 758

Query: 619 VIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
                N+   I +++ F    +  DS   Y+L Y+R
Sbjct: 759 -----NNVTEIRQEDVFKRGDEASDSKTAYILIYQR 789

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 99/235 (42%), Gaps = 40/235 (17%)

Query: 159 EPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRTLSTPKR---SSTLMTESLSFVLARPA 215
           EPS R+  S  + +++  S+KP    +P+N        KR   SS   +E L  V  R  
Sbjct: 268 EPSGRTMKSWSQVASNAASKKP----IPANVSLAAKKEKRYIPSSIKGSEPLGTVALRMC 323

Query: 216 EIKKHTVPIIDATDNIPKMLSLV---GLRNQGNTCYINSMVQCLF--------------- 257
             K +   +        K + L    G+ N+GN C+++S++Q L                
Sbjct: 324 LDKDYINYVSSTMPESAKAIKLGIPRGIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHAR 383

Query: 258 -GTK---VLRDLFIS-EXXYKDFIK----KDAETKISEPFARLLLTMYENGGTSVIPKNF 308
            G K   +L  L  S    YK+F K    KD   K S    +       +   ++ P++F
Sbjct: 384 TGVKSWTLLPPLLGSCLEFYKEFEKLHADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHF 443

Query: 309 LQQFSLLR--PDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINL 361
            +  S L    DL     Q+D +EFL   LD LH+E V + + +S    SD I+L
Sbjct: 444 YKCISKLPMFKDLQW-GHQEDAEEFLTHFLDQLHEEFVSSINSLS---CSDMIHL 494

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 112/270 (41%), Gaps = 56/270 (20%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTMY 296
           + GL N GNTC++NS++Q L  ++ L   F+ +   +    K+ E   S  F  LL  + 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAH-FLDDIIEESEPNKN-ELNFSVAFKTLLDKLN 122

Query: 297 ENGGTSVIPKNFLQQFSLLR-----PDLNI--PKDQQDTQEFLVILLDILHDELVYTDD- 348
              G +   + + +  +LL+     P+ NI    DQ+D QEF   ++  L  +L   D  
Sbjct: 123 AKYGRN---RKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTD 179

Query: 349 -------------------LISNNYVSDDI-------NLGKEYMPWLQ---NNLKANGK- 378
                              ++ ++  +D +        +G  Y+P  Q   N     G+ 
Sbjct: 180 GDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEH 239

Query: 379 ----SPIDLI--FQGQIENCLQCQRCG-NTSYNYSMFYMLSLAIPKIAKENSKNRVKLED 431
               +P  L+    G I   + C  CG N    YS+   LSL +P    EN    +KL +
Sbjct: 240 ESFYTPYKLLTPLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLP---NENIGATLKLSE 296

Query: 432 CINFFTSDEILTGENAWNCPKCCPTTIETY 461
            ++ +   EI+ G    +C +C    + ++
Sbjct: 297 LLDKWVEPEIIEG---VDCNRCALEAVRSH 323

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 11/116 (9%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLR---DLFISEXXYKD--FIKKDAETKISEPFARLL 292
            GL N GN+CY+NS++QCLF  +       + + E    D  F   +   ++ + +  + 
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNNLRCQLIKLYRAMK 379

Query: 293 L--TMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYT 346
           L   +Y  G   + P++F + FS    +    + QQD  EFL  ++D L  +L  T
Sbjct: 380 LEPELYPQG---IKPQSFKKCFSAGHEEF-ASQRQQDAMEFLTYMIDNLDKKLSPT 431

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 9/51 (17%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNS 625
           YKLYG++ H+G  T+ GHY + + +         + QW  ++DE I  + S
Sbjct: 707 YKLYGIVCHKGNSTQSGHYVAYIRQ--------RDGQWTLYNDEKIVCVES 749

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 27/140 (19%)

Query: 521 EKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNA----VITYPLILNIIMKNNIDVVK- 575
           E+++ LKQL F      L +H+ RF Y+  +  N      I YPL L +    +  V K 
Sbjct: 515 ERVVGLKQLPFY-----LALHMKRFKYSERQNCNVKLFNRIHYPLHLKVCSTFDSSVCKQ 569

Query: 576 YKLYGL-INHQGGLTKGHYTSIVNKDLNHSLDLNEQ-QWYNFDDEVIKKLNSNNTINKKE 633
           Y+L GL ++  GG   GHY SI           NE+  W  FDDE ++      T+N+  
Sbjct: 570 YELVGLVVHMGGGPHHGHYVSICK---------NERFGWLLFDDETVE------TVNEST 614

Query: 634 SFNIEKDEFDSSKVYVLFYE 653
                 +  D +  Y+LFY+
Sbjct: 615 VLKFVGNSDDLTTAYLLFYK 634

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 50/133 (37%), Gaps = 28/133 (21%)

Query: 325 QQDTQEFLVILLDILHDELVYTDDLISNNYV---SDDINLGKEYMPWLQNNLKANGKSPI 381
            QD  EFL  LL+ + D L    + I+         DIN                    +
Sbjct: 402 HQDAHEFLNFLLNEVSDYLGAHSEQIAQGLDVKNPGDINF-------------------V 442

Query: 382 DLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEI 441
           + +FQG + N  +C  C NT+Y    F  L  AI       +  +  L D    F   E+
Sbjct: 443 NRLFQGTLTNRTKCLTCDNTTYRNEPF--LDFAIEVQQDSETDIQTTLAD----FHQKEL 496

Query: 442 LTGENAWNCPKCC 454
           L G N + C  CC
Sbjct: 497 LNGANKFYCDVCC 509

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 217 IKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLR 263
           IK    P++   D   K+    G  N GNTCY NS++Q L+    LR
Sbjct: 125 IKPPVTPLLPYGDGSNKVF---GYENFGNTCYCNSVLQVLYNLPELR 168

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 522 KLITLKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPLILNII---MKNN----ID 572
           K   +K+    + P IL++HLSR  +N     +N+  +T+   L+     ++NN    + 
Sbjct: 434 KSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVK 493

Query: 573 VVKYKLYGLINHQGGLTKGHY 593
            +KYKL  ++ H+G  ++GHY
Sbjct: 494 PIKYKLKAMVKHEGTHSQGHY 514

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 5/40 (12%)

Query: 229 DNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           D IP     +GLRN GNTCY N+ +Q L+  K LR+  ++
Sbjct: 102 DTIP-----MGLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 65/143 (45%), Gaps = 23/143 (16%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLF-------ISEXXYKDFIKKDAETKISEPFARL 291
           G+ N GN C+++S++Q L   +    L         ++     F+  DA  ++   F ++
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKTSAKMGNTGFLLLDACLELYRKFDKV 69

Query: 292 LLTMYE----NGGTSVI---------PKNFLQQFSLLRP--DLNIPKDQQDTQEFLVILL 336
                +    N G S I         P +F +  S L    DL     Q+D +EFL  LL
Sbjct: 70  TFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRWGH-QEDAEEFLTHLL 128

Query: 337 DILHDELVYTDDLISNNYVSDDI 359
           D LH+E V + D +S+N VS+ I
Sbjct: 129 DQLHEEFVQSIDSLSDNDVSNLI 151

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 66/159 (41%), Gaps = 40/159 (25%)

Query: 524 ITLKQLNFI-KLPPILVIHLSRF-YYNSTKKNNAV---------------ITYPLILNII 566
           +  K+  FI KLP + +I L RF + N+T K+  V               I Y   L I 
Sbjct: 636 VEAKKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIP 695

Query: 567 MKNNIDV---------VKYKLYGLINHQG-GLTKGHYTSIVNKDLNHSLDLNEQQWYNFD 616
                 V           YKL G++ H G   + GHYT  V ++      LN  +WY  D
Sbjct: 696 DATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQET-----LN--KWYRID 748

Query: 617 DEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655
           D  ++++  +  +   E  N      DS   Y+L Y+++
Sbjct: 749 DTNVQEIEKDEVLKGGEEGN------DSRTAYILIYQKL 781

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 22/143 (15%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLF-------ISEXXYKDFIKKDAETKI-----SE 286
           G+ N GN C+++S++Q L   +   +L         ++     F+  DA  ++      +
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 287 PFARLLLTMYENG-------GTSVIPKNFLQQFSLLRP--DLNIPKDQQDTQEFLVILLD 337
            F R   +   +G         ++ P +F +  S L    DL     Q+D +EFL  LLD
Sbjct: 408 AFEREKASRSSSGVNISSALADAIKPDDFYKTLSKLPKFKDLRW-GHQEDAEEFLTHLLD 466

Query: 338 ILHDELVYTDDLISNNYVSDDIN 360
            LH+E V + D +S++ V   IN
Sbjct: 467 QLHEEFVNSIDSLSDSEVISLIN 489

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 96/220 (43%), Gaps = 30/220 (13%)

Query: 386 QGQIENCLQCQRCGNTS-YNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTG 444
            G + + L C  CG +S  N   F M SL +P++   +      L   I+   +D+I   
Sbjct: 314 HGSLADSLFCLSCGESSKVNIHEFTMYSLPVPQLINAD------LAQMISDNQTDQI--- 364

Query: 445 ENAWNCPKCCPTTIETYDEADSPATVENR-VKNKSINPLNFFK-LHKVLSPSSGNXXXXX 502
            + ++C  CC       +E       +NR  +N S       K L ++L  +  N     
Sbjct: 365 -SGYSC-LCCKLNAIIANE-------KNRNYQNNSDEENQILKELEELLPKAFINDDLAR 415

Query: 503 XXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNST--KKNNAVITYP 560
                  S  K   K    K   +K+   +  P +L++HLSR  ++    +KN   +++ 
Sbjct: 416 NLSTYINSYEKGGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFE 475

Query: 561 --LILN-IIMKNN--IDVVK--YKLYGLINHQGGLTKGHY 593
             L++N  +++NN  + + K  YKL  ++ HQG  + GHY
Sbjct: 476 EELVVNRQVIENNKCVGIRKDSYKLRSMLRHQGSHSTGHY 515

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 57/150 (38%), Gaps = 41/150 (27%)

Query: 533 KLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMK------------------------ 568
           KLP  L+I   RF + S    N +  Y      I K                        
Sbjct: 636 KLPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKESISPNLVS 695

Query: 569 --NNIDVVKYKLYGLINHQG-GLTKGHYT-SIVNKDLNHSLDLNEQQWYNFDDEVIKKLN 624
             N+ +  KY L G+I H G   + GHYT  + +KDL+        +WY  DD     +N
Sbjct: 696 TSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLD--------KWYRIDD-----VN 742

Query: 625 SNNTINKKESFNIEKDEFDSSKVYVLFYER 654
            +   NK++         DS   Y+L YE+
Sbjct: 743 VDEIKNKEDILRSGDSASDSRTAYILLYEK 772

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 65/145 (44%), Gaps = 36/145 (24%)

Query: 239 GLRNQGNTCYINSMVQCLF-------------GTKVLRDLFISE--XXYKDFIKK-DAET 282
           G+ N+G+ C+I+S++Q L               T V R   +S       D  K+ D ET
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 283 KISEPFARLLLTMYENGGT------------SVIPKNFLQQFSLLRP--DLNIPKDQQDT 328
            ++E     L    EN  T            S+ P+ F +  S L    DL   + Q+D 
Sbjct: 398 IVNE-----LNETRENSKTKSKSSNLNENIISIDPEPFYKSISTLPKFKDLTWGR-QEDA 451

Query: 329 QEFLVILLDILHDELVYTDDLISNN 353
           +EFL  +LD LH+E + + + +++N
Sbjct: 452 EEFLTHMLDQLHEEFIGSINTLNSN 476

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 151/410 (36%), Gaps = 112/410 (27%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYK------------------------- 273
           GL N GNTC++N ++Q +  +K L      E   K                         
Sbjct: 86  GLVNDGNTCFMNCVLQSMASSKELLKFLDEEIACKAKLDEDQSNGDDVNNEKPHNTSKQQ 145

Query: 274 ----DFIKKDAETKISEPFARLLLTMYEN-GGTSVIPKNFLQQFSLLR-----PDLNI-- 321
               +  K + ET     F+  L  + +         + + +   LL+     P+ NI  
Sbjct: 146 QKREEEAKSEGETVPDVTFSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILL 205

Query: 322 PKDQQDTQEFLVILLDILHDELVYTDDLISNNY--VSDDI------------NLGKEYMP 367
             DQ+D QEF   +L  L       D+   + +  +  D+            ++G  Y+P
Sbjct: 206 GYDQEDAQEFFQTMLSELEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAVYIP 265

Query: 368 WLQ--NNLKANGK-----------SPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLA 414
             Q   NL   G            +P+D I   +I  CLQC   G     YS+   LSL 
Sbjct: 266 TEQVTPNLIPPGSKEKYFTKFKLITPLDGILAERI-GCLQCGETGGI--RYSVSSGLSLN 322

Query: 415 IPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTI--------ETYDEADS 466
           +P    +N  + +KL D +  +   EI+ G     C +C    +        + Y++  +
Sbjct: 323 LP---SDNMGSSLKLSDLLKDYIKPEIIEG---VECNRCALIAVRDHLKEQLQQYEDKKA 376

Query: 467 ---PATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKL 523
              PA +    +++        +L KVLS                  D +   K   E +
Sbjct: 377 NAIPAKLCQAFQSR------IQELEKVLSKPV--------------IDDEEYKKLHTENM 416

Query: 524 I----TLKQLNFIKLPPILVIHLSRFYYNST----KKNNAVITYPLILNI 565
           +      KQ+   + PP+L IH++R  ++      +KNNA + +   LN+
Sbjct: 417 VRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNARVLFKSRLNL 466

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
            GL N GNTCY+NS++Q  F  K LRD  +
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           VG +N GNTCY+N+ +Q L+    LRD+ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMIL 138

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  +L+      E +WY F+D+ +
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELD------ENKWYKFNDDKV 469

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 90/383 (23%), Positives = 145/383 (37%), Gaps = 80/383 (20%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI--KKDAETKISEPFAR-LLLT 294
           +GL N  N C+INS +Q L           S   Y + I  K   +  +S P  + L  T
Sbjct: 74  MGLINARNDCFINSSLQALVPLS-------SFTVYLNSILSKLQEDKNLSLPLHKNLAKT 126

Query: 295 MYENGGTSVIPKNFLQQFSLLRPDL----NIPKDQQDTQEFLVILLDILHDELVYTDDLI 350
           +YE     V  +++  +  +   +      I + Q D  EF  +LL+ L  EL       
Sbjct: 127 VYELQKLIVDSESYSAELIISTMEHIFKGTISRQQNDAHEFTQLLLETLFKELAV----- 181

Query: 351 SNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTS-YNYSMFY 409
                          +P          K  I++  +G + N L C RCG+ S     MF 
Sbjct: 182 ---------------LP----------KGVIEVPMKGVVGNHLICIRCGHISQIKEEMFS 216

Query: 410 MLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTI---ETYDEADS 466
           +  L +P+ +        KL D I+    ++I      ++C  C    I   E Y  +D 
Sbjct: 217 IYELNVPQCSSS------KLTDIIHNNQLEKI----EGYSCLYCEINMILKNENYRNSDG 266

Query: 467 PATVENRVKNKSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNK-NKYKNEKLIT 525
             T ++  K K    L + K    L+    N           KS  +   +  K EK   
Sbjct: 267 -FTGDDEEKRK----LRYLK-EVFLNNLMINQELPDDIMHYIKSYKRGYCDISKMEKSDI 320

Query: 526 LKQLNFIKLPPILVIHLSRFYYNSTK--KNNAVITYPLILNI-------------IMKNN 570
            ++   ++ P +L+IHLSR  YN     +N   + +  IL +                N+
Sbjct: 321 FRKRRLLQCPKVLLIHLSRSMYNGMAYTRNPCNVEFENILELEEEQMLQSSPGEKTFINS 380

Query: 571 IDVVKYKLYGLINHQGGLTKGHY 593
              ++Y+L  L+ H G   +GHY
Sbjct: 381 NSKIRYELKSLVKHTGSHYQGHY 403

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 231 IPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           +P      G+ N GNTCY+NS++Q  F  K LRD  +
Sbjct: 691 LPVATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFIL 727

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRD 264
           VGL+N GNTCY+NS +Q L+  + LR+
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLRE 132

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY S +  + +      E +WY F+D+ +
Sbjct: 426 YNLIGVITHQGANSESGHYQSFIRDEAD------ENKWYRFNDDKV 465

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 20/120 (16%)

Query: 166 LSRDRSSTSVLSRKPTLSHVPSNPQR----------------TLSTPKRSSTLMTESLSF 209
           LS D ++  +  +   L+ VPS  Q+                +L  P  +  L+    + 
Sbjct: 21  LSTDATAGDLKGKVEELTQVPSARQKYMVKGGLSGEEAIKIASLIKPGSTVMLLGTPDAN 80

Query: 210 VLARPAEIKKHT-VPIIDATDNIPKMLSL-VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           ++++P  IKK+  +  +     + +   L VG +N GNTCY+N+ +Q L+    LR++ +
Sbjct: 81  LISKP--IKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMIL 138

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  +L+      E +WY F+D+ +
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELD------ENKWYKFNDDKV 469

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           VGL N GNTCY+NS++Q  F    LR+  I+
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 96/237 (40%), Gaps = 46/237 (19%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKV--LRDLFISEXXYKDFIKKDAETKISEP-------F 288
            GL N GN+CY+NS++Q LF   V    D+ +      D I KD    +  P        
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLM------DTIGKDFPVDVVYPSNNVKCQL 372

Query: 289 ARLLLTMYENGG---TSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLD-----ILH 340
            +LL  M  N       + P++F         +    K QQD  EFL   ++     +  
Sbjct: 373 IKLLNAMKINPSRYPEGIKPRSFKNCIGQNNKEFTSNK-QQDALEFLSYFVNELDKKLFK 431

Query: 341 DELVYTDDLISNNYVSDDINLGK----EY---------MPWLQNNLKANGKSPIDLIFQG 387
            EL    DL+   Y+ D +   +    +Y         +P   NN   + +  +D  F+G
Sbjct: 432 KELTNPGDLMR-CYMEDRLQCLRCKHVKYSYQANESIQLPLKDNNEPQDIRERLDAFFKG 490

Query: 388 QI--ENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEIL 442
           ++   NC  CQ+    S    +    +L +       S  R+KLE+ I   T++E+L
Sbjct: 491 EVIEFNCPHCQKMTEASKRPGLKTFPNLLVL------SPIRIKLENWIPIKTANELL 541

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 105/275 (38%), Gaps = 50/275 (18%)

Query: 324 DQQDTQEFLVILLDILH-------------DELVYTDDLISNNYVSDD--INLGKEYMPW 368
           DQ+D QEF   +L  L              +E     D+  N  +  +    +G  Y+P 
Sbjct: 239 DQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELADIPKNAMIGQERLGEMGTVYLPA 298

Query: 369 LQNN----LKANGKS---PIDLI--FQGQIENCLQCQRCG-NTSYNYSMFYMLSLAIPKI 418
            Q +    L    K    P DL+    G     + C +CG N    YS+F  LSL +P  
Sbjct: 299 EQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPS- 357

Query: 419 AKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKS 478
             +   + +KL   +  +   EI+ G     C +C              A +E+  K  +
Sbjct: 358 --DTVGSALKLSQLLREWVKPEIIEG---VECNRCALK-----------AVLEHLEKTLT 401

Query: 479 INPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI----TLKQLNFIKL 534
              +N     K++S  S               D  +  K   E ++      KQ+   + 
Sbjct: 402 QYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKKLHTENMVRKCSKSKQILISRP 461

Query: 535 PPILVIHLSRFYYN----STKKNNAVITYPLILNI 565
           PP+L IH++R  ++    + +KNN+ + +   LN+
Sbjct: 462 PPLLSIHINRSVFDPRTYTIRKNNSKVLFKSRLNL 496

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFISE 269
           GL N GNTC++NS++Q L  +K L      E
Sbjct: 99  GLINDGNTCFMNSVIQSLASSKSLMQFLDEE 129

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 38.1 bits (87), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS-EXXYKDFIKKDAETKI 284
           +GL N GNTCY+NS++Q  F    LR+   S +   + F   D + KI
Sbjct: 725 IGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESFEATDTDAKI 772

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 78/190 (41%), Gaps = 45/190 (23%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLR----DLFISEXXYKDFIKKDAET-KISEPFARLLL 293
           GL N G TCY N+ VQ +     ++    D+ + +  Y   I K++ +  ++E   ++ L
Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGK--YDSTISKNSVSYTLAETSKKMWL 420

Query: 294 TMYEN-----GGTSVIPKNFLQQFSLLRPDLNI---PKDQQDTQEFLVILLDILHDELVY 345
            + +N       + + PK+ + +      D+N       Q+D+ E+ + L+  L ++ V 
Sbjct: 421 PVSKNPRKNVSASYINPKHLISRLD----DINCMMSEWQQEDSHEYFMSLMSRLQEDSVP 476

Query: 346 TDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNY 405
               +  + + D                          IF G ++  + C+ CG+ S   
Sbjct: 477 KGHKLIESIIYD--------------------------IFGGLLKQIVTCKSCGSISKTE 510

Query: 406 SMFYMLSLAI 415
             FY LSL +
Sbjct: 511 QPFYDLSLHL 520

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 87/407 (21%), Positives = 147/407 (36%), Gaps = 92/407 (22%)

Query: 233 KMLSLVGLRNQGNTCYINSMVQCLFGT-----------KVLRDL---------------- 265
           K  + VGL N+GN C+I S +Q L G             +L++L                
Sbjct: 48  KKYTTVGLINRGNDCFITSSLQGLAGMPRFVEYLKQIKSILQELKSNPSRKAKVDNLIVD 107

Query: 266 -FISEXXYKDFIKKDAETKISEPFARLL--LTMYENGGTSVIPKNFLQQFSLLRPDLNIP 322
             +S   +++    D+   + E    L+  L        SV P+  +     +     + 
Sbjct: 108 DVVSCIRFRN--SPDSLAPLHESLMALIFDLVSVRESKKSVSPQMVINTLEAIFKS-KMS 164

Query: 323 KDQQDTQEFLVILLDILHDELVYTDDLISNNYVSDDINLGKEYMPWLQ-NNLKANGKSPI 381
             Q D  E  +++L  L  E     +L+             +YMP +   N    G++  
Sbjct: 165 SRQNDAHECTLLMLQTLQKE---RSNLVGYT----------QYMPEINIPNFPFEGETSK 211

Query: 382 DLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEI 441
            L+       CLQC+  G +  +Y   ++  L++P+   E           +    +DE 
Sbjct: 212 FLV-------CLQCK--GLSKPSYQQTFIRELSVPQQTSEK---------LLTILANDET 253

Query: 442 LTGENAWNCPKCCPTTIETYDEADSPATVENRVKN-KSINP---LNFFKLHKVLSPSSGN 497
              E+ ++C  C    I  ++          R +N K   P   L    L    + +S N
Sbjct: 254 EIIED-YSCSICQIRAILNHE----------RYRNFKDCTPEELLMIEALKNYATKASIN 302

Query: 498 XXXXXXXXXXXKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTK------ 551
                      K   K+K      K   +K+   ++LP ILV+HLSR  +N         
Sbjct: 303 EDLPPELEQYIKRYSKDKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYCRNPC 362

Query: 552 -----KNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHY 593
                +   +  Y L  N  +  N   VKY L  ++ H G  ++GHY
Sbjct: 363 NVEFGERVKLPEYTLAENRAITENRQ-VKYNLKSVVKHTGSHSRGHY 408

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           GL N GNTCY+NS++Q  F    LRD  I+
Sbjct: 748 GLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           +GL+N GNTCY+N+ +Q L+    LR+  +
Sbjct: 104 IGLKNMGNTCYMNATLQALYQITPLREAIL 133

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + +  +++      E +WY F+D+ +
Sbjct: 423 YDLIGVITHQGANSESGHYQAFIRDEMD------ENKWYKFNDDKV 462

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 89/232 (38%), Gaps = 58/232 (25%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDAETKISEPFARLLLTM-- 295
            GL N GN+CY+NS++QCL    V            + I  D    +  P   L   M  
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPN----WSDKLGNIIGHDFPKDVIYPTGNLRCQMIK 397

Query: 296 -----------YENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELV 344
                      YE G   + P++F +       +     +QQD+ EFL            
Sbjct: 398 LLNAFKLNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLT----------- 442

Query: 345 YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYN 404
                    +V++++  G    P +Q +   N  + +  I    +E+ LQC  C N  Y 
Sbjct: 443 ---------FVTEELEKG--LFPKIQ-DASINPNNLLKFI----MEDKLQCVECKNVKYT 486

Query: 405 YSMFYMLSLAIPK---IAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKC 453
           Y     + L + +   +    ++N ++L    ++F  +EI      ++CP C
Sbjct: 487 YQPNECIQLPLKEGNDLVGTTTQNLMEL--ITDYFQGEEI-----EFSCPTC 531

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 220 HTVPIIDATDNIPKMLSL-VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           H +  +     + KM S  +G +N GNTCY+N+ +Q L+ T  +R + +
Sbjct: 92  HFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMIL 140

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 14/81 (17%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKES 634
           Y L G+I HQG  ++ GHY + + +D N     +E +WY F+D+ +       T+ +KE 
Sbjct: 433 YNLIGIITHQGANSESGHYQAFM-RDEN-----DENKWYKFNDDKV-------TVVEKEK 479

Query: 635 FNIEKDEFDSSKVYVLFYERI 655
                   +S    +L Y+ +
Sbjct: 480 IEALAGGGESDSALILMYKGL 500

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 78/176 (44%), Gaps = 25/176 (14%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS-EXXYKDFIKKDAET--KISEPFARLLLT 294
           +G +N GNTCY+N+ +Q L+    LRD  ++ +    +    + ET  K+     R    
Sbjct: 107 IGFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNGENETHIKLVTELKRCFEG 166

Query: 295 MYENGGTSVIPKNFLQ-------QFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTD 347
           +      SV+P   L        QF+   P     K QQD +E L         +L ++ 
Sbjct: 167 LKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYK-QQDAEELLT--------QLFHSM 217

Query: 348 DLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSY 403
            ++  +  +DD  +  ++   +++    N +S +  + +G+ +  LQC   G T++
Sbjct: 218 GIVFGDKFTDDFRI--QFRTTIKD---TNNESDLS-VREGENDLKLQCHISGTTNF 267

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 576 YKLYGLINHQGGLTK-GHYTSIVNKDLNHSLDLNEQQWYNFDDEVI 620
           Y L G+I HQG  ++ GHY + + +D N     +E  WY F+D+ +
Sbjct: 430 YDLVGIITHQGANSESGHYQAFI-RDEN-----DENIWYKFNDDKV 469

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS-EXXYKDF--IKKDAET 282
            G+ N GNTCY+NS++Q  F    LR+  +     Y+DF   K++A+T
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKT 799

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 207 LSFVLARPA--EIKKHTVPII-----DATDNIPKM----LSLVGLRNQGNTCYINSMVQC 255
           ++F+LA  A  E+ KH    +     +     PKM    L   G+ N GNTCY+NS++Q 
Sbjct: 716 VNFILASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQY 775

Query: 256 LFGTKVLRDL 265
            F   + R+ 
Sbjct: 776 YFSITLFREF 785

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 23/105 (21%)

Query: 324 DQQDTQEFLVILL-DILHDELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPID 382
           DQQD QEFL IL  D+   ++ +T   I++N   D + +                K+P +
Sbjct: 140 DQQDAQEFLQILFNDLEKSQIFHTTVKITSN---DALQI----------------KTPFE 180

Query: 383 LIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENSKNRV 427
            I   +++ CL C    N   N+ +F  L+L++P+ +K+ + N +
Sbjct: 181 GILMARMK-CLTCDEISNP--NFKLFSNLTLSLPRYSKQETFNDI 222

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 25/97 (25%)

Query: 559 YPLI-LNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617
           +PL  L  I+ NN  V  Y L  ++ H G    GHY S             E QW+   D
Sbjct: 412 FPLKELGHIIGNNKCV--YSLKSIVVHYGSHDYGHYISYRRF---------EDQWWRISD 460

Query: 618 EVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYER 654
           E + K++             E + F +S ++++FYE+
Sbjct: 461 ESVLKVD-------------EDEVFSASGIFIVFYEQ 484

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 58/277 (20%), Positives = 107/277 (38%), Gaps = 52/277 (18%)

Query: 324 DQQDTQEFLVILLDILHD------------------ELVYTDDLISNNYVSDDINLGKEY 365
           DQ+D QEF   +L  L                    E +  D +I + ++     +G  Y
Sbjct: 222 DQEDAQEFFQTILSELEKDVQSIQGKPEKNAKPVPKEELPGDAIIGSEHIG---RIGTVY 278

Query: 366 MPWLQ---NNLKANGK---SPIDLI--FQGQIENCLQCQRCG-NTSYNYSMFYMLSLAIP 416
           +P  Q   N++  + +   +P  L+  F G     + C +CG N    Y +F  LSL +P
Sbjct: 279 IPTEQIAPNSVLNDPERYYTPFKLLTPFDGITAERVGCLQCGENGGIRYCLFSSLSLNLP 338

Query: 417 KIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKN 476
               +N+ + +KL + +  +   EI+ G     C +C    +         A +  +VK 
Sbjct: 339 N---DNTSSTLKLSELLREWVKPEIIEG---VECNRCALQAVH--------AHLAAKVKE 384

Query: 477 KSINPLNFFKLHKVLSPSSGNXXXXXXXXXXXKSDGKNKNKYKNEKLI----TLKQLNFI 532
                       K++S                  D ++  K   + ++      KQ    
Sbjct: 385 LQAAEDEKAMSAKLISLMKARLEQLEGILAKPAIDDEDYKKLHTDNMVRKCSKSKQTLIT 444

Query: 533 KLPPILVIHLSRFYYNS----TKKNNAVITYPLILNI 565
           + PP+L IH++R  ++      +KNN+ + +   LN+
Sbjct: 445 RPPPLLSIHINRSVFDPRTFMIRKNNSKVLFKSRLNL 481

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVL 262
           GL N GNTC+INS++Q L  ++ L
Sbjct: 89  GLVNDGNTCFINSVIQSLASSREL 112

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVLRD 264
           GL N GNTCY+NS++Q  F    LRD
Sbjct: 702 GLNNIGNTCYLNSLLQYYFSISPLRD 727

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 101/251 (40%), Gaps = 71/251 (28%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVL-----------RD-LFISEXXYKDFIKKDAETKIS 285
            GL N GN+CY+NS+VQ LF   V            RD +F S       IK     KI 
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377

Query: 286 EPFARLLLTMYENGGTSVIPKNFL----QQFSLLRPDLNIPKDQQDTQEFLVILLDILHD 341
                     Y++G      K  +    ++FS  R        QQD  EFL   +D L D
Sbjct: 378 P-------EKYQHGVKPASVKKCIGEDNEEFSSGR--------QQDAMEFLTYFIDKL-D 421

Query: 342 ELVYTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNT 401
             V++                           KA+  +P DL+ +  +E+ L+C +C + 
Sbjct: 422 RKVFS---------------------------KASSSNPNDLM-RFMVEDRLECTKCEHV 453

Query: 402 SYNYSMFYMLSLAIPKIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETY 461
            Y+  +  +L   IP +   +S +   L D ++ + + E L      +CP+C   T+ T 
Sbjct: 454 KYSSQVCEILQ--IPLL---DSNDPQFLMDRLHSYFNGESLD----IHCPQCSEITVATK 504

Query: 462 DEA--DSPATV 470
           +     +PAT+
Sbjct: 505 NSMLKTAPATL 515

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 239 GLRNQGNTCYINSMVQCLFGTKVL 262
           GL N GNTC++NS++QCL  +K L
Sbjct: 85  GLVNDGNTCFMNSVLQCLASSKEL 108

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFI 267
           +GL N GNTCY+NS++Q  F    LR+  +
Sbjct: 710 IGLNNIGNTCYLNSLLQYYFSIAPLREYIL 739

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268
           +G+ N GNTCY+N+ +Q L+G   LR+  ++
Sbjct: 60  MGIVNMGNTCYMNATLQGLYGIVPLREQILA 90

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 237 LVGLRNQGNTCYINSMVQCLFGTKVLRDLFISE 269
           + GL N GNTC++NS++Q L  +K L +   SE
Sbjct: 88  VAGLVNDGNTCFMNSVLQSLASSKTLLEFLDSE 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,398,427
Number of extensions: 3579091
Number of successful extensions: 14801
Number of sequences better than 10.0: 326
Number of HSP's gapped: 14619
Number of HSP's successfully gapped: 586
Length of query: 656
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 540
Effective length of database: 40,180,143
Effective search space: 21697277220
Effective search space used: 21697277220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)