Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G037203.498ON40940918170.0
KNAG0A079703.498ON3884036631e-82
Suva_16.4803.498ON4524395374e-63
Skud_16.4463.498ON4564055149e-60
TDEL0D056603.498ON4423915094e-59
YPR152C (URN1)3.498ON4654005071e-58
TPHA0A056903.498ON4784735062e-58
Smik_16.4043.498ON4604494887e-56
SAKL0F02552g3.498ON4784764652e-52
Kwal_47.188953.498ON4434504534e-51
KLTH0G02398g3.498ON4624624101e-44
ZYRO0D09768g3.498ON4602294013e-43
Kpol_480.113.498ON4632383952e-42
KLLA0E03939g3.498ON4354313713e-39
NCAS0F035803.498ON4134213545e-37
CAGL0L08404g3.498ON4104183334e-34
Ecym_12313.498ON3292303191e-32
AFR317C3.498ON3282253041e-30
NDAI0B059003.498ON5222592572e-23
TBLA0D029303.498ON2761471963e-16
KLLA0A06776g1.178ON80042722.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03720
         (409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   704   0.0  
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   259   1e-82
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   211   4e-63
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   202   9e-60
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   200   4e-59
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   199   1e-58
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   199   2e-58
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   192   7e-56
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   183   2e-52
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   179   4e-51
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   162   1e-44
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   159   3e-43
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   156   2e-42
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   147   3e-39
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   140   5e-37
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   132   4e-34
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   127   1e-32
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   121   1e-30
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   103   2e-23
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    80   3e-16
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    32   2.8  

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/409 (86%), Positives = 355/409 (86%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXXXXXXXAAKREEIEPVFVIRLMNDWKLVICNNGMK 60
           MNKIWKEYRAPNG                  AAKREEIEPVFVIRLMNDWKLVICNNGMK
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEAAKREEIEPVFVIRLMNDWKLVICNNGMK 60

Query: 61  YYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVEFLK 120
           YYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVEFLK
Sbjct: 61  YYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVEFLK 120

Query: 121 EDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXXXXXXXXXXXFLNNVAD 180
           EDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEG                 FLNNVAD
Sbjct: 121 EDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSSESEEEEEEEDDYEFLNNVAD 180

Query: 181 EGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGI 240
           EGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGI
Sbjct: 181 EGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGI 240

Query: 241 HSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYK 300
           HSTSD                   TKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYK
Sbjct: 241 HSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYK 300

Query: 301 IKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSDMNTLSEHIK 360
           IKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSDMNTLSEHIK
Sbjct: 301 IKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSDMNTLSEHIK 360

Query: 361 RNDTYAIETTLLQIECNFPQDVLSDVRYYILDLKQKTIELVKNSHVNEK 409
           RNDTYAIETTLLQIECNFPQDVLSDVRYYILDLKQKTIELVKNSHVNEK
Sbjct: 361 RNDTYAIETTLLQIECNFPQDVLSDVRYYILDLKQKTIELVKNSHVNEK 409

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  259 bits (663), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/403 (37%), Positives = 216/403 (53%), Gaps = 33/403 (8%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXXXXXXXAAKRE---EIEPVFVIRLMNDWKLVICNN 57
           M  +W+EYRAPNG                    K +    I+P +VI L+N W LVICNN
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60

Query: 58  GMKYYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVE 117
           G K+YL+ + +P   L D +S  L+ L D+EKL+ LIG+ARGY   + +K+Y +++EE+ 
Sbjct: 61  GAKFYLNPDGDPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDKVYNSVLEEIS 120

Query: 118 FLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXXXXXXXXXXXFLNN 177
           FLK+D+ N++  L +E E       L+E E    N+                        
Sbjct: 121 FLKDDLANDKAPLAEERE-------LQE-EPLETNVQSEPVPSALVSGYGSSSDGSDDEE 172

Query: 178 VADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSG 237
                   ++  +  LF  YGLDK+S WS+E  K+S DP F++++DD++RE++FE WC  
Sbjct: 173 EVPPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS 232

Query: 238 QGIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFK 297
             +  + D                   TK+HYLSQIV+KS +  TTIFQDIK++   LFK
Sbjct: 233 GVVDDSED-------EGYSSGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFK 285

Query: 298 EYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKN----ANYTSMSDMN 353
           +Y IK F+ S +EQE+FVS+LLFYYK F  +E+R + F  F+ E       + TS +D  
Sbjct: 286 QYGIKQFL-SKREQEQFVSQLLFYYKKF-TLEERVQLFTKFIAESRTGTVPSPTSPADSA 343

Query: 354 TLSEHIKRNDTYAIETTLLQIECNFPQDVLSDVRYYILDLKQK 396
           T  +         IET LLQ+E + P  VL +  YY LD+K K
Sbjct: 344 TPED---------IETNLLQMESHLPPTVLDNTVYYTLDIKTK 377

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  211 bits (537), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 147/439 (33%), Positives = 221/439 (50%), Gaps = 50/439 (11%)

Query: 2   NKIWKEYRAPNGXXXXXXXXXXXX---------XXXXXXAAKREEIE--PVFVIRLMNDW 50
           N++W+E++ P G                            AK  ++E  P+F + L++DW
Sbjct: 4   NEVWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDW 63

Query: 51  KLVICNNGMKYYLDNENEPTKELSDEESL----RLIELFDKEKLVCLIGIARGYAI--EN 104
            L+ICN+G K+Y + E+  +K   DEE       L+   DKEKL+ LIG+ARGY +  E+
Sbjct: 64  HLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREED 123

Query: 105 VEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXX 164
           VEKI+ ++ EE++  K   KN+   ++++A+    E    +AE P      G        
Sbjct: 124 VEKIFESLNEEIDLFK---KNQVVVVEEKADEPNEEA--GDAETPPQANSAGLVSGYGSS 178

Query: 165 XXXXXXXXXFLNNVA---------DEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKD 215
                      N+ A         D G   ++  F +L DRY LDKFS WS++  K+  D
Sbjct: 179 SEEEEEEEEPENDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIEND 238

Query: 216 PDFYLVTDDQEREDLFERWCSGQGIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVS 275
           PDFY V D   RE LFE WC+     ++ +                   TKFHYL+QIV+
Sbjct: 239 PDFYKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEP------TKFHYLAQIVA 292

Query: 276 KSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQF 335
           K+EI    I QDI++Q K LFK Y+IK+++ S ++Q++FVS+LLFYYKTF  +E R + F
Sbjct: 293 KAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTF-SLEQRKEIF 351

Query: 336 NDFLREKNANYTSM-----SDMNTLS--EHIKR---NDTYAIETTLLQIE--CNFPQDVL 383
            + LR+   ++         D+  +S  + I R    D  ++E  LL IE  C      L
Sbjct: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411

Query: 384 SDVRYYILDLKQKTIELVK 402
           +D RYY+L +  KT   V+
Sbjct: 412 ADPRYYVLGILDKTAGWVR 430

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  202 bits (514), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 214/405 (52%), Gaps = 49/405 (12%)

Query: 33  AKREEIEPVFVIRLMNDWKLVICNNGMKYYLDNE-----NEPTKELSDEESLRLIELFDK 87
           A R E +P F + L++ W LVICN+G K+Y +++     NE ++E SD +   L+E  DK
Sbjct: 41  ALRMERKPTFSLELIDAWHLVICNDGTKFYYNSDSKVFKNEISQE-SDSQCSALVESLDK 99

Query: 88  EKLVCLIGIARGYAI--ENVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREI--VL 143
           EKLV LIG+ARGY +  E+V+KI+ ++ EE+   K++ +NE  R+  EA  E  ++   L
Sbjct: 100 EKLVLLIGVARGYDMRDEDVDKIFESLNEEINLFKKN-QNEAGRVD-EANEEPGDVNPPL 157

Query: 144 KEAEKPRMNLVEGXXXXXXXXXXXXXX-----XXXFLN---------NVADEGLSGDKAK 189
           KE       L+ G                       LN         N  D G + ++  
Sbjct: 158 KEH---HTGLISGYGSSSEEEEEEEEEEEEDDGEQDLNKDATIIDDLNQIDTGDADERGL 214

Query: 190 FMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDXXXX 249
           F  LFDRY LDKFS WS++  K+  DPDFY + DD  RE  FE WC     H  SD    
Sbjct: 215 FFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCG----HEHSD-SAA 269

Query: 250 XXXXXXXXXXXXXXXTKFHYLSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESS 308
                          TK+HYL+QI++K+  I    + QDI++Q K L+K Y+IK+++ S 
Sbjct: 270 AEASGSEDVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSK 329

Query: 309 KEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYT-SMSDMNTLSEHIKR------ 361
           +EQ+KFVS+LLFYYKTF  +E R + F D LR+   ++  ++  +   S  I +      
Sbjct: 330 REQDKFVSQLLFYYKTF-SLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLE 388

Query: 362 --NDTYAIETTLLQIE--CNFPQDVLSDVRYYILDLKQKTIELVK 402
              D  ++E  LL IE  CN    V +D RYY++ +  KT+  V+
Sbjct: 389 APADGASVEEVLLNIEYRCNIV--VAADPRYYVVGILDKTMVWVR 431

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  200 bits (509), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 140/391 (35%), Positives = 205/391 (52%), Gaps = 28/391 (7%)

Query: 37  EIEPVFVIRLMNDWKLVICNNGMKYYLDNENE-PTKELSDEESLRLIELFDKEKLVCLIG 95
           E EP + I L+NDW LVI + G KYY D+  E  +  L D ES  L+   DK K++ L+ 
Sbjct: 47  EPEPFYAIPLVNDWFLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVA 106

Query: 96  IARGYAIENVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVE 155
           IARGY     +++Y  ++++++ L++    E+E  ++  +         E E+ R + + 
Sbjct: 107 IARGYNTNVGDRVYQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLI 166

Query: 156 GXXXXXXXXXXXXXXXXXFLNNVADEGL--------SGDKAKFMELFDRYGLDKFSEWSM 207
                              LNN+ D+ L        S  +  F +L  R+  D +S WS+
Sbjct: 167 AGYSSSEEEENEIDSDVEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSI 226

Query: 208 EMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTS------DXXXXXXXXXXXXXXXX 261
           +  K+ +DP FY +TDD  RE +FE WC  + I+ T+      D                
Sbjct: 227 QARKIQEDPLFYRITDDSIRESMFEEWCE-KAINRTTNPQDLVDEDNLDDDSREEEEEDE 285

Query: 262 XXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFY 321
                FHYL+ IVSK+ I  +TIFQDIK QNK  FK+YKIK F++S  +QE FVSKLLFY
Sbjct: 286 LEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFY 345

Query: 322 YKTFPQVEDRTKQFNDFLR------EKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE 375
           YK F  +++R + F+D L       +KN    S S  +TLSE    ND YAIET LL++E
Sbjct: 346 YKKF-TLDERKEIFHDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKME 404

Query: 376 --CNFPQD---VLSDVRYYILDLKQKTIELV 401
                 +D   + +D +YY+L +K K IEL+
Sbjct: 405 NLIGLARDMEELANDPKYYVLGIKDKMIELM 435

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  199 bits (507), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/400 (35%), Positives = 210/400 (52%), Gaps = 41/400 (10%)

Query: 37  EIEPVFVIRLMNDWKLVICNNGMKYYL-DNENEPTKELSDEESLR---LIELFDKEKLVC 92
           E +P F + L+N W L+I N+G K Y  D+  E   ++S E+  R   LIE  DKEKLV 
Sbjct: 48  ERKPTFSLELVNGWHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVL 107

Query: 93  LIGIARGYAI--ENVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPR 150
           LIG+ARGY +  E+++KI  +  EE+   K   +N+ E  +K+  SE    V    ++  
Sbjct: 108 LIGVARGYTMREEDIDKILESCNEEIHLFK---RNQDEVERKDEISEEAGDVKSPLQESH 164

Query: 151 MNLVEGXXXXXXXXXXXXXXXXXF----------------LNNVADEGLSGDKAKFMELF 194
             LV G                                  LN +  + +  ++  F ELF
Sbjct: 165 TGLVSGYGSSSGEEDEEEDEEEDEENEEQIVNQDISIIDDLNRIDTDDID-ERNIFFELF 223

Query: 195 DRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDXXXXXXXXX 254
           DRY LDKFS WS++  K+  DPDFY + DD  RE LFE WC  +  ++T++         
Sbjct: 224 DRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAE--ESDSEDN 281

Query: 255 XXXXXXXXXXTKFHYLSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEK 313
                     TK+HYL+QIV+ +  I   TI QDI++Q K L+K YKIK++I S ++Q+K
Sbjct: 282 SEDDSEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDK 341

Query: 314 FVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYT-SMSDMNTLSEHIKR--------NDT 364
           FVS+LLFYYKTF  +E R + F D LR+   ++T ++  +    E I R         D+
Sbjct: 342 FVSQLLFYYKTF-DLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADS 400

Query: 365 YAIETTLLQIE--CNFPQDVLSDVRYYILDLKQKTIELVK 402
            +IE  LL IE  C     V+++ RYY++ + +KT+  V+
Sbjct: 401 SSIEDILLSIEHRCCVSPIVVTEPRYYVVGILEKTVVWVR 440

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  199 bits (506), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 145/473 (30%), Positives = 221/473 (46%), Gaps = 76/473 (16%)

Query: 3   KIWKEYRAPNGXXXXXXXXXXXXX--------XXXXXAAKREEIEPVFVIRLMNDWKLVI 54
           ++WKE+ APNG                          +  +++  PVF   L NDW LVI
Sbjct: 4   RVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVI 63

Query: 55  CNNGMKYYLDN-ENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIV 113
            + G K+Y +  EN    EL DE + +L++  DK+KL+ L+G+ARG+  +   ++Y  I+
Sbjct: 64  SSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEIM 123

Query: 114 EEVEFLKEDMKNEQERLK---------------------------------KEAESEVRE 140
           E ++F+K ++ NE + L+                                  + E ++RE
Sbjct: 124 ENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIRE 183

Query: 141 IVLKEAEKPRMNLVEGXXXXXXXXXXXXXXXXXFLNNVADEGLSGDKAKFMELFDRYGLD 200
               E +    NL +                   LN+V     +  K K+ +LF++Y L+
Sbjct: 184 DKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQLN 243

Query: 201 KFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCS-------------------GQGIH 241
            FS WS +   V  DPDFYL+TD+  RED+FE WCS                     G H
Sbjct: 244 SFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSGAH 303

Query: 242 STSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKI 301
           S+++                   TK+HYLS I+SK+ I   TIFQDIK+ NK+LFK++KI
Sbjct: 304 SSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIKKDNKKLFKQFKI 363

Query: 302 KDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREK----NANYTSMSD--MNTL 355
             FI S ++ E F SKL+FYYK F Q + R   F   L +     N +    SD  + TL
Sbjct: 364 NKFITSKRDLESFSSKLIFYYKKFDQSQ-RRDIFEGILEQNKTAINKHVVEHSDKVLETL 422

Query: 356 SEHIKRNDTYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTIELVKN 403
           +  +  N+ +  ET LL++E         + + +D +YYIL +K K +E +KN
Sbjct: 423 NTSV--NEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK-LECLKN 472

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  192 bits (488), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 221/449 (49%), Gaps = 61/449 (13%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXXXXXXXAAKREEIE-----------PVFVIRLMND 49
           M+ +W+E++ P G                    K  ++E           P F + L++ 
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 50  WKLVICNNGMKYYLDNENEPTKELSDEESL----RLIELFDKEKLVCLIGIARGYAI--E 103
           W L+ICN+G K Y +++++  K    +ES      LIE  DK+KLV LIGIARGY++  E
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 104 NVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXX 163
           +++KI+ ++ EE++  K++    +  ++   E+ V + +L E+      L+ G       
Sbjct: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSES---HTGLISGYGSSSEE 177

Query: 164 XXXXXXXXXXF----------------LNNV-ADEGLSG-DKAKFMELFDRYGLDKFSEW 205
                                      LN++ AD+   G +++ F +L DRY LDKFS W
Sbjct: 178 EEEEEEEEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTW 237

Query: 206 SMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDXXXXXXXXXXXXXXXXXXXT 265
           S++  K+  DP+FY + DD  RE LFE WC     HS  +                   T
Sbjct: 238 SLQSKKIENDPEFYKIRDDTVREGLFEEWCEK---HSAKE-------SDSEDESNVLEPT 287

Query: 266 KFHYLSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKT 324
           K+HYL+QIV+K+  I    I QDI+++ K L+K Y+IK+++   +EQ++FVS+LLFYYKT
Sbjct: 288 KYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKT 347

Query: 325 FPQVEDRTKQFNDFL----REKNANYTSMSDMNTLSEHIKR-----NDTYAIETTLLQIE 375
           F  +E R   F D L    R+      S+   N L    +       D  +IE  LL IE
Sbjct: 348 F-NLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIE 406

Query: 376 --CNFPQDVLSDVRYYILDLKQKTIELVK 402
             C     V++D RYY++ + +KT+  V+
Sbjct: 407 NRCCVSAIVVADPRYYVVGILEKTVVWVR 435

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  183 bits (465), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 215/476 (45%), Gaps = 82/476 (17%)

Query: 1   MNKIWKEYRAPNGXX------XXXXXXXXXXXXXXXXAAKREEIE--PVFVIRLMNDWKL 52
           M   W E+  P+G                        + KR++++  P +++ L   W L
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQKLQHKPKYLVPLDKGWSL 60

Query: 53  VICNNGMKYYLDN-ENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGN 111
           V+CN G K+Y +   NE    L D  S+ L++  DKEKLV LIGI+RGY       +Y  
Sbjct: 61  VLCNTGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPR-RNVYDE 119

Query: 112 IVEEVEFLKEDMKNEQERLKKEAESEVREI-VLKEAEKPRMNLVEGXXXXXXXXXXXXXX 170
           I+ +++FLK+    +Q    + A ++  ++  L + E+  + LV G              
Sbjct: 120 IINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENIEE 179

Query: 171 XXXF----------------------------LNNVADEGLSGDKAKFMELFDRYGLDKF 202
                                           LNN+++      K +F  LFD+Y LD +
Sbjct: 180 EEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTILFDKYNLDPY 239

Query: 203 SEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDXXXXXXXXXXXXXXXXX 262
           S W  +  K++KDPDFYLVT+   R+DLFE+WC+ + I ++ D                 
Sbjct: 240 SMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCT-ETIANSKDAISDANINENDADQRQE 298

Query: 263 X--------------------------XTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLF 296
                                       T+FHYLS I+SKS I +TTIF DIK++NK LF
Sbjct: 299 SEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKALF 358

Query: 297 KEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFN-------DFLREKNANYTSM 349
           K ++IK  ++  K+QE F SKLLFYYK    +E R   F        D +R    N   +
Sbjct: 359 KTFRIKSSLK-KKDQEDFASKLLFYYKRM-DLEQRKLIFQKLLLSKLDIIRSNLRNVEKL 416

Query: 350 SDMNTLSEHIKRNDTYAIETTLLQIE-CNFPQDVLS----DVRYYILDLKQKTIEL 400
            D+ T  E     D+YAIET LL +E C      LS    +V YYIL +K KTI+L
Sbjct: 417 RDIAT--EQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQL 470

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  179 bits (453), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 214/450 (47%), Gaps = 65/450 (14%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXX----------XXXXXAAKREEIEPVFVIRLMNDW 50
           M + W+EY+ P+G                             +++ + +P+F + L NDW
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60

Query: 51  KLVICNNGMKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIY 109
            L+ICN G++++ ++E+  ++ +L DE SL L+   D+EKLV L+G+A+G+   +   +Y
Sbjct: 61  ALIICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFDPGD-RNVY 119

Query: 110 GNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXXXXXXX 169
             + + +  LKED  N   R K+ AE  +   V      P  +LV G             
Sbjct: 120 QELSDSISELKEDSNNRDFR-KETAEESIPTAV------PGQSLVSGYGSSDESDKDEDE 172

Query: 170 XXXXFLNNVADEGLS---------------------GDKAKFMELFDRYGLDKFSEWSME 208
                    + E +S                      + A+F+ LF +Y +D +S W+M+
Sbjct: 173 EEEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQ 232

Query: 209 MNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHST---SDXXXXXXXXXXXXXXXXXXXT 265
             K+  DP FY +T+D +R++LFE WC  +  + +   +                    +
Sbjct: 233 SRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPS 292

Query: 266 KFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTF 325
           ++HYL+ IVSKS+I  +T+ +DI+   K LFK+++IKD + S +EQ+ F+SKLLFYYK  
Sbjct: 293 RYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRM 351

Query: 326 PQVEDRTKQFNDFLR-------EKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE-C- 376
              E R   F  FL        +   N   +S +  LS      + YAIET LL +E C 
Sbjct: 352 -TPEQRIAIFKRFLEGKKKALKKGLKNQERLSTI--LSTPSLPQENYAIETQLLILEDCI 408

Query: 377 ------NFPQDVLSDVRYYILDLKQKTIEL 400
                  F Q+   DV+YY+L +K KT+ L
Sbjct: 409 DTHGSNAFLQE---DVQYYVLGIKDKTVAL 435

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  162 bits (410), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/462 (27%), Positives = 206/462 (44%), Gaps = 78/462 (16%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXXX--------XXXXAAKREEIEP--VFVIRLMNDW 50
           M + W+EY+ P+G                           +K   ++P   FV+ L NDW
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDW 65

Query: 51  KLVICNNGMKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIY 109
            L +C NG +++  +  E ++ ++ DEESLR++ L DK KLV L+  ARG+ I   + +Y
Sbjct: 66  VLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGERD-VY 124

Query: 110 GNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXXXXXXX 169
             ++E++  LK      Q R   E        V++ AE+P     E              
Sbjct: 125 QELLEDINNLK------QSRGVPEGSE-----VIEAAEEPSHTAGEPSNATEEPSQAVRT 173

Query: 170 XXXXF--------------------------------LNNVADEGLSGDKAKFMELFDRY 197
               +                                LN  + +     K  F  LFD Y
Sbjct: 174 LISAYESSDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEY 233

Query: 198 GLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQ---------GIHSTSDXXX 248
            LD +S W+M+  K+  +P FY V  D ER +LFE WC  +           H       
Sbjct: 234 DLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQA--VSS 291

Query: 249 XXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDFIESS 308
                           T++HYL+ IVSK+E+  +T+ +D++ + K+LFK++KIK+ +   
Sbjct: 292 DGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESL-GK 350

Query: 309 KEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKN----ANYTSMSDM-NTLSEHIKRND 363
           K+Q++F+SKLLFYYK   + E R +    FL+ +       + ++  + + LS+      
Sbjct: 351 KQQDEFLSKLLFYYKNMTE-EQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQDLPTS 409

Query: 364 TYAIETTLLQIE-C----NFPQDVLSDVRYYILDLKQKTIEL 400
            +AIE+ LL++E C       + +  +V+YY+L +KQKT  L
Sbjct: 410 GFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTAL 451

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  159 bits (401), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 127/229 (55%), Gaps = 13/229 (5%)

Query: 183 LSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHS 242
           +SGDK    +LF RY L+ +S W  EM K+  DPDF  V DD  RED+FE WC+   I  
Sbjct: 226 ISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCA-HAISG 284

Query: 243 TSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIK 302
                                 TK+HYL+ IVSKS I  TTIF DIK  NK  FK+Y IK
Sbjct: 285 DQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIK 344

Query: 303 DFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLRE--KNANYTSMSDMN----TLS 356
           DF+ S K+QE FVSKLLFYYK   ++E+R + F   L++  K       +DM+     L+
Sbjct: 345 DFLTSKKDQESFVSKLLFYYKRM-KLEERKEVFVQLLKQNGKTIEENLSNDMDKVRHCLA 403

Query: 357 EHIKRNDTYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTIEL 400
           + I  ND YA+ET L ++E          D++ + +YYIL ++ K +EL
Sbjct: 404 QEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKMLEL 452

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 71/150 (47%), Gaps = 20/150 (13%)

Query: 1   MNKIWKEYRAPNGXXXXXXXXXXXXXXXXXXAA------------KREEIEPVFVIRLMN 48
           M +IW+EY AP+G                  +             K+ E +P   + L +
Sbjct: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60

Query: 49  DWKLVICNNGMKYYLDNE-NEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEK 107
            W LVIC+ G K+Y + E NE    L DE S  LI+  DK KLV LIG+ARGY+   +  
Sbjct: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGGLH- 119

Query: 108 IYGNIVEEVEFLKEDMKNEQERLKKEAESE 137
           IY  +V ++      +K  QER  K AE +
Sbjct: 120 IYEELVTDL------VKLRQEREAKRAEGD 143

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  156 bits (395), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 137/238 (57%), Gaps = 13/238 (5%)

Query: 175 LNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERW 234
           L+++ D  L   K+ F  LF+ + LD +S W +++ K+   PD++ +TD+  RE+LFE W
Sbjct: 219 LDSLDDIDLEKSKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESW 278

Query: 235 CSGQ---GIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQ 291
           CS +   G  + ++                   TKFHYL+ I+SK++I   TIF DIK  
Sbjct: 279 CSSKFNGGKSNVTNFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKEN 338

Query: 292 NKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLRE-KNANYTSMS 350
           NK LFKE+KIKDFI+S K+QE F SKLLF+YK F Q+ +R   F   L+E +N    +++
Sbjct: 339 NKSLFKEFKIKDFIKSKKDQEAFSSKLLFFYKKF-QLNERKNLFLQLLKENENLIIPNIN 397

Query: 351 DMNTLSEHIKRND---TYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTIEL 400
               +  HI +ND    Y IET LLQIE      N   D+ +D +YYIL +K K I L
Sbjct: 398 SNIEIVRHIIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILL 455

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 11/137 (8%)

Query: 3   KIWKEYRAPNGXXXXXXXXXXXXXXXXXXAAKREE---------IEPVFVIRLMNDWKLV 53
           KIWKE+ AP+G                  +    E           P+FV  L+N W L+
Sbjct: 4   KIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAGAPLFVFPLLNGWHLI 63

Query: 54  ICNNGMKYYLDN--ENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGN 111
           IC  G KYY +    +  +KELSD+ SL+L+   DK+KL+ LI +ARGY   + EK+Y  
Sbjct: 64  ICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEKLYDE 123

Query: 112 IVEEVEFLKEDMKNEQE 128
           +++E E +  DM   Q+
Sbjct: 124 LLKEFELISNDMMQTQQ 140

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  147 bits (371), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 117/431 (27%), Positives = 201/431 (46%), Gaps = 44/431 (10%)

Query: 5   WKEYRAPNG------XXXXXXXXXXXXXXXXXXAAKREEIEPVFVIRLMNDWKLVICNNG 58
           WK ++ P+G                        A  +E   PVF + L N W LVIC +G
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICKDG 63

Query: 59  MKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVE 117
            K++ ++E+  ++ +L+D+ES  L++  D   L  LIG+ARG+ + N   +YG I + ++
Sbjct: 64  SKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRDVLQ 123

Query: 118 FLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXX----------------X 161
              +    EQ  + +E        V  E +    N++                       
Sbjct: 124 AKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSSSDDSGEESEVEEKNDP 183

Query: 162 XXXXXXXXXXXXFLNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLV 221
                        LNN   E      +KF++L +   LD +S WS++  ++  DP +YL+
Sbjct: 184 SSIDVKEEDTLPSLNNTEIE------SKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLI 237

Query: 222 TDDQEREDLFERWCSGQ----GIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKS 277
           T + +R++LF+ WCS Q       + ++                   TK+HYL+ I+SK+
Sbjct: 238 TSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIISKA 297

Query: 278 EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFND 337
            I   T+F +IK++NK LFKE +I   + + KEQE+F SK++ YYK    ++ RT+ F  
Sbjct: 298 NITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQ-RTELFKK 355

Query: 338 FLREKNANYTSMSD-MNTLSEHIKRNDTYAIETTLLQIEC------NFPQDVL-SDVRYY 389
            ++ K   +  +S+ ++ L      +D++ +ET LLQ+E       N     + +++ YY
Sbjct: 356 MMKNK-LRFPPISEKLSQLMLEETPSDSFKLETQLLQLENALLILDNLQNSYMQNEIMYY 414

Query: 390 ILDLKQKTIEL 400
           IL +K K   L
Sbjct: 415 ILGIKDKLAAL 425

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  140 bits (354), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 116/421 (27%), Positives = 196/421 (46%), Gaps = 51/421 (12%)

Query: 2   NKIWKEYRAPNGXXXXXXXXXXXXXXXXXXAAKREEIEPV------FVIRLMNDWKLVIC 55
            K+W+EY+APNG                    + E+ EP       F   L + W L+I 
Sbjct: 4   GKLWREYKAPNGRKYYYNVKTKETTWTK--PVEEEKPEPGDNKEVKFAFELFDGWYLLIR 61

Query: 56  NNGMKYYLDNENEP------TKELSDEESLRLIELFDKEKLVCLIGIARGYAIE--NVEK 107
            +G K + D+ NE       TK++  E + ++IEL DKEK++ LIG+ RG+  +  +++ 
Sbjct: 62  GDGGKLFYDSVNEKSYLETRTKKMG-ENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120

Query: 108 IYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGXXXXXXXXXXX 167
           +Y +I +++ FLK+++ N+   L++     +     +E  +    L +            
Sbjct: 121 VYDDIAQDINFLKQEILNDAMELER-----LNAEAEEEESEKEEALPQEEQDDHTVELLN 175

Query: 168 XXXXXXFLNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQER 227
                    +V D        +   LF+ + LD +S WS++  K+S   D++LV DD +R
Sbjct: 176 NLEEEEEEQDVKD--------RLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQR 227

Query: 228 EDLFERWCSGQGIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVS--KSEIRRTTIF 285
           E++FE WC+ +                          TK+HYLS+I+   + EI   T+ 
Sbjct: 228 EEMFEDWCAMK--------VAQLPEDESEAEDDDYEPTKYHYLSEIMYQLRDEINADTVA 279

Query: 286 QDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNAN 345
            DI R ++ LFK+Y IK FI   +E    VS+LLFYYK F   E R   F+D++ ++   
Sbjct: 280 DDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARE-RRAVFHDYVSQR--- 335

Query: 346 YTSMSDMNTLSEHIKRNDTYAIETTLL------QIECNFPQDVLSDVRYYILDLKQKTIE 399
           Y  +   +  ++         +ET +L      Q E N   D  + + YY++ L++K I 
Sbjct: 336 YGLLPGEDVDNDDAGSLSGEQMETRILQWERDRQTEGNSSWDPTA-LEYYVVGLREKYIG 394

Query: 400 L 400
           L
Sbjct: 395 L 395

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  132 bits (333), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 204/418 (48%), Gaps = 51/418 (12%)

Query: 2   NKIWKEYRAPNG-------XXXXXXXXXXXXXXXXXXAAKREEIEPVFVIRLMNDWKLVI 54
           +K+WKEY APNG                         A K  EI+P+    L+  W L+I
Sbjct: 6   SKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALII 65

Query: 55  CNNGMK-YYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIE-NVEKIYGNI 112
            ++G K YY  NE++ ++++S  E L+LI+L +K++L+ LIGI RGY    N + +   I
Sbjct: 66  FSDGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKDLVNEI 125

Query: 113 VEEVEFLKEDMKNEQERLKKEAESEVREI-----------VLKEAEKPRMNLVEGXXXXX 161
            E+++F++EDM   +     ++ S V  +              + E+P            
Sbjct: 126 REDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEP------AKRDEQ 179

Query: 162 XXXXXXXXXXXXFLNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLV 221
                        + ++  E     K  +  LF ++ L+K+S W +E  KVS+DP+FY +
Sbjct: 180 AVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKI 239

Query: 222 TDDQEREDLFERWCSGQGIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRR 281
            DD  RE++FE WC+   + S  +                   TK+HYLSQ+V+  +++ 
Sbjct: 240 IDDAVRENIFEEWCNAGSVESNEE--------SGDPGDDQFEPTKYHYLSQLVANYDLKP 291

Query: 282 TTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFL-R 340
            TI  +   ++K+L K+Y+IKD+   S EQ +F+SK+L +YK    +EDR + F  ++ R
Sbjct: 292 DTI-PEDIIKDKKLIKKYRIKDYTTKS-EQRQFLSKMLAWYKHM-SLEDRKQMFQTYIDR 348

Query: 341 EKNANYTSMSDMNTLSEHIKRNDTYAIETTLLQIE--CNFPQDVLSDVRYYILDLKQK 396
                YT   D+++ ++         +E+ LL++E     P    +D+ YY +DL+ K
Sbjct: 349 IPVGKYT---DIDSDAQE-------DVESQLLELENQLGIPTSE-NDLEYYCIDLRSK 395

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  127 bits (319), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 120/230 (52%), Gaps = 15/230 (6%)

Query: 182 GLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIH 241
           G   + A+F+ LFDRY L+ +S WS++  KV  DP+FY + DD+ R +LFE WC+ +   
Sbjct: 82  GYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAK 141

Query: 242 STSDXXXXXX------XXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRL 295
           +  D                          KFHYLS IVSKS I+  T+F D+K +NK L
Sbjct: 142 AGGDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLL 201

Query: 296 FKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSD--MN 353
           FK + I D     +EQ +FVS LLFYYK     ++R + F + L  K  +  +  D    
Sbjct: 202 FKNFNI-DETHPKQEQRQFVSSLLFYYKK-KSSKERVEIFKNLLDTKVKHEINNEDQLQQ 259

Query: 354 TLSEHIKRNDTYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTI 398
            L +    ND Y IE+ L+ +E      +  + +  D++YY++ ++ KTI
Sbjct: 260 ILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTI 309

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  121 bits (304), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 116/225 (51%), Gaps = 18/225 (8%)

Query: 185 GDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTS 244
           G KA+   LF+R  LD +S W  E  K+S D  FY V DD+ R++LFE+WC+       +
Sbjct: 95  GKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCA----RKIA 150

Query: 245 DXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYKIKDF 304
           D                   T+FHYL+ IVSKS +R  T++ D++R++K LF + ++   
Sbjct: 151 DEGNAVLEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD-- 208

Query: 305 IESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSM-----SDMNTLSEHI 359
           I   KEQ +FV+ LLFYYK       R + F   L    A  T+      + +  L E+ 
Sbjct: 209 ILDKKEQRRFVAGLLFYYKKMDAAL-RGEVFRKLLHAHRAAITAAFLENDAQLRELLEYD 267

Query: 360 K-RNDTYAIETTLLQIE-CNFPQDVL----SDVRYYILDLKQKTI 398
           +   D+Y+IET L  +E C      L    S+++YY+L +K K +
Sbjct: 268 ELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLV 312

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  103 bits (257), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 121/259 (46%), Gaps = 42/259 (16%)

Query: 187 KAKFMELFDRYGLDKFSEWSMEMNKVSKDPD-FYLVTDDQEREDLFERWCSGQGIHST-- 243
           K  F EL D+  LD +S WS++  ++ + P  FY +++D ERE++FE WC  + +HST  
Sbjct: 256 KQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNR-VHSTGL 314

Query: 244 -----------------SDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSK--SEIRRTTI 284
                            S                    TK+HYLS+++ K    I   +I
Sbjct: 315 YSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSI 374

Query: 285 FQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNA 344
           FQDIKRQ K LFK+Y+IKD+I   KE EK VS LLFYYK   + E R  +F +++ +   
Sbjct: 375 FQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQE-RCDKFQEYVTKHYG 433

Query: 345 NYTSMS--DMNTLSEHIKRNDTYA-----IETTLLQIEC--------NFPQDVLSD---V 386
               +   ++N + E     D  A     IE  +LQIE         + P     D   +
Sbjct: 434 EKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGL 493

Query: 387 RYYILDLKQKTIELVKNSH 405
            YYI+ L+ K   L    H
Sbjct: 494 EYYIIGLRAKHSALATLIH 512

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 23/148 (15%)

Query: 3   KIWKEYRAPNGXXXXXXXXXXXXX---------------XXXXXAAKREEIEPVFVIRLM 47
           +IWKEY+ PNG                                      EIE  F  +L+
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 48  NDWKLVICNNGMKYYLDNENEPT--KELSDEE----SLRLIELFDKEKLVCLIGIARGYA 101
           N+W L++ ++G K+Y +  +  +  K + D+E    S  L++  DK  L+ LIG+ RGY 
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYN 129

Query: 102 IENVE--KIYGNIVEEVEFLKEDMKNEQ 127
             +++   +Y  IV  + FLK+D+  EQ
Sbjct: 130 DPSIDIKGLYEEIVANIGFLKQDILTEQ 157

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 79/147 (53%), Gaps = 13/147 (8%)

Query: 177 NVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCS 236
           + +++ +   + +F EL DR  +D +S W +E  K+S DP FY +  D ERE LFE+WC 
Sbjct: 62  DASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCY 121

Query: 237 GQGIHSTSDXXXXXXXXXXXXXXXXXXXTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLF 296
           G+ +HS  +                     +H L++++   +I+  TI++DI++ NK++ 
Sbjct: 122 GK-LHSREE---------ETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMV 171

Query: 297 KEYKIKDFIESSKEQEKFVSKLLFYYK 323
           ++   K    S  EQEKF +KLL   K
Sbjct: 172 RQIDEKI---SKNEQEKFGTKLLGILK 195

>KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} similar
           to uniprot|Q757Y0 Ashbya gossypii AEL120W AEL120Wp and
           some similarites with YKL171W uniprot|P36003
           Saccharomyces cerevisiae YKL171W
          Length = 800

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 49  DWKLVICNNGMKYYLDNENEPTKELSDEESLRLIELFDKEKL 90
           DWKLV+C+ GM ++  +     K+  + ES++L  LFD   L
Sbjct: 565 DWKLVLCDFGMSHFYGH----FKDQMENESIQLKSLFDGSTL 602

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,744,048
Number of extensions: 1764654
Number of successful extensions: 9950
Number of sequences better than 10.0: 70
Number of HSP's gapped: 10216
Number of HSP's successfully gapped: 84
Length of query: 409
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 297
Effective length of database: 40,638,807
Effective search space: 12069725679
Effective search space used: 12069725679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)