Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G037403.501ON2342348141e-110
KNAG0A079903.501ON2212434581e-56
CAGL0F04829g3.501ON2022344092e-49
TPHA0A057203.501ON2202464094e-49
NDAI0B059203.501ON2351393757e-44
SAKL0F02486g3.501ON2301433625e-42
Suva_16.4823.501ON2351433626e-42
KLTH0G02332g3.501ON2331393531e-40
Smik_16.4063.501ON2121393451e-39
NCAS0F036003.501ON2371433452e-39
Skud_16.4483.501ON2081393423e-39
Kpol_480.83.501ON2391393444e-39
YPR154W (PIN3)3.501ON2151433372e-38
Kwal_47.189053.501ON2361453341e-37
Suva_7.4243.501ON2491383052e-33
AFR320W3.501ON2571393044e-33
TDEL0D056903.501ON2011372944e-32
Smik_6.2323.501ON2411382932e-31
Skud_7.4473.501ON2381392904e-31
YGR136W (LSB1)3.501ON2411392895e-31
ZYRO0D09702g3.501ON1581592741e-29
TBLA0C045303.501ON2221392791e-29
KNAG0B007503.501ON2171392676e-28
Ecym_12283.501ON2531372634e-27
KLLA0E03873g3.501ON220702327e-23
ZYRO0G20372gsingletonON150582154e-21
TBLA0D029103.501ON2691391841e-15
TPHA0C040202.502ON485621421e-09
TBLA0D049501.356ON468601402e-09
Ecym_27471.356ON452621376e-09
Kwal_26.79022.502ON5321371368e-09
CAGL0K02761g2.502ON450601332e-08
SAKL0D09702g1.356ON428531332e-08
TBLA0A025705.470ON493621332e-08
Kwal_0.3711.356ON217531292e-08
Ecym_24402.502ON459571322e-08
NCAS0A089901.356ON434511313e-08
KLLA0B13475g2.502ON508571304e-08
NCAS0A050802.502ON450591305e-08
Smik_8.811.356ON468511296e-08
KLTH0H12980g1.356ON399531296e-08
AEL017W1.356ON416531296e-08
KLLA0E03059g5.470ON428621289e-08
Kpol_1056.372.502ON501591289e-08
NDAI0A043505.470ON459671289e-08
Skud_8.681.356ON475511289e-08
Suva_15.1991.356ON457511271e-07
SAKL0E02200g2.502ON511661271e-07
TPHA0O012801.356ON454531261e-07
YHR016C (YSC84)1.356ON468511261e-07
Smik_7.3351.356ON460621261e-07
TBLA0B054702.502ON539561262e-07
NCAS0B072501.356ON441621252e-07
KLTH0F15114g5.470ON435661252e-07
KAFR0C044001.356ON459531252e-07
TPHA0E015005.470ON457551252e-07
YFR024C-A (LSB3)1.356ON459621252e-07
Kpol_1008.251.356ON449531242e-07
NCAS0A119205.470ON463661242e-07
TDEL0D022401.356ON433651243e-07
CAGL0I08965g1.356ON437531243e-07
KAFR0D033602.502ON455531233e-07
KNAG0C020401.356ON464531233e-07
TDEL0A033405.470ON473621234e-07
Skud_4.6615.470ON460551224e-07
Suva_6.961.356ON455531225e-07
KAFR0E036405.470ON441561225e-07
TPHA0A022101.356ON397531225e-07
KLLA0A08360g1.356ON423531215e-07
TDEL0A027802.502ON451571216e-07
Ecym_23165.470ON421621217e-07
Suva_8.512.502ON456571217e-07
Smik_8.472.502ON447571208e-07
KNAG0C046305.470ON516561208e-07
ZYRO0B01298g2.502ON411551191e-06
YHL002W (HSE1)2.502ON452621191e-06
Kpol_440.105.470ON470591191e-06
Skud_6.1081.356ON459621181e-06
SAKL0G03454g5.470ON468561181e-06
KAFR0A009701.356ON396531181e-06
YDR388W (RVS167)5.470ON482551182e-06
Kwal_55.212875.470ON461661182e-06
TBLA0F034901.356ON511531182e-06
Smik_4.6585.470ON472551172e-06
KLTH0D06138g2.502ON489621172e-06
CAGL0M01650g5.470ON466561172e-06
ZYRO0D11110g5.470ON459561163e-06
NDAI0B045801.356ON424531163e-06
Skud_8.432.502ON454671154e-06
NDAI0G059601.356ON423591145e-06
ZYRO0G00792g1.356ON469531146e-06
NDAI0K021302.502ON459531136e-06
AFR140C5.470ON388491129e-06
Smik_8.1922.159ON633641084e-05
Kwal_47.178942.159ON621631074e-05
KLTH0E09790g2.159ON622641074e-05
CAGL0A02145g1.356ON391521065e-05
ACR266W2.159ON626631065e-05
Ecym_23082.591ON678561041e-04
KNAG0A067102.502ON419591031e-04
YHR114W (BZZ1)2.159ON633641031e-04
SAKL0H24222g4.45ON1526671022e-04
ABR008C2.502ON443501012e-04
SAKL0E10780g2.159ON625651012e-04
Skud_8.1752.159ON633521013e-04
Suva_15.3102.159ON63464995e-04
KLLA0C12551g2.591ON60760978e-04
NDAI0E043907.365ON44571960.001
YLR191W (PEX13)7.365ON38671950.001
KNAG0I015801.356ON58153950.001
Skud_12.2567.365ON40371940.001
Smik_12.2517.365ON38867930.002
TPHA0F031007.365ON38167930.002
NDAI0I002206.366ON61568930.002
ABR082W2.591ON68356930.003
Kpol_538.255.170ON70758920.003
KLLA0D09306g4.45ON153765920.003
Suva_2.564singletonON4339820.004
TPHA0B028902.159ON63452910.004
Ecym_11678.539ON55065910.004
KAFR0L015807.365ON34466890.007
Kpol_1072.562.159ON63755890.009
Suva_10.2877.365ON39267880.010
AGR306C5.170ON92361870.015
TDEL0C018207.365ON38967850.021
TDEL0B052202.159ON61364850.026
TBLA0E015604.45ON139478850.029
SAKL0A00594g6.366ON63651840.034
KLTH0H09416g4.45ON152861840.034
SAKL0H10098g8.539ON55551840.036
Suva_2.1184.108ON116654830.043
Kpol_325.126.366ON57050830.044
SAKL0F11748g7.365ON40872820.046
Ecym_47107.365ON39967820.047
Kwal_33.148357.365ON38465820.048
TBLA0C055602.159ON67351830.051
KLLA0F23848g2.159ON64949820.052
Ecym_25266.366ON52451820.056
KLLA0E19735g7.365ON40867820.057
KNAG0I027006.366ON57550820.059
SAKL0E06820g2.319ON90552820.060
KNAG0B025207.365ON31472810.061
SAKL0G17600g4.335ON44159810.067
KNAG0H035002.159ON63455810.071
KNAG0B050005.170ON85558810.084
Smik_2.1134.108ON123054800.11
YBL007C (SLA1)4.108ON124454800.11
TDEL0A078106.366ON55860790.12
Skud_2.1044.108ON121454800.12
Kpol_534.62.319ON88656800.13
KLLA0A04983g4.108ON125155800.13
Ecym_54262.159ON67254790.14
TBLA0H011608.344ON22450770.15
YDR162C (NBP2)8.344ON23650770.15
KLLA0E23365g8.539ON57551780.18
Smik_3.1866.366ON59153780.19
Skud_3.1606.366ON58653780.20
ZYRO0B16214g2.159ON65948780.20
KAFR0J026506.366ON55350780.20
TPHA0F003804.45ON161842780.21
KLTH0B04818g7.365ON38067770.22
TPHA0H023806.366ON52869770.23
Suva_3.1246.366ON60053770.25
TBLA0A006108.539ON59757770.26
ACR230C7.365ON39867760.26
NCAS0A059704.45ON132366770.27
AEL241W8.539ON54957770.28
YCR088W (ABP1)6.366ON59253770.28
KLLA0D16874g8.344ON22756750.29
KAFR0F007502.159ON60261760.29
Kwal_47.169434.335ON46057760.31
Kwal_14.23134.45ON151769770.31
Suva_2.3268.344ON24050750.33
Skud_4.4208.344ON23350750.34
TDEL0E055204.45ON158959760.35
ZYRO0G10098g4.108ON139263760.38
NDAI0A014707.419ON36756750.39
Kpol_530.187.365ON37166750.42
ZYRO0B02706g7.365ON39667750.44
Kpol_457.12singletonON56758750.46
TPHA0G009302.319ON82453750.46
TBLA0A076107.365ON41367740.49
NCAS0B069802.159ON63963750.51
TBLA0F002806.366ON57651740.51
Ecym_72314.108ON114662740.59
NCAS0B060202.319ON86456740.63
NCAS0A145707.419ON35553730.68
NCAS0D047406.366ON59469730.73
CAGL0E02783g4.108ON120352730.78
AGR170C4.108ON112157730.79
TBLA0B096202.319ON94159730.84
SAKL0H21912g4.108ON125370730.86
CAGL0C03597g6.366ON58053730.87
TDEL0C028107.419ON33758720.92
KLTH0E07744g4.108ON124962721.0
Suva_10.4064.45ON158769721.1
NCAS0E027907.365ON37971711.3
Kwal_23.64376.366ON63157711.4
Smik_4.4068.344ON23553701.5
AGL237C6.366ON57851701.9
Smik_13.2022.591ON66363702.0
KLLA0E06953g7.419ON35753692.0
TBLA0D004507.413ON100556692.3
ZYRO0D17358g6.366ON66850692.5
YMR032W (HOF1)2.591ON66963692.7
KLLA0F14575g5.170ON85155683.4
KLTH0A07348g6.366ON62651683.6
TBLA0C041004.108ON130262683.9
Ecym_71347.419ON33255664.4
NCAS0D019505.170ON93951674.6
NDAI0A033304.108ON122658674.9
ZYRO0F13882g8.344ON28857665.0
Kpol_1025.404.108ON120267675.2
KNAG0B022307.413ON90453666.9
NDAI0J008508.344ON24550647.2
Smik_5.2637.419ON36855648.4
NCAS0A034904.108ON123562649.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03740
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   318   e-110
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   181   1e-56
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   162   2e-49
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   162   4e-49
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   149   7e-44
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   144   5e-42
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   144   6e-42
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   140   1e-40
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   137   1e-39
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   137   2e-39
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   136   3e-39
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   137   4e-39
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   134   2e-38
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   133   1e-37
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   122   2e-33
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   121   4e-33
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   117   4e-32
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   117   2e-31
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   116   4e-31
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   115   5e-31
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   110   1e-29
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   112   1e-29
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   107   6e-28
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   105   4e-27
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...    94   7e-23
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    87   4e-21
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    75   1e-15
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    59   1e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    59   2e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    57   6e-09
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    57   8e-09
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    56   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    56   2e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    56   2e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    54   2e-08
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    55   2e-08
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    55   3e-08
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    55   4e-08
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    55   5e-08
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    54   6e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    54   6e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    54   6e-08
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    54   9e-08
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    54   9e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    54   9e-08
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    54   9e-08
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    54   1e-07
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    54   1e-07
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    53   1e-07
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    53   1e-07
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    53   1e-07
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    53   2e-07
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    53   2e-07
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    53   2e-07
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    53   2e-07
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    53   2e-07
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    53   2e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    52   2e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    52   2e-07
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    52   3e-07
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    52   3e-07
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    52   3e-07
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    52   3e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    52   4e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    52   4e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    52   5e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    52   5e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    52   5e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    51   5e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    51   6e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    51   7e-07
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    51   7e-07
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    51   8e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    51   8e-07
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    50   1e-06
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    50   1e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    50   1e-06
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    50   1e-06
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    50   1e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    50   1e-06
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    50   2e-06
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    50   2e-06
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    50   2e-06
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    50   2e-06
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    50   2e-06
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    50   2e-06
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    49   3e-06
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    49   3e-06
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    49   4e-06
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    49   5e-06
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    49   6e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    48   6e-06
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    48   9e-06
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    46   4e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    46   4e-05
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    46   4e-05
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    45   5e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    45   5e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    45   1e-04
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    44   1e-04
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    44   1e-04
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    44   2e-04
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    44   2e-04
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    44   2e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    44   3e-04
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    43   5e-04
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    42   8e-04
NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.3...    42   0.001
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    41   0.001
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    41   0.001
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    41   0.001
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    40   0.002
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    40   0.002
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    40   0.002
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    40   0.003
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    40   0.003
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    40   0.003
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    36   0.004
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    40   0.004
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    40   0.004
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    39   0.007
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    39   0.009
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    39   0.010
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    38   0.015
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    37   0.021
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    37   0.026
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    37   0.029
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    37   0.034
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    37   0.034
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    37   0.036
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    37   0.043
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    37   0.044
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    36   0.046
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    36   0.047
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    36   0.048
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    37   0.051
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    36   0.052
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    36   0.056
KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]...    36   0.057
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    36   0.059
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    36   0.060
KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.36...    36   0.061
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    36   0.067
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    36   0.071
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    36   0.084
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    35   0.11 
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    35   0.11 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    35   0.12 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    35   0.12 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    35   0.13 
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    35   0.13 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    35   0.14 
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    34   0.15 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    34   0.15 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    35   0.18 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    35   0.19 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    35   0.20 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.20 
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    35   0.20 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    35   0.21 
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    34   0.22 
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    34   0.23 
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    34   0.25 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    34   0.26 
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    34   0.26 
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    34   0.27 
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    34   0.28 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    34   0.28 
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    33   0.29 
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    34   0.29 
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    34   0.31 
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    34   0.31 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    33   0.33 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    33   0.34 
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    34   0.35 
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    34   0.38 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    33   0.39 
Kpol_530.18 s530 (47170..48285) [1116 bp, 371 aa] {ON} (47170..4...    33   0.42 
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    33   0.44 
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    33   0.46 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    33   0.46 
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    33   0.49 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    33   0.51 
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    33   0.51 
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    33   0.59 
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    33   0.63 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    33   0.68 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.73 
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    33   0.78 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    33   0.79 
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    33   0.84 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    33   0.86 
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    33   0.87 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    32   0.92 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    32   1.0  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    32   1.1  
NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.3...    32   1.3  
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    32   1.4  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    32   1.5  
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    32   1.9  
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    32   2.0  
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    31   2.0  
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    31   2.3  
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    31   2.5  
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    31   2.7  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    31   3.4  
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    31   3.6  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    31   3.9  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    30   4.4  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     30   4.6  
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    30   4.9  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    30   5.0  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    30   5.2  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    30   6.9  
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    29   7.2  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    29   8.4  
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    29   9.5  

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  318 bits (814), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/234 (72%), Positives = 169/234 (72%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
           N               TPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 121 KGTCNGQIGMFPANYVKPVTKDSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXTGYYXXXX 180
           KGTCNGQIGMFPANYVKPVTKDSFA                           TGYY    
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDSFAPPPPQYQQYSNNYQQPSYSQPAYPPASTGYYQQPQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
                              SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 181 QVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  181 bits (458), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 129/243 (53%), Gaps = 31/243 (12%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++TN++TELDFLRESE+I+++  ++I+  LP+KYDP+    Q N+     + 
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPN----QHNDNRSRDSS 56

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                 +LEYVEALYAF+PQQ+GDL L  GDK+Q+LEKPSAEWY
Sbjct: 57  ESHA------------------KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWY 98

Query: 121 KGTCNGQIGMFPANYVKPVTKDSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXTGYYXXXX 180
           KG C GQ+GMFP+NYVKP      +                           TGY     
Sbjct: 99  KGKCGGQVGMFPSNYVKPAFSGESSAPKRPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSN 158

Query: 181 XX---------XXXXXXXXXXXXXXXXXSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVN 231
                                          +   K+FGS+LGNAAIFGAGAT+GSD+VN
Sbjct: 159 PPFPPQSANYYPPQQQQQPQQVVVEQQQPHKHNAFKKFGSQLGNAAIFGAGATIGSDIVN 218

Query: 232 SIF 234
           SIF
Sbjct: 219 SIF 221

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  162 bits (409), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 116/234 (49%), Gaps = 32/234 (13%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS + INR++ NI+ ELDFLRES +I++    EI+ +LP           SN   P+   
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP-----------SNGASPV--- 46

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                             PP   LEYVEALY F+PQQ+GDL + AGDK+Q+LEKPSAEWY
Sbjct: 47  ------------------PPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWY 88

Query: 121 KGTCNGQIGMFPANYVKPVTKDSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXTGYYXXXX 180
           +GT NG+ GMFP+NYV+P    S                                     
Sbjct: 89  RGTVNGREGMFPSNYVRPAAAPSANLAPPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQP 148

Query: 181 XXXXXXXXXXXXXXXXXXXSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
                              S  +  LK FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 149 AYYQAPPQQVVVEQQPVQQSSAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  162 bits (409), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 124/246 (50%), Gaps = 38/246 (15%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++T I+TEL+FL+ES++I+     EI   LPE+YDPS+  +           
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSM---------- 50

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                           T   +  LEYVEA+Y F+PQQ+GDL +  GDK+Q+LEK S EWY
Sbjct: 51  ------------LSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY 98

Query: 121 KGTCNGQIGMFPANYVKPVTKDSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXTGYYXX-- 178
           KG+CNG++G+FP+NY    TK +F+                             Y+    
Sbjct: 99  KGSCNGKVGVFPSNY----TKPAFSGSTNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQ 154

Query: 179 ----------XXXXXXXXXXXXXXXXXXXXXSQTNEQLKRFGSKLGNAAIFGAGATLGSD 228
                                          S T + LK FGSKLGNAAIFGAGAT+GSD
Sbjct: 155 PFPPQSTNYYQQAPQQQQQQQQPEQQQQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSD 214

Query: 229 LVNSIF 234
           +VNSIF
Sbjct: 215 IVNSIF 220

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  149 bits (375), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 94/139 (67%), Gaps = 26/139 (18%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++TNI+TELDFL+ES +I+++  ++I  QLP++YDP+  +   + + P    
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPT--- 57

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                  LEYVEA+Y FEPQQEGDL L AGDK+Q++EKPS EW+
Sbjct: 58  -----------------------LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWF 94

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG CNGQ+G+FP+NYV+P 
Sbjct: 95  KGKCNGQVGIFPSNYVRPA 113

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%)

Query: 201 QTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            T E LK+FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 202 HTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  144 bits (362), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 92/143 (64%), Gaps = 28/143 (19%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++T I+TELDFLRESE+I+++   +I   LP++YDP++   +S+        
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSP------ 54

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                  LEYVEA+YAF+ QQ+GDL L  GDK+Q+LEKPS+EWY
Sbjct: 55  ----------------------SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWY 92

Query: 121 KGTCNGQIGMFPANYVKPVTKDS 143
           KG CNG +GMFP+NYVKP    S
Sbjct: 93  KGKCNGSVGMFPSNYVKPAFSGS 115

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (93%)

Query: 203 NEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           ++  K+FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 199 SQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  144 bits (362), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 92/143 (64%), Gaps = 28/143 (19%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++L+NR++TNI+TELDFL+ES +I+    D+I K LP K+DPSS    SN        
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSN-------- 70

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                               +  LEYVEA+Y F+PQQ+GDL L  GDKVQ+LEK S EWY
Sbjct: 71  --------------------SASLEYVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWY 110

Query: 121 KGTCNGQIGMFPANYVKPVTKDS 143
           KG+CNG+ G+FPANYVKPV  DS
Sbjct: 111 KGSCNGRTGIFPANYVKPVFSDS 133

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (88%)

Query: 200 SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           S +N  LK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 201 SSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  140 bits (353), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 89/139 (64%), Gaps = 28/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++ INR+++ ++TEL+FLRES++IT+    +IL  LPE+YDPS    Q          
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQ---------- 50

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                             P A Q E+VEA+YAF+ QQ+GDL L  GDKV++LEKPS EW+
Sbjct: 51  ------------------PSATQGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWF 92

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG CNG++GMFP+NYVKP 
Sbjct: 93  KGKCNGRVGMFPSNYVKPA 111

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (85%)

Query: 200 SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           SQ +   K+FG KLGNAA+FGAGAT+GSD+VNSIF
Sbjct: 199 SQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  137 bits (345), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 28/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++TNI+TELDFL+ES +I+    D+I K LP ++DP S    ++        
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTS-------- 52

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                               +  LEYVEALY F+PQQ+GDL L  GDK+Q+LEK S EWY
Sbjct: 53  --------------------STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY 92

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG+CNG+ G+FPANYVKP 
Sbjct: 93  KGSCNGRTGIFPANYVKPA 111

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 30/33 (90%)

Query: 202 TNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           ++  LK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 180 SHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  137 bits (345), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 88/143 (61%), Gaps = 27/143 (18%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQA----QSNEKLP 56
           MS++ INR++  I+TELDFL+ES +I+Q+  D+I   LP KYDP + +A     SN   P
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 57  LQTVNXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPS 116
               N                       E+VEA+Y FEPQQ+GDL L  GDK++++EKPS
Sbjct: 61  QDQGN-----------------------EFVEAIYPFEPQQQGDLALKPGDKIEVIEKPS 97

Query: 117 AEWYKGTCNGQIGMFPANYVKPV 139
            EW+KG CNGQ GMFP+NYVKP 
Sbjct: 98  PEWFKGRCNGQTGMFPSNYVKPA 120

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%)

Query: 201 QTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            ++  LK+FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 204 HSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  136 bits (342), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 28/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++T I+TELDFL+ES +I+    D+I K LP +++PSS    ++        
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSA------ 54

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                  LEYVEALY F+PQQ+GDL L  GDKVQ+LEK S EWY
Sbjct: 55  ----------------------SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY 92

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG+CNG++G+FPANYVKP 
Sbjct: 93  KGSCNGRVGIFPANYVKPA 111

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 30/33 (90%)

Query: 202 TNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           ++  LK FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 176 SHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  137 bits (344), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 26/139 (18%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MSSA INR++T++KTEL+FLR+S +I+ +  D+I   LP+++DPS +   +N   P    
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSP---- 56

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                  LEYVEA+Y F+PQQ+GDL +  GDK+Q+LEK S EWY
Sbjct: 57  ----------------------NLEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY 94

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG CNG++G+FP+NYVKP 
Sbjct: 95  KGKCNGKVGVFPSNYVKPA 113

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%)

Query: 204 EQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           +  K FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 209 KHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  134 bits (337), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 91/143 (63%), Gaps = 28/143 (19%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++TNI+TELDFL+ S +I+    D+I K LP K+DP++    ++        
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNAS-------- 52

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                              PA+ LEYVEALY F+PQQ+GDL L  GDKVQ+LEK S EWY
Sbjct: 53  -------------------PAS-LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY 92

Query: 121 KGTCNGQIGMFPANYVKPVTKDS 143
           KG+CNG+ G+FPANYVKP    S
Sbjct: 93  KGSCNGRTGIFPANYVKPAFSGS 115

 Score = 55.8 bits (133), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 202 TNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           ++  LK FGSKLGNAAIFGAGA++GSD+VN+IF
Sbjct: 183 SHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  133 bits (334), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 90/145 (62%), Gaps = 28/145 (19%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++ INR+++ ++TEL+FLRES +I +    +IL  LPE+Y+P           P  T 
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEP-----------PRSTP 49

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                              P++Q E+VEA+YAF+ QQ+GDL L  GDK+++LEKPS EWY
Sbjct: 50  TV-----------------PSSQSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWY 92

Query: 121 KGTCNGQIGMFPANYVKPVTKDSFA 145
           KG CNG++GMFP+NYVKP    S A
Sbjct: 93  KGRCNGRVGMFPSNYVKPAFSGSNA 117

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (82%)

Query: 200 SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           S T    K+FG KLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 202 SHTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  122 bits (305), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 86/138 (62%), Gaps = 29/138 (21%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++ NI+ ELDFL+ESE+I+    + I  +LPEK+D           + L+ V
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWD-----------VNLRPV 49

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                             P A+  E+VEALY FEPQQEGDL L  GDK+QILEK S +WY
Sbjct: 50  ------------------PNASVEEFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWY 91

Query: 121 KGTCNGQIGMFPANYVKP 138
           +G  N ++G+FPANYVKP
Sbjct: 92  RGKANNRVGIFPANYVKP 109

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/35 (68%), Positives = 29/35 (82%)

Query: 200 SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           S  +   K FGSKLGNAAIFGAG+T+GSD+V+SIF
Sbjct: 215 SGASSAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  121 bits (304), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 81/139 (58%), Gaps = 28/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MSS LINR++  I+TEL FL +S +IT+QQ ++I   LP            NE L     
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNP----------NEALRGAPA 50

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
           N                   A  +EYVEALYAF+ QQ GDL    G+K+++LEKPS EWY
Sbjct: 51  NN------------------AGPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWY 92

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG CNG++GMFP+NYVKP 
Sbjct: 93  KGRCNGKVGMFPSNYVKPA 111

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 28/28 (100%)

Query: 207 KRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           K+FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  117 bits (294), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (57%), Gaps = 37/137 (27%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++ INR++  ++TELDFLRES +I+Q+  D +                 N+ LP    
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMV-----------------NQSLPQNAS 43

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
           N                       EY+EALY F+PQQ+GDL L  GDK+++LEKPS EW+
Sbjct: 44  NKGG--------------------EYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWF 83

Query: 121 KGTCNGQIGMFPANYVK 137
           KG CNG++GMFPANYVK
Sbjct: 84  KGRCNGRVGMFPANYVK 100

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%)

Query: 201 QTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            ++  LK+FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 168 HSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  117 bits (293), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 29/138 (21%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS+ L+NR++ NI+ EL+FLRES +I+    D I  +LPEK++ +++             
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTR------------- 47

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                           +P  A+  EYVEALY FE QQ+GDL L  GDK+Q+LEK S +WY
Sbjct: 48  ----------------SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY 91

Query: 121 KGTCNGQIGMFPANYVKP 138
           KG  N ++G+FPANYVKP
Sbjct: 92  KGKANNRVGIFPANYVKP 109

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (89%)

Query: 206 LKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            K FGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  116 bits (290), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 81/139 (58%), Gaps = 29/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++LINR++ NI+ EL+FL+ES +I+ +    I   LP K+D +SK A +         
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANN--------- 51

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                               A+  EYVEALY FE QQ+GDL L  GDK+QILEK S +WY
Sbjct: 52  --------------------ASTEEYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWY 91

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG  N  IG+FPANYVKP 
Sbjct: 92  KGKANDMIGIFPANYVKPA 110

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 206 LKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            K FGSKLG+AAIFGAG+T+GSD++NSIF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  115 bits (289), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 83/139 (59%), Gaps = 29/139 (20%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS++L+NR++ NI+ EL+FL+ES +I+    + I  +LPEK+D + +  Q+         
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQN--------- 51

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                               A+  EYVEALY FE QQ+GDL L  GDK+Q+LEK S +WY
Sbjct: 52  --------------------ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY 91

Query: 121 KGTCNGQIGMFPANYVKPV 139
           +G  N +IG+FPANYVKP 
Sbjct: 92  RGKSNNKIGIFPANYVKPA 110

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/35 (68%), Positives = 28/35 (80%)

Query: 200 SQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           S  +   K FGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 207 SGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  110 bits (274), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 79/159 (49%), Gaps = 13/159 (8%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPA---------NY 135
           E+VEA+Y F+PQQEGDL L  GDK+++LEKPS EW++G CNG++GMFP+          +
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 136 VKPVTKDSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXTGYYXXXXXXXXXXXXXXXXXXX 195
            +P                                  T YY                   
Sbjct: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQQEQ 123

Query: 196 XXXXSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
                + +  L +FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 124 ----GKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  112 bits (279), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 81/139 (58%), Gaps = 27/139 (19%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MSS+LIN++++ I TELDFL +S  I ++   +I   LP +      + QSN        
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNS------- 53

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                               +   E+VEA+Y F+PQQ+GDL+L+ GDK+ + EKPS EW+
Sbjct: 54  --------------------SKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF 93

Query: 121 KGTCNGQIGMFPANYVKPV 139
           KG CNG++G+FP+NYV+P 
Sbjct: 94  KGKCNGKVGVFPSNYVRPA 112

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 203 NEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           ++ LK FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 191 HKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  107 bits (267), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 84/139 (60%), Gaps = 25/139 (17%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MS   +NR+ITNI+TEL++L ES++I++   DE  ++LP+ +D       + EK P    
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD-GKPIGGAGEKHP---- 55

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                ++ EYVEA++ ++PQ++ DL L  GDKV+ILEK SA+WY
Sbjct: 56  --------------------PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWY 95

Query: 121 KGTCNGQIGMFPANYVKPV 139
           +G   G++G+FP+NYVK V
Sbjct: 96  RGKNKGKVGVFPSNYVKAV 114

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 212 KLGNAAIFGAGATLGSDLVNSI 233
           + GN+ +FGAG  +GSD+VN I
Sbjct: 192 QFGNSIVFGAGQRIGSDIVNGI 213

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  105 bits (263), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 82/137 (59%), Gaps = 29/137 (21%)

Query: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60
           MSS+LINR++ NIKTEL+FL ES +I+Q Q  +IL  L    + + K A S + L     
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAA-SQQVL----- 54

Query: 61  NXXXXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120
                                   EYVEALYAF PQQ GDL    GDK+++LEKPSA+WY
Sbjct: 55  -----------------------KEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWY 91

Query: 121 KGTCNGQIGMFPANYVK 137
           KG  NG++GMFP+NYVK
Sbjct: 92  KGQHNGRVGMFPSNYVK 108

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 27/29 (93%)

Query: 206 LKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
            K+FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score = 94.0 bits (232), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 55/70 (78%), Gaps = 5/70 (7%)

Query: 78  PPPANQL----EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPA 133
           PP A+ +    E VEALYAF+PQQ+GDL L  GDK++ILEK S EWYKG CNGQ+G+FP+
Sbjct: 43  PPVADTMGQNNEIVEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPS 102

Query: 134 NYVKPV-TKD 142
           NYVK V TKD
Sbjct: 103 NYVKSVDTKD 112

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%)

Query: 201 QTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
           Q +   K+FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 187 QGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 87.4 bits (215), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 47/58 (81%)

Query: 82  NQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
           +Q EYVE LY F+PQ + DL +  GDKV+++EK SA+WYKG CNG+ GMFPANYVKPV
Sbjct: 12  SQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPV 69

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 27/34 (79%)

Query: 201 QTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234
             +  L + GSKLGNAAIFG GATLG+DLV+SIF
Sbjct: 117 HRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 75.5 bits (184), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 71/139 (51%), Gaps = 20/139 (14%)

Query: 4   ALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTVNXX 63
           A I  A T I+  L+ L +++ I++   DEI   L  K    S  + SN   P +     
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSN---PTKGALS- 63

Query: 64  XXXXXXXXXXXXXTPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT 123
                           P N  +YVEA+YA+  +Q+GDL L  GD ++++ K S +WY+G 
Sbjct: 64  ----------------PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGR 107

Query: 124 CNGQIGMFPANYVKPVTKD 142
            NG++G+FP NYVK  + D
Sbjct: 108 LNGKVGVFPTNYVKLYSSD 126

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 212 KLGNAAIFGAGATLGSDLVNSIF 234
           KLGNAA+FGAG+  G+D+VN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 78  PPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVK 137
           P   N +  V A+Y    Q+E +L    GD + +LE+   +W++GT +G+IG+FP NYV 
Sbjct: 225 PQKPNIIRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVT 284

Query: 138 PV 139
           P+
Sbjct: 285 PI 286

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 82  NQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           N L    ALY F+ ++ GDL    GD + I++K  +  +W+ G CNG+ G+FPANYV+ V
Sbjct: 409 NNLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVELV 468

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 2/62 (3%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           P++      ALY F+ +Q+GDL    GD + IL+K ++  +W+ G  NGQ G+FPANYV+
Sbjct: 391 PSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

Query: 138 PV 139
            V
Sbjct: 451 LV 452

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 10/137 (7%)

Query: 9   AITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTVNXXXXXXX 68
           A  +I  + + +RE++   +Q+L+E LK    +Y+ SS Q       P  + N       
Sbjct: 159 AKHDIPQKRELVRETKRNEEQELEEALKLSILEYEKSSAQ-------PTASNNGADASEE 211

Query: 69  XXXXXXXXTP-PPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQ 127
                    P PP   +  V AL+    +   +L    GD ++++E+   +W++G+  G+
Sbjct: 212 SKSERPSTNPGPPV--VRKVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGK 269

Query: 128 IGMFPANYVKPVTKDSF 144
           IG+FP NYV PVT  + 
Sbjct: 270 IGIFPLNYVTPVTDKTL 286

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDS 143
           +  V ALY     ++ +L    GD + +LE+   +W++G+ +G+IG+FP NYV P+T+ S
Sbjct: 214 IRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPITEPS 273

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F+ +Q GDL    GD V IL+K  +  +W+ G  NGQ G+FPANYV+ V
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVELV 428

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 78  PPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPS--AEWYKGTCNGQIGMFPANY 135
           P  A   E V ALY ++ Q EGDL   AG  ++I+++ +   EW+ G  NGQ G+FP NY
Sbjct: 428 PQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNY 487

Query: 136 VK 137
           VK
Sbjct: 488 VK 489

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F  +Q GDL    GD + IL+K  +  +W+ G  NGQ G+FPANYV+ V
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVELV 217

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%)

Query: 83  QLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
           Q++ V A+Y+    +  +L  V GD + ++E+   +W++GT  G++G+FP NYV P 
Sbjct: 227 QVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           ALY F  +Q+GDL    GDK+ IL++  +  +W+ G  NG+ G+FPANYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 36/57 (63%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDS 143
           V A+Y F   ++ +L    GD + ++E+   +W++GT  G +G+FP NYV PVT+ S
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPVTEPS 283

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%)

Query: 82  NQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVT 140
           N +  V ALY     +  +L  V GD + +LE+   +W++GT  G  G+FP NYV P++
Sbjct: 215 NIIRKVRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTPIS 273

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           ALY F  +Q GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F+ +Q GDL    GD + IL+K  +  +W+ G  NGQ G+FPANYV+ V
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVELV 399

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F+ +Q+GDL    GD + IL++  +  +W+ G  NGQ G+FPANYV  V
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYVDLV 416

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 77  TPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANY 135
           TPP +  +E   ALY +  Q EGDL   AG  +Q++++  A  W+ G  NG  G+FP NY
Sbjct: 363 TPPTSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNY 422

Query: 136 VK 137
           V+
Sbjct: 423 VE 424

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDSFA 145
           V A+Y     +  +L    GD + +LE+   +W+KGT  G IG+FP NYV P++  S A
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNA 298

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 78  PPPANQL-----EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGM 130
           PP A  +     E V ALY ++ Q  GDL   AG  ++I+E+ S   EW+ G  NGQ G+
Sbjct: 389 PPTAGSMAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGV 448

Query: 131 FPANYVK 137
           FP NYV+
Sbjct: 449 FPGNYVQ 455

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           ALY F  +Q GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           ALY F  +Q GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 77  TPPPANQ-LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANY 135
           TP PA   ++ V A+Y     +  +L    GD + ++E+   +W++G   G++G+FP NY
Sbjct: 222 TPAPAQTVIKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNY 281

Query: 136 VKPVTK 141
           V P+T+
Sbjct: 282 VTPITE 287

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVELV 454

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           ALY F  +Q GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           P+       ALY+F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 399 PSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

Query: 138 PV 139
            V
Sbjct: 459 LV 460

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 35/56 (62%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
           ++ V A+Y     + G+L    GD ++++E+   +W++G+  G +G+FP NYV P+
Sbjct: 242 VKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNPI 297

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           P++      ALY+F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 380 PSSTAPKAVALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

Query: 138 PV 139
            V
Sbjct: 440 LV 441

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 5/66 (7%)

Query: 77  TPP---PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGTCNGQIGMF 131
           TPP   PA+  E V ALY ++ Q EGDL   AG  ++++E+ +    W+ G  NG  G+F
Sbjct: 367 TPPTTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVF 426

Query: 132 PANYVK 137
           P NYV+
Sbjct: 427 PGNYVQ 432

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVELV 459

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           EY  +LY ++ Q +GDL   AG  +QI+++ +   +W+ G  NGQ G+FP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           P+       ALY+F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+
Sbjct: 398 PSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

Query: 138 PV 139
            V
Sbjct: 458 LV 459

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++ GDLR   GD + IL+K  +  +W+ G  N   G+FPANYV+ V
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVELV 449

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 6/66 (9%)

Query: 78  PPPANQL----EYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMF 131
           PP A  +    E V ALY ++ Q  GDL   AG  ++I+E+ P   EW+ G  NGQ G+F
Sbjct: 394 PPTAGSMTAGGETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVF 453

Query: 132 PANYVK 137
           P NYV+
Sbjct: 454 PGNYVQ 459

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 3/65 (4%)

Query: 77  TPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPAN 134
           +P  +N  + V ALY+F  ++ GDL    GD + IL+K  +  +W+ G  NG+ G+FPAN
Sbjct: 370 SPSSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPAN 428

Query: 135 YVKPV 139
           YV+ V
Sbjct: 429 YVELV 433

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++ GDL    GD + I++K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVELV 437

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
           V A+Y F   +  +L    GD + +LE+   +W++G+  G+IG+FP NYV P+
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPI 268

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++ GDL    GD + +L+K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVELV 464

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 5/62 (8%)

Query: 78  PPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANY 135
           PP AN    V ALY ++ Q  GDL   AG  ++++++     EW+ G  NGQ G+FP NY
Sbjct: 411 PPAANT---VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNY 467

Query: 136 VK 137
           V+
Sbjct: 468 VQ 469

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMFPANYVK 137
           E V ALY ++ Q  GDL   AG  ++I+++ P A EW+ G  NGQ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           AL++F  ++ GDL    GD V IL+K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVELV 455

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGTCNGQIGMFPANYVK 137
           +E V ALY ++ Q  GDL   AG  ++I+++ + E  W+ G  NGQ G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           AL+ F+ +Q GDL    GD V IL+K     +W+ G  N Q G+FPANYV+ V
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVELV 397

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F+ ++ GDL    GD + I++K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVELV 423

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDS 143
           V A+Y    ++  +L    GD + +LE+   +W++GT  G++G+FP NYV P+ + S
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTPIEEPS 284

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 77  TPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKP-SAEWYKGTCNGQIGMFPANY 135
           TP  A   E   +LYAF  Q + DL   A   ++IL++  S+ W+ G  NGQ G+FP NY
Sbjct: 356 TPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNY 415

Query: 136 VK 137
           V+
Sbjct: 416 VR 417

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDS 143
           V A+Y     +  +L    GD + +LE+   +W+KG   G++G+FP NYV P+ + S
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTPIAEPS 282

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTKDS 143
           V ALY     +  +L    GD + +LE+   +W+KG   G++G+FP NYV P+++ S
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTPISEPS 273

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           +E V ALY ++ Q  GDL   AG  ++I+++ +   EW+ G  NGQ G+FP NYV+
Sbjct: 458 VETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTK 141
           V+ALY     +  +L    GD + +LE+   +W++G+  G IG+FP NYV PV +
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPVAE 286

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%)

Query: 79  PPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKP 138
           P    +  V ALY     +  +L    GD + +LE+   +W+KG   G +G+FP NYV P
Sbjct: 214 PAQTVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

Query: 139 VT 140
           + 
Sbjct: 274 IV 275

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 81  ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           A Q E   +LY ++ Q  GDL   AG  ++I+E+ +   EW+ G  NGQ G+FP NYV+
Sbjct: 409 APQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVK 137
           P+       ALY F  ++ GDL    GD + IL+K  +  +W+ G  +G+ G+FPANYV+
Sbjct: 398 PSTSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

Query: 138 PV 139
            V
Sbjct: 458 LV 459

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGTCNGQIGMFPANYVK 137
           +E V ALY ++ Q EGDL    G  ++++E+ +    W+ G  NGQ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F  ++EGDL    GD + I+++  +  +W+ G  NG+ G+FPANYV+ +
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVEII 396

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMFPANYVK 137
           E V ALY ++ Q  GDL   AG  ++I+++ P   EW+ G  NGQ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 77  TPP---PANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSAE-WYKGTCNGQIGMF 131
           TPP   P +  E V ALY ++ Q EGDL   AG  ++++E+ P    W+ G  NG  G+F
Sbjct: 393 TPPTTAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQGVF 452

Query: 132 PANYVK 137
           P NYV+
Sbjct: 453 PGNYVQ 458

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++ GDL    GD + I++K  +  +W+ G  +G+ G+FPANYV+ V
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVELV 511

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMFPANYVK 137
           E V ALY ++ Q  GDL   AG  ++I+++ P   EW+ G  NGQ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%)

Query: 82  NQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPVTK 141
           N +  V AL+    ++  +L    GD + ++E+   +W++G   G++G+FP NYV PV +
Sbjct: 212 NTVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPVAE 271

Query: 142 DS 143
            +
Sbjct: 272 KT 273

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMFPANYVK 137
           +E V ALY ++ Q  GDL   AG  ++++++ P   EW+ G  NGQ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKP--SAEWYKGTCNGQIGMFPANYVK 137
           +E V ALY ++ Q  GDL   A   ++I+++   + EW+ G  +GQ+G+FP NYV+
Sbjct: 400 VETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY+F  ++  DL    GD + IL+K  +  +W+ G  NG+ G+FPANYV+ V
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVELV 424

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%)

Query: 77  TPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYV 136
           T P    +  V ALY     +  +L     D + +LE+   +W+KG   G++G+FP NYV
Sbjct: 215 TTPVQTIVRRVRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 274

Query: 137 KPVTKDS 143
            P+ + S
Sbjct: 275 TPIAEPS 281

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 83  QLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           + E V ALY F  +Q+GDL    GD + +++K  +  +W+ G    + G+FPANYV+ V
Sbjct: 365 KAEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVELV 423

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           ALY F  ++ GDL    GD + IL+K  +  +W+ G   G+ G+FPANYV+ V
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVELV 469

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
           V ALY        +L    GD + +LE+   +W+KG    Q G+FP NYV PV
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYV 136
           ALY F  Q +GDL       ++IL++  A  W+ G  NG+ G+FPANYV
Sbjct: 336 ALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 78  PPPANQ---LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP      +  +EA+YA+E Q + ++ +  GD + ++       W  G C+G  G+FP 
Sbjct: 570 PPPRRSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPT 629

Query: 134 NYVK 137
           +Y K
Sbjct: 630 SYCK 633

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYK--GTCNGQIGMFPANYVKPVTKDS 143
           + LYA+  Q + ++ +  GD++ ++ + +   W K      G+ G+ P  Y++  T D+
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDT 557

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 78  PPP--ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPAN 134
           PPP        VEA+Y+++ Q E +  L  GD + +L+      W  G  NG+ G+FP +
Sbjct: 559 PPPRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTS 618

Query: 135 YVK 137
           Y K
Sbjct: 619 YCK 621

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 78  PPP---ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP    N    V+AL+ +E Q + ++ +  GD + +L+      W  G  NGQ G+FP 
Sbjct: 559 PPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPT 618

Query: 134 NYVK 137
           NY +
Sbjct: 619 NYCQ 622

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYV 136
           V ALY F  QQ+GDL     D + + +K  +  +W+ G  +G  G+FPANYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 78  PPP---ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP   A  L+ V A+Y +  Q + ++ + AGD +++L   +   W  G  NG  G+FP+
Sbjct: 563 PPPRKGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPS 622

Query: 134 NYV 136
           NY 
Sbjct: 623 NYC 625

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 86  YVEALYAF-EPQQEGDLRLVAGDKVQILEKPSAEWYKG---TCNGQIGMFPANYVK 137
           Y +ALY+F EP +   L    GD + + EK + +WY G     NG+ G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%)

Query: 81  ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVKPV 139
            N ++ V A+Y  E     +L     D + ++E+   +W+ G+   ++G+FP NYV P+
Sbjct: 213 TNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTPI 271

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 78  PPPANQ---LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP      +  +EA+YA+E Q + ++ +  GD + ++       W  G C+G  G+FP 
Sbjct: 570 PPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPT 629

Query: 134 NYVK 137
           +Y K
Sbjct: 630 SYCK 633

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYK--GTCNGQIGMFPANYVK 137
           + LYA+  + + ++ +  GDK+ ++ + +   W K      G+ G+ P  Y++
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIR 551

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 5/67 (7%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC-----NGQIGMFPANYVKP 138
           ++ V A Y + P ++  LRL+ GD V +L K  + W+ G           G FP NY K 
Sbjct: 23  VDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSKS 82

Query: 139 VTKDSFA 145
           +    F+
Sbjct: 83  IRDRWFS 89

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 30/50 (60%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYV 136
           V+A++     +  +L    GD + ++E+   +W++G   G++G+FP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 78  PPP---ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPS--AEWYKGTCNGQIGMFP 132
           PPP    + +  +EALY ++ Q + +L + AG  V++L KP   + W  G  +G  G+FP
Sbjct: 562 PPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKGLFP 620

Query: 133 ANYVK 137
            +Y K
Sbjct: 621 TSYCK 625

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYVK 137
           +EA+YA+E Q + ++ +  GD++ ++       W  G C+G  G+FP +Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/53 (22%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCN---GQIGMFPANYVK 137
           + LYA+  Q + ++ +  GDK+ ++ + +   +    N   G+ G+ P  Y++
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIR 551

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 78  PPP---ANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP   A  +  +EA YA+E + + ++ +  GD + ++       W  G C+G  G+FP 
Sbjct: 571 PPPRRTALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPT 630

Query: 134 NYVK 137
           +Y K
Sbjct: 631 SYCK 634

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYK--GTCNGQIGMFPANYVK 137
           + LYA+  Q   ++ +  GDK+ ++ + S   W K      G+ G+ P  YV+
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 84  LEYVEALYAF-EPQQEGDLRLVAGDKVQILEKPSAEWYKGTC---NGQIGMFPANYVKPV 139
           ++YV+A+Y++ EP +   L   +GD + ++E  + +WY G     N Q G+ P NYVK +
Sbjct: 547 VKYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVKVI 606

>NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.365
           YLR191W
          Length = 445

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 10/71 (14%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK-----PSAEWYK-GTCNGQIGMFPAN 134
           N LE+  A Y F P+  E +L+L  GD + I+ K       +EW+K  T NG +G  P N
Sbjct: 368 NNLEFARAKYKFVPENPEMELQLSKGDLMAIISKQDPLGRDSEWWKVRTKNGDMGYVPYN 427

Query: 135 Y---VKPVTKD 142
           Y   +K V KD
Sbjct: 428 YLEIIKRVAKD 438

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 7/71 (9%)

Query: 78  PPPANQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKPS-----AEWYK-GTCNGQIGM 130
           P   ++LE+  ALY F P+  E ++ L  GD + IL K       ++W+K  T NG IG 
Sbjct: 302 PIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGY 361

Query: 131 FPANYVKPVTK 141
            P NY++ + +
Sbjct: 362 IPYNYIEIIKR 372

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSA--EWYKGTCNGQIGMFPANYVKPV 139
           AL+ F   + GDL    GD + I+++  +  +W+ G  N + G+FPANYV+ V
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVECV 581

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 7/71 (9%)

Query: 78  PPPANQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKP-----SAEWYK-GTCNGQIGM 130
           P   ++LE+  ALY F P+  + ++ L  GD + IL K      +++W+K  T NG+IG 
Sbjct: 319 PIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGY 378

Query: 131 FPANYVKPVTK 141
            P NY++ + +
Sbjct: 379 IPYNYIEIIKR 389

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKPS-----AEWYK-GTCNGQIGMFPAN 134
           ++LE+  ALY F P+  E ++ L  GD + IL K       ++W+K  T NG IG  P N
Sbjct: 308 SKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYN 367

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 368 YIEIIKR 374

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 83  QLEYVEALYAFEPQQEG-DLRLVAGDKVQILEKP-----SAEWYK-GTCNGQIGMFPANY 135
            LE+  AL+ F P+    +L L  GD + IL K      +++W+K  T NG  G  P+NY
Sbjct: 305 NLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNY 364

Query: 136 VKPVTKD 142
           ++ + ++
Sbjct: 365 IEIIPRN 371

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 78  PPPANQLE-------YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQI 128
           PPP   +E       +  A Y ++  +E +L  V  DK+  +E    +W+ G    NG+ 
Sbjct: 544 PPPRRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEK 603

Query: 129 GMFPANYV 136
           G+FP+NYV
Sbjct: 604 GLFPSNYV 611

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 86  YVEALYAF-EPQQEGDLRLVAGDKVQILEKPSAEWYKGTC---NGQIGMFPANYVK 137
           Y  A+Y+F EP     L    GD + + EK + +WY G     NG+ G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQ-----IGMFPANYVKPV 139
           V A+ A+EPQ   DL++  GDK+ +L      WY G    +      G+FP+++VK +
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVKVI 68

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQI---GMFPANYVKP 138
           L+ V A Y F P ++  LR  AGD + ++ K  + W+ G    N  +   G FP +Y K 
Sbjct: 23  LDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTKS 82

Query: 139 VTKDS 143
           +   S
Sbjct: 83  IKDTS 87

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 101 LRLVAGDKVQILEK-PSA-EWYKGTCNGQIGMFPANYVK 137
           L   AG  ++I+++ P A EW+ G  NGQ G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYVK 137
           V+ALY +E Q + ++ +  GD + +++      W  G  NG  G+FP++Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 80  PANQLEYV-EALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           P+N++  + +ALY +  Q  G+L    G+ V ++ +   EW++ +   +G+ GM P +Y 
Sbjct: 61  PSNEVPIILKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSYF 119

Query: 137 KPVTK 141
           +PV++
Sbjct: 120 EPVSR 124

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 83  QLEYVEALYAFEPQQEG-DLRLVAGDKVQILEKPSA-----EWYK-GTCNGQIGMFPANY 135
           +LE+  A+Y F P+    ++ L  GD + IL K  +     +W+K  T NG +G  P NY
Sbjct: 258 KLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNY 317

Query: 136 VKPVTK 141
           ++ + +
Sbjct: 318 IEVIIR 323

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYVK 137
           +  VEA+Y +E   + +L +  G+ ++++       W  G  NG  G+FP++Y K
Sbjct: 583 IRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKPS-----AEWYK-GTCNGQIGMFPAN 134
           ++LE+  ALY F P+  + ++ L  GD + IL K       ++W+K  T NG IG  P N
Sbjct: 312 SKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYN 371

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 372 YIEIIKR 378

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 38.1 bits (87), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY-----KGTCNGQIGMFPANYVKPVTK 141
           V A Y +E   +GDL    G +++++     +WY      G  N Q G+FP NYV+    
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVAQD 72

Query: 142 D 142
           D
Sbjct: 73  D 73

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK-----PSAEWYK-GTCNGQIGMFPAN 134
           ++LE+  ALY F P+  + ++ L  GD + I+ K       +EW+K  T +G IG  P N
Sbjct: 306 SKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPFN 365

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 366 YIEIIRR 372

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 78  PPPANQ---LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP         ++A Y +E Q + +L L   D V ++       W  G  NG+ G+FP 
Sbjct: 550 PPPRRTNMPTRTMQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPT 609

Query: 134 NYVK 137
           +Y +
Sbjct: 610 SYCR 613

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 18/78 (23%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG------TCNGQI--------- 128
           ++ V  ++ F P     L L +G  + ++EK S  W+ G      T +G           
Sbjct: 9   IDIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPKSGSTQK 68

Query: 129 ---GMFPANYVKPVTKDS 143
              G FPANY KP+ K S
Sbjct: 69  IIRGWFPANYTKPIPKTS 86

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           A Y +E  +E +L    GDK+  +E    +W+ G     G+ G+FP+NYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG-TCNGQI------GMFPANYV 136
           ++ V A   F P ++  LRL AGD V +L K  + W+ G T  G+       G FP N+ 
Sbjct: 24  VDVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFPHNFT 83

Query: 137 K 137
           +
Sbjct: 84  R 84

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT--CNGQIGMFPANY 135
           ++A+Y ++ Q  G+L  V GD   +L +   EWY  +   +G+ GM P +Y
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPKSY 120

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 7/54 (12%)

Query: 91  YAFEPQQEGDLRLVAGDKVQIL-EKPSAEWYKGTC----NGQIGMFPANYVKPV 139
           Y F  + + +L + +GDKV IL +K S++W+   C    +G+ G+ PA +V+PV
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWW--MCQLIDSGKSGLVPAQFVEPV 405

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 84  LEYVEALYAFEPQQEGD--LRLVAGDKVQILEKPSAEW--YKGTCNGQIGMFPANYVK 137
           L+ V A+Y +E  Q  D  L     D   +L+    +W   K T + + G  P NYV+
Sbjct: 71  LKKVRAIYDYEQVQNADEELTFHENDVFNVLDDKDPDWLLVKSTVSNEFGFIPGNYVE 128

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           A Y ++  ++ +L  V GDK+  +E    +W+ G     G+ G+FP+NYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 77  TPPPANQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKPS-----AEWYK-GTCNGQIG 129
           +P P N LE+  A+Y F P+  + ++ L  GD + I+ K       ++W+K  T  G IG
Sbjct: 317 SPDPKN-LEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKGDIG 375

Query: 130 MFPANYVKPVTK 141
             P NY++ + +
Sbjct: 376 YVPYNYIEVIKR 387

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK--PS---AEWYK-GTCNGQIGMFPAN 134
           N LE+  A+Y F P+    +  L  GD + I+ K  P+   ++W+K  T  G++G  P+N
Sbjct: 312 NNLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSN 371

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 372 YIELIRR 378

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 84  LEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK------PSAEWYKGTCNGQIGMFPANYV 136
           LE+  A+Y F P+  + +L L  GD + ++ K      PS  W   T  G IG  P NY+
Sbjct: 307 LEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNYL 366

Query: 137 KPVTK 141
           + + +
Sbjct: 367 ELIKR 371

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPS--AEWYKGTCNGQIGMFPANYVK 137
           ALY +E Q + ++ L  GD ++++ KP   + W  G  N +  +FP +Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYK--GTCNGQIGMFPANYVKPV 139
           + LYA+    + ++ +  GD + ++EK +   W K      G+IG+ P++Y++ V
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLETV 592

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYV 136
           A Y ++ Q   +L L  GDK+++L++     W  G  NG  G+FP  Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           A Y +E  ++ +L    GD++  +E    +W+ G     G+ G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KLLA0E19735g Chr5 complement(1756682..1757908) [1227 bp, 408 aa]
           {ON} similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEKP-----SAEWYK-GTCNGQIGMFPAN 134
           N LE+  A+Y F P+    +  L  GD + I+ K      ++EW+K  T  G IG  P N
Sbjct: 310 NNLEFARAIYDFVPENPRIECNLKKGDLMAIISKKDPLGNNSEWWKVRTKQGNIGYVPYN 369

Query: 135 YVKPVTK 141
           Y++ + K
Sbjct: 370 YLELIKK 376

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           A Y ++  +E +L  V  DK+  +E    +W+ G    NG+ G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           V+A+Y++  ++E DL  +  D +++  K    WY G    N + G FPANYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.365
           YLR191W
          Length = 314

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 78  PPPANQLEYVEALYAFEPQ--------QEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIG 129
           P    +L++  ALY F P+        ++GDL  +  +K     + S  W   T +G +G
Sbjct: 238 PVDLTKLKFARALYDFVPENAKIEVPLKKGDLMAIISEK-DTFGRDSQWWRVRTRDGNVG 296

Query: 130 MFPANYVKPVTK 141
             P NYV+ + +
Sbjct: 297 YIPYNYVEVIKR 308

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 86  YVEALYAF--EPQQEG---DLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           Y  ALY +  +P Q+G   DL    GD +++++K    W+ G      + G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYVK 137
           +  V A YA+  Q + +L L AGD V++++      W  G  +G  G+ P +Y K
Sbjct: 580 MRTVTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG---TCNGQI--GMFPANYVKPVTK 141
           A +A+E + E DL   AG K+ +      EWY G      G +  G+FP ++V  VTK
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFVTVVTK 69

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 7/54 (12%)

Query: 91  YAFEPQQEGDLRLVAGDKVQIL-EKPSAEWYKGTC----NGQIGMFPANYVKPV 139
           Y F  + + +L + +GDKV IL +K S +W+   C    +G+ G+ PA +++PV
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWW--MCQLIDSGKSGLVPAQFIEPV 410

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 84  LEYVEALYAFEPQQEGD--LRLVAGDKVQILEKPSAEW--YKGTCNGQIGMFPANYVKPV 139
           L+ V A+Y +   Q  D  L     D   + +   A+W   K T + + G  P NYV+P 
Sbjct: 71  LKKVRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 7/54 (12%)

Query: 91  YAFEPQQEGDLRLVAGDKVQIL-EKPSAEWYKGTC----NGQIGMFPANYVKPV 139
           Y F  + + +L + +GDKV IL +K S +W+   C    +G+ G+ PA +++PV
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWW--MCQLVDSGKSGLVPAQFIEPV 413

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 79  PPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           PP        A Y +E  +E +L     DK+  ++    +W+ G    NG+ G+FP+NYV
Sbjct: 496 PPKPAAPSATAEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 7/54 (12%)

Query: 91  YAFEPQQEGDLRLVAGDKVQILE-KPSAEWYKGTC----NGQIGMFPANYVKPV 139
           Y F  + + +L + +GDKV IL+ K S +W+   C    +G+ G+ PA +++PV
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWW--MCQLVDSGKSGLVPAQFIEPV 406

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 84  LEYVEALYAFEPQQEGD--LRLVAGDKVQILEKPSAEW--YKGTCNGQIGMFPANYVKP 138
           L+ V A+Y +E  Q  D  L     D   +L+    +W   K T + + G  P NYV+P
Sbjct: 71  LKKVRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 10/56 (17%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT------CNGQIGMFPANYV 136
           V A Y +  Q +GDL  + GD +++ +K + +W+ GT      C+   G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCS---GYFPKNFV 61

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 87  VEALYAFEPQQEGDLRLV--AGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVK 137
           V ALY +E  Q  +  LV    D  Q+ +   A+W+  K T N ++G  P NYV+
Sbjct: 74  VVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYVE 128

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 80  PANQLEYVEALYAFEPQQEGDLRLVAGDKVQIL-EKPSAEWY--KGTCNGQIGMFPANYV 136
           PA   +  +A+Y F      +L +  GD + IL ++ S +WY  +    G+ G+ PA +V
Sbjct: 408 PAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFV 467

Query: 137 K 137
           +
Sbjct: 468 E 468

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYV 136
           L  V A+Y +  +   ++ + AGD ++++   +   W  G   G  G+FP+NY 
Sbjct: 618 LRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           ALY F P+ + +L+LV GD + I  K    W   +   N +IG+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           ALY FEP+ + +LRL  GD V I  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT--CNGQIGMFPANY 135
           ++ALY ++ Q  G+L    GD   + ++   +WY+ +   +G+ GM P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           +  A Y ++  ++ +L  V  DK+  +E    +W+ G    +G  G+FP+NYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           +  A Y ++  ++ +L  V  DK+  +E    +W+ G    +G  G+FP+NYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 91  YAFEPQQEGDLRLVAGDKVQIL-EKPSAEWYKGTCNGQIGMFPANYVK 137
           Y ++ Q+E ++ +  GD V +L E   + W     +G  G+ P NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           A Y +E  ++ +L     DK+  +E    +W+ G    NG+ G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 101 LRLVAGDKVQILEKPSAEWYKG-TCNGQI---GMFPANYVKP 138
           LR   GDK+ +L K    W+ G   +G++   G FP ++VKP
Sbjct: 53  LRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 11/67 (16%)

Query: 84  LEYVEALYAF---EPQQEGDLRLVAGDKVQILEKP-----SAEWYK-GTCNGQIGMFPAN 134
           LE+  A+Y F    PQ E  LR   GD + ++ K      ++EW++  T  G +G  P+N
Sbjct: 310 LEFARAVYDFTPENPQVEAALR--KGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSN 367

Query: 135 YVKPVTK 141
           YV+ + +
Sbjct: 368 YVELIRR 374

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 78  PPPANQLEYVE--------ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT--CNGQ 127
           PPP  ++   E        A Y ++  ++ +L  V G K+  +E    +W+ G     G+
Sbjct: 456 PPPPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGE 515

Query: 128 IGMFPANYV 136
            G+FPANYV
Sbjct: 516 KGLFPANYV 524

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           +  A Y ++  ++ +L  V  DK+  +E    +W+ G    +G  G+FP+NYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQI---GMFPANYVKPV 139
           Y   LY FE  +E +L + AG+ + I      EW+ G   G+I   G+ P ++V  +
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFVNII 221

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK-----PSAEWYK-GTCNGQIGMFPAN 134
           N LE+  A+Y F P+    +  L  GD + I+ +       ++W+K  T  G +G  P N
Sbjct: 312 NSLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCN 371

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 372 YIELIRR 378

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 85  EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC-----NGQI--GMFPANYVK 137
           + V  +Y F P     L+L   + V +L KP+  W+ G         QI  G FP  +V 
Sbjct: 61  DIVRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFVH 120

Query: 138 PVTKDS 143
            +T  S
Sbjct: 121 SITFSS 126

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCN--GQIGMFPANYVKPVTK 141
           ++ALY +  Q  G+L    G+  Q+      EWY+ T    G+ GM P +Y + V+K
Sbjct: 67  LKALYTYHAQSPGELSFNKGELFQV-NGEDGEWYEVTSTEGGRKGMVPKSYFEQVSK 122

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           +  A Y ++  ++ +L  V  DK+  +E    +W+ G    +G  G+FP+NYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVKPVTKD 142
           A+YAF P+ + +L L  GD V I  K    W   +     + G+ P  YV+ +  D
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLIEDD 122

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 78  PPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPANYV 136
           PP    +  +E ++ +  Q + ++ +  GD V +++      W  G  NG  G+ P +Y 
Sbjct: 542 PPRRKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYC 601

Query: 137 K 137
           K
Sbjct: 602 K 602

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 86  YVEALYAFEP---QQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           Y  AL+ +EP    Q  DL     + +++++K    W+ G      + G FPANYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 10/69 (14%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY----------KGTCNGQIGMFPA 133
           L+ V A   F   ++  LRL  GD V +L K  + W+          +G      G FP 
Sbjct: 23  LDVVIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHRCVRGWFPQ 82

Query: 134 NYVKPVTKD 142
           N+ +P  +D
Sbjct: 83  NHTRPAPRD 91

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           ALY FEP+ + +L+L  GD V I  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           ALY FEP+ + +L+L  GD V I  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT---CNGQI--GMFPANYVK 137
           ++ V A++ +  + + +L L  GD + ++ K  + W+ G     NG++  G FP NY +
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCR 106

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSA-EWYKGTCNGQI---------GMFPANYV 136
           V+ALY +EPQ + +L +   D + +LEK    EW+  T   ++         G+ P+NYV
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWW--TVKKRVIGLDAEEPTGLVPSNYV 65

Query: 137 KPV 139
           +P 
Sbjct: 66  EPA 68

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGTC-NGQIGMFPANYVKPV 139
           V+ALY+++   + D   ++ D+ +IL+    E  W+K    NGQ G+ P+NYV+ +
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVELI 365

>Kpol_530.18 s530 (47170..48285) [1116 bp, 371 aa] {ON}
           (47170..48285) [1116 nt, 372 aa]
          Length = 371

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 7/66 (10%)

Query: 83  QLEYVEALYAFEPQQEG-DLRLVAGDKVQILEK--PS---AEWYK-GTCNGQIGMFPANY 135
           +L +  A++ F P+    ++ L  G+ + I+ K  PS   +EW+K  T +GQIG  P NY
Sbjct: 297 KLIFARAMFDFTPENPNVEVMLKKGELMAIISKKDPSGNDSEWWKVRTKSGQIGYVPGNY 356

Query: 136 VKPVTK 141
           ++ + +
Sbjct: 357 LEIIER 362

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 82  NQLEYVEALYAFEPQQ-EGDLRLVAGDKVQILEK--PS---AEWYK-GTCNGQIGMFPAN 134
           ++LE+  ALY F P+  + +  L  G+ + I+ K  PS   +EW+K  T  G +G  P N
Sbjct: 311 SKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPFN 370

Query: 135 YVKPVTK 141
           YV+ + +
Sbjct: 371 YVEIIKR 377

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT---CNGQIGMFPANYVK---PVT 140
            LY F+P++  +L   AGDK+ I    + EW+  +    +G+  + P ++V    P+T
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFVSIIDPIT 226

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC---NGQIGMFPANYV 136
           V+A Y +  Q +GDL  + GD + +  K + +WY G         G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 83  QLEYVEALYAFEPQ--------QEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPAN 134
           +LE+  ALY F P+        ++G+L L   D+  +    S  W   T NG  G  P N
Sbjct: 330 RLEFGRALYDFIPENPRIEATMKKGEL-LAILDRRDVFGNESEWWKVRTKNGSTGYVPYN 388

Query: 135 YVKPVTK 141
           Y++ + +
Sbjct: 389 YIEIIRR 395

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 4/63 (6%)

Query: 78  PPPANQL---EYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAE-WYKGTCNGQIGMFPA 133
           PPP         + A Y +  Q + ++ + AGD + ++       W  G  NG  G+FP 
Sbjct: 576 PPPRRSTLPTRTMTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPT 635

Query: 134 NYV 136
           +Y 
Sbjct: 636 SYC 638

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT--CNGQIGMFPANYVK 137
           A Y +E  ++ +L     DK+  +E    +W+ G    +G+ G+FP+NYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA-EWYK------GTCNGQ-IGMFPANY 135
           L   +A+Y++EPQ + +LR+   D + +LEK    +W+       GT   + +G+ P NY
Sbjct: 5   LGVYKAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNY 64

Query: 136 VK 137
           ++
Sbjct: 65  IE 66

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQI-GMFPANYVKPV 139
           V A Y +  Q +GDL  + GD +++  + + +W+ G    N +  G FP N+V P+
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIPL 67

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 87  VEALYAFEPQQEG--DLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVK 137
           V+ALY+++       +L    GD +++ +     W     NGQ G+ P+NYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 78  PPPANQLE--------YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG--TCNGQ 127
           PPP    E        +  A Y +E  ++ +L     DK+  +E    +W+ G    +G+
Sbjct: 522 PPPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGE 581

Query: 128 IGMFPANYV 136
            G+FP+NYV
Sbjct: 582 KGLFPSNYV 590

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQIL-EKPSAEWY--KGTCNGQIGMFPANYVK 137
           ALY FE +   +L +  GD V ++ +K S +W+  +   NG+ G+ PA +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 87  VEALYAFEPQQEGDLRLV--AGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVKPV 139
           V ++Y +E  Q  D  LV   GD+  + +   A+W   +   +G +G  P NYV+ V
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVEKV 130

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 32.7 bits (73), Expect = 0.84,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 10/59 (16%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG------TCNGQIGMFPANYVKPV 139
           V+A Y +  Q +GDL  + GD +++  K + +WY G       C+   G FP N+VK V
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCS---GYFPNNFVKIV 69

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 9/70 (12%)

Query: 84  LEYVEALYAFEPQQEGDLRLV--AGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVK-- 137
           + + +ALY ++  Q  D  L+   GD+  + +    +W       +G+IG  P NYV+  
Sbjct: 71  ISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEIS 130

Query: 138 ---PVTKDSF 144
              PV  +SF
Sbjct: 131 EATPVGSNSF 140

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 86  YVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYV 136
           +  A Y +E  ++ +L     DK+  +E    +W+ G     G+ G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKG-TCNGQIGMFPANYVKPVTKD 142
           + LY+++    GD   ++ D+ +IL+    E  W+K    NG+ G+ P+NYV+ +  D
Sbjct: 279 KTLYSYQAD-AGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQLIDND 335

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILE-KPSAEWYKGTC----NGQIGMFPANYVKPVTKD 142
           + +Y F  +   +L + AG  V IL+ K S +W+   C     G+ G+ PA +V+P+ + 
Sbjct: 379 KVVYDFIGESGDELTITAGQIVNILDDKKSKDWW--MCELPETGKKGVVPAQFVEPINQL 436

Query: 143 SF 144
           SF
Sbjct: 437 SF 438

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 87  VEALYAFE--PQQEGDLRLVA---GDKVQILEKPSAEWYKGTC----NGQI--GMFPANY 135
           V A Y F    +++G  +L++   GD + IL K S+ W+ G      +G++  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 136 VKPVTKDSF 144
            +P+    F
Sbjct: 126 GRPLRDSHF 134

>NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.365
           YLR191W
          Length = 379

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 11/71 (15%)

Query: 82  NQLEYVEALYAF---EPQQEGDLRLVAGDKVQILE------KPSAEWYKGTCNGQIGMFP 132
           N++E+  ALY F    PQ E +L+   G+ + I+       + S  W   T +G +G  P
Sbjct: 302 NKIEFARALYDFVPENPQIEAELK--KGELMAIISQRDPVGRESNWWKVRTKDGSMGYVP 359

Query: 133 ANYVKPVTKDS 143
            NY++ + + +
Sbjct: 360 YNYIEVIKRTT 370

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 83  QLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           QL    A Y  E ++  +L    GDK+  +     +W+ G     G+ G+FP+NYV+
Sbjct: 572 QLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVKPV 139
           ALY FEP+ + +L+L  G+ V I  K    W   +     + G+ P  +V  +
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYI 169

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           A Y +E  ++ +L    GD +  ++    +W+ G     GQ G+FP+NYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 84  LEYVEALYAFEPQQE-GDLRLVAGDKVQILEKPSAEWYKGTC--------NGQIGMFPAN 134
           +EY +A+Y     +  G      GD + I E  + +WYKG          N ++G+ P N
Sbjct: 595 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYN 654

Query: 135 YVK 137
           +++
Sbjct: 655 FIQ 657

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGT-CNGQIGMFPANYVK 137
           EALY ++  Q  D   ++ ++ +IL     E  W+K    NG+ G+ P+NYVK
Sbjct: 299 EALYTYQADQT-DAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAE---WYKGT--CNGQIGMFPANYVKPV 139
           A+  ++ + + +L ++ GDK+Q+L   S     WY G      + G++P N+ + +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQAI 81

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT--CNGQIGMFPANYV 136
           A Y ++  ++ +L     DK+  +E    +W+ G     G+ G+FP+NYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 84  LEYVEALYAFEPQQE-GDLRLVAGDKVQILEKPSAEWYKGTC--------NGQIGMFPAN 134
           +EY +A+Y     +  G      GD + I E  + +WYKG          N +IG+ P N
Sbjct: 601 IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYN 660

Query: 135 YVK 137
           +++
Sbjct: 661 FIQ 663

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKG---TCNGQI--GMFPANYV 136
           VEAL+ +    E DL    G  + +LE    EW+ G     +G+   G+FP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTC--NGQIGMFPANYVK 137
           A Y  E ++  +L    GDK+  +     +W+ G     G+ G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA-EWYK------GT-CNGQIGMFPANY 135
           L   +A+YA+EPQ   +L +   D + +LEK    +W+       GT  +   G+ P+NY
Sbjct: 5   LGIYKAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNY 64

Query: 136 VK 137
           V+
Sbjct: 65  VE 66

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDK--VQILEKPSAEW--YKGTCNGQIGMFPANYVKPV 139
           +  V+A+Y ++  Q  D  L+  +     + +    +W   K     Q+G  P NYV+P+
Sbjct: 71  ISQVKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEPI 130

Query: 140 T 140
           +
Sbjct: 131 S 131

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKG-TCNGQIGMFPANYVKPV 139
            ALYA+E   E D   ++  + +IL     E  W+K    NG+ G+ P+NYV+ +
Sbjct: 273 RALYAYEAD-ESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVELI 326

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 87  VEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGTCNGQIGMFPANYVK 137
           V+A + ++ + E DL       + +      EWY G    + G+FP ++VK
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 87  VEALYAFEPQQ--EGDLRLVAGDKVQILEKPSAEW--YKGTCNGQIGMFPANYVKPVT 140
           V+ALY +E  Q  E +L     D   + +    +W   K   + ++G  P NYV+PV+
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPVS 131

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA-EWY--KGTCNGQ-----IGMFPANY 135
           L   +A+Y +EPQ   +L L   D + +LEK    +W+  K    G      +G+ P+NY
Sbjct: 5   LGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNY 64

Query: 136 VK 137
           ++
Sbjct: 65  IE 66

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYVKPVTKDS 143
           ALY FEP+ + +L L  GD V I  +    W   +     + G+ P  +V    +D 
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYANEDD 189

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 81  ANQLEYVEALYAFEPQQEGDLRLV--AGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           A+ +  V+A+Y +   Q  D  LV    D   + +    +W   +     Q G  P NYV
Sbjct: 68  ADVISQVKAVYDYHEVQNPDEELVFNENDTFDVYDDKDPDWILARSISTNQFGFIPGNYV 127

Query: 137 KPVTKDS 143
           +P+  ++
Sbjct: 128 EPLNAET 134

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 30.0 bits (66), Expect = 6.9,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 93  FEPQQEGDLRLVAGDKVQILEKPSAE---WYKG---TCNGQIGMFPANYVKPV 139
           +  + E +L LV GD++++LE        WY G   +   Q+G+FP  + K V
Sbjct: 28  YAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTKVV 80

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 89  ALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY--KGTCNGQIGMFPANYV 136
           ALY FEP+ + +L L   D V I  K    W   +     Q G+ P  YV
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYV 160

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query: 88  EALYAFEPQQEGDLRLVAGDKVQILEKPSAE--WYKGT-CNGQIGMFPANYVKPV 139
           +ALY ++   E D   ++ ++ +IL+    E  W+K    NG+ G+ P+NYV+ +
Sbjct: 307 KALYPYDADDE-DAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLI 360

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 84  LEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSA-EWY--KGTCNGQ-----IGMFPANY 135
           L   +A+Y +EPQ   +L +   D + +LEK    EW+  K    G      +G+ P+NY
Sbjct: 5   LGVYKAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNY 64

Query: 136 VK 137
           ++
Sbjct: 65  IE 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,334,206
Number of extensions: 552501
Number of successful extensions: 2035
Number of sequences better than 10.0: 234
Number of HSP's gapped: 1955
Number of HSP's successfully gapped: 288
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)