Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G037103.496ON79794125e-54
TBLA0D029403.496ON71541555e-15
TPHA0D033003.496ON196581566e-14
ZYRO0D09812g3.496ON185551556e-14
TDEL0D056403.496ON124431501e-13
Kwal_55.212483.496ON222511533e-13
KLTH0F14938g3.496ON229461524e-13
CAGL0L08426g3.496ON140671467e-13
KNAG0A079603.496ON177691452e-12
Suva_16.4793.496ON212391462e-12
Smik_16.4033.496ON203391443e-12
Kpol_1017.43.496ON184501434e-12
YPR151C (SUE1)3.496ON206391444e-12
Ecym_12333.496ON87411375e-12
Skud_16.4453.496ON215391445e-12
NDAI0B058903.496ON278411342e-10
KLLA0E03983g3.496ON191521295e-10
AFR315C3.496ON77451211e-09
SAKL0F02618g3.496ON253371281e-09
NCAS0F035703.496ON230411227e-09
KLLA0D06061g8.682ON24940921e-04
YPL159C (PET20)8.682ON25328893e-04
TPHA0G015708.682ON25542884e-04
Smik_6.3568.682ON25328859e-04
Skud_16.1238.682ON25528850.001
Suva_16.1518.682ON25328850.001
ZYRO0F07480g8.682ON23646830.002
KAFR0H023808.682ON22034800.005
SAKL0H06380g8.682ON21928780.008
Kpol_1013.98.682ON26127770.012
TDEL0E007103.62ON47628750.022
TDEL0A062708.682ON24228750.023
KNAG0J017608.682ON25828750.028
KLLA0A07447g3.62ON48654750.029
TPHA0D012908.682ON21837740.036
Kwal_26.88288.682ON22332730.044
Ecym_23908.682ON22727730.048
TBLA0B038008.682ON32427720.060
Kpol_1072.128.682ON22227720.067
KLTH0D11396g8.682ON22528690.16
ZYRO0C02244g3.62ON46028690.16
Kpol_1066.443.62ON47938680.23
YNL295W3.62ON52477680.27
NCAS0C013108.682ON25733660.40
SAKL0C12342g3.62ON55228650.65
NCAS0A099403.62ON49428640.70
TBLA0B085103.62ON50158631.0
Skud_14.423.62ON52470621.3
Suva_14.443.62ON52576621.4
TBLA0B027208.798ON50240602.7
TPHA0N003107.33ON67336593.5
CAGL0I03410g7.343ON72438594.2
NDAI0K013208.682ON25830575.9
Kpol_1031.95.405ON71042578.3
TDEL0F037508.248ON118041568.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03710
         (79 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...   163   5e-54
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    64   5e-15
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    65   6e-14
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    64   6e-14
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    62   1e-13
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    64   3e-13
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    63   4e-13
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    61   7e-13
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    60   2e-12
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    61   2e-12
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    60   3e-12
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    60   4e-12
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    60   4e-12
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    57   5e-12
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    60   5e-12
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    56   2e-10
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    54   5e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    51   1e-09
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    54   1e-09
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    52   7e-09
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    40   1e-04
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    39   3e-04
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    39   4e-04
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    37   9e-04
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    37   0.001
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    37   0.001
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    37   0.002
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    35   0.005
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    35   0.008
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    34   0.012
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    33   0.022
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    33   0.023
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    33   0.028
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    33   0.029
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    33   0.036
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    33   0.044
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    33   0.048
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    32   0.060
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    32   0.067
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    31   0.16 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   0.16 
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    31   0.23 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    31   0.27 
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    30   0.40 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    30   0.65 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    29   0.70 
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    29   1.0  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    28   1.3  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    28   1.4  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    28   2.7  
TPHA0N00310 Chr14 complement(54950..56971) [2022 bp, 673 aa] {ON...    27   3.5  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...    27   4.2  
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    27   5.9  
Kpol_1031.9 s1031 complement(22263..24395) [2133 bp, 710 aa] {ON...    27   8.3  
TDEL0F03750 Chr6 complement(686701..690243) [3543 bp, 1180 aa] {...    26   8.9  

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score =  163 bits (412), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFT 60
          MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFT
Sbjct: 1  MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFT 60

Query: 61 DIQQRDWNFRIKNSKVQLK 79
          DIQQRDWNFRIKNSKVQLK
Sbjct: 61 DIQQRDWNFRIKNSKVQLK 79

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 64.3 bits (155), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 42/54 (77%), Gaps = 2/54 (3%)

Query: 1  MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGEL 54
          +R    + ++LPRVPTT+YL+ ++L  DI ++GYRPV+YP+KENPL   +NGEL
Sbjct: 9  VRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLF--RNGEL 60

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score = 64.7 bits (156), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 2/58 (3%)

Query: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFTDIQQ 64
           + KNLPRVPTT+YL+ +KL  DIL++GYRP+ YP+KENPL   +N    N  F   Q+
Sbjct: 50  IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLF--RNINKYNNDFLSTQE 105

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 185

 Score = 64.3 bits (155), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 43/55 (78%), Gaps = 2/55 (3%)

Query: 5  SILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYR--QNGELANE 57
          S + +++PRVPTT++L+  +L  DIL++GYRPV+YP+KENPL     +NGEL +E
Sbjct: 22 SDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDE 76

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa]
          {ON} Anc_3.496 YPR151C
          Length = 124

 Score = 62.4 bits (150), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%)

Query: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYR 49
          L + LPRVPTT++L+  +L  DIL++GYRPV+YP++ENPL  R
Sbjct: 30 LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGR 72

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa]
          {ON} YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 63.5 bits (153), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 42/51 (82%), Gaps = 1/51 (1%)

Query: 2  RGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNG 52
          R  S + ++LP+VPTT+YL+ ++L  DILY+GYRPV+YP+KENP L+++ G
Sbjct: 17 RRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP-LFKETG 66

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
          {ON} weakly similar to uniprot|Q06524 Saccharomyces
          cerevisiae YPR151C SUE1 Mitochondrial protein required
          for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 63.2 bits (152), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 2  RGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
          R  S + ++LP+VPTT+YL+ ++L  DILY+GYRPV+YP+KENPL 
Sbjct: 17 RKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 60.8 bits (146), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 11/67 (16%)

Query: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQN-------GELANEQF 59
          + + LP+VP T+YL+   L  D+LYNGYRP+LYPM+ENPLL   N       GE +NE  
Sbjct: 7  IFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGESSNE-- 64

Query: 60 TDIQQRD 66
            +Q++D
Sbjct: 65 --LQKKD 69

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa]
          {ON} Anc_3.496 YPR151C
          Length = 177

 Score = 60.5 bits (145), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 6/69 (8%)

Query: 4  GSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELA------NE 57
          G  + + LP+VP TKYL+  +L  DILY+GYRPV+YP++ENPL    N  +A      + 
Sbjct: 28 GRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDT 87

Query: 58 QFTDIQQRD 66
          + T+   RD
Sbjct: 88 EGTEGTHRD 96

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 60.8 bits (146), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 9   KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
           ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 63  RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa]
          {ON} YPR151C (REAL)
          Length = 203

 Score = 60.1 bits (144), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 9  KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
          ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 54 RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 92

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
          (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 59.7 bits (143), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%)

Query: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELAN 56
          + ++LPRVPTT++L+ + L  DIL++GYRP+ YP+KENP L+R  G   N
Sbjct: 35 IFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP-LFRNTGNTKN 83

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
          SUE1Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 206

 Score = 60.1 bits (144), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 9  KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
          ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 56 RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 94

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 57.4 bits (137), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 34/41 (82%)

Query: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
          + ++LPRVPTT+YL   +L+ DI ++GYRP++YP+K+NPL 
Sbjct: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF 49

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 60.1 bits (144), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 9   KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
           ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 63  RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 56.2 bits (134), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 33/41 (80%)

Query: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
           + + +P+VP TKYL+  +L  D+LY+GYRP++YP+KENPL 
Sbjct: 128 IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLF 168

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 191

 Score = 54.3 bits (129), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%)

Query: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQ 58
          + + LPRVPTT++L   +L  DIL++GYRP++ P+++NPL   +  EL  E+
Sbjct: 11 MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVER 62

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 51.2 bits (121), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 35/45 (77%)

Query: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELA 55
          LPRVP+T++L   K+++DIL++ +RP+ YP+ +NPL+ R+   L+
Sbjct: 10 LPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLS 54

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
          Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 253

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
          LP+VPTT++L+  +L  DIL++GYRPV YP+KENP  
Sbjct: 26 LPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFF 62

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 51.6 bits (122), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 32/41 (78%)

Query: 7   LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
           + + LP+VP T+YL+  +L  +IL+ GY+P++YP++ENPL 
Sbjct: 117 IFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLF 157

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 3/40 (7%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYP---MKENPLL 47
           LPRVPTT+++ + +   D+LY+GYRP++      KEN L+
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLM 151

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LPRVP+T +L +S +  ++LY+GYRP+ 
Sbjct: 103 LPRVPSTSHLKQSDMTTNVLYSGYRPLF 130

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 38.5 bits (88), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 6/42 (14%)

Query: 10  NLPRVPTTKYLDKSKLKIDILYNGYRPV------LYPMKENP 45
           +LP+ PTT +L  S+   D+ Y+GYRP+      L   +ENP
Sbjct: 105 SLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENP 146

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 37.4 bits (85), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (78%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LP+VP+T +L +S +  ++LY+GYRP+ 
Sbjct: 103 LPKVPSTSHLKQSDMTTNVLYSGYRPLF 130

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LPRVP+T +L  + +  ++LY+GYRP+ 
Sbjct: 103 LPRVPSTSHLKHTDMTTNVLYSGYRPLF 130

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 37.4 bits (85), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LPRVP+T +L  S +  ++LY+GYRP+ 
Sbjct: 103 LPRVPSTSHLKHSDMTTNVLYSGYRPIF 130

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 36.6 bits (83), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELAN 56
           LPRVP+T YL    +   ILY+GYRP+   +  + L   Q+G  AN
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLF--LNPDELKTSQDGGNAN 131

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (70%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKEN 44
           LPRVP+T  +D+ +L  ++L++ YRP+   +K +
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 34.7 bits (78), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LP+ P+T++L   ++  D+ Y+GYRP+ 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIF 110

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 34.3 bits (77), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPV 37
           LP+VP+T+ L+  +++   LY+GYRP+
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPI 138

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 33.5 bits (75), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LPRVP+T Y+  ++++ + L+ GYRP+ 
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF 102

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 33.5 bits (75), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LPRVP+T  L    + + +LY+GYRP+ 
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPLF 123

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 33.5 bits (75), Expect = 0.028,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 22/28 (78%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LP VP+T++++ + +  ++LY+GYRP+ 
Sbjct: 96  LPSVPSTQHIEANDMCTELLYSGYRPLF 123

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 33.5 bits (75), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFTDIQQ 64
           +P+VP+T YL +  L+ + L+ GY+P+   +  +PL    N  L +  F+ I++
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVLLDGLFSSIRK 141

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 33.1 bits (74), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47
           LP+VP T  +   ++  + LY+GYRP+    K+  LL
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL 131

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 32.7 bits (73), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRP-VLYPM 41
           LP+ P+T +L +  +   +LY+GYRP VL P 
Sbjct: 85  LPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPA 116

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 32.7 bits (73), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPV 37
            P  P T++L +  + +D+LY+GYRP+
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPL 115

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 32.3 bits (72), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPV 37
           LP+VPT K L +  +  ++LY+GYRP+
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPL 193

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 32.3 bits (72), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPV 37
           LP+VP+ K L    +  DI Y+G+RP+
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPL 123

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           LP+ P+T +L    +   +LY+GYRP +
Sbjct: 85  LPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 31.2 bits (69), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
          +PRVP T Y+   +++ + L+ GYRP+ 
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPLF 85

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 30.8 bits (68), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 3   GGSILCKNL--PRVPTTKYLDKSKLKIDILYNGYRPVL 38
           GGS   K+L  PRVP+T+ +   +++ D L+ GYRP+ 
Sbjct: 64  GGSNHKKSLILPRVPSTENIPVEEVQTDGLFAGYRPLF 101

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 30.8 bits (68), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 3   GGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVL-----YP--MKENPLLYRQNGELA 55
            GS L   +PRV +T Y+   ++  + L+ GYRP+      +P   ++    +  +  L 
Sbjct: 103 SGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFPSDARKGKNFHELDDVLP 162

Query: 56  NEQFTDIQQRDWNFRIK 72
           N Q  D  ++D    ++
Sbjct: 163 NIQVVDASEKDGKLNVQ 179

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 30.0 bits (66), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKE 43
           LP+V     L  +++  DILY+GYRP+    K+
Sbjct: 90  LPKVEPITNLRHNEISTDILYSGYRPLFLNFKD 122

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 29.6 bits (65), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 19/28 (67%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
           +P VP T Y+  S+++ + L+ GY+P+ 
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLF 188

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 29.3 bits (64), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVL 38
          +P+VPTT Y+   +++ + L+ GY+P+ 
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 28.9 bits (63), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQFTDIQQRDWN 68
           +PRV +T+ +   ++++D L+ GYRP+   + E+ +  R+     ++ F  ++    N
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLF--LGESSIKRRRKASPLDKFFHSVETHTRN 145

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 28.5 bits (62), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 4   GSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLY-------PMKENPLLYRQNGELAN 56
           GS L   +P+V +T+Y+   ++  + L+ GYRP+          M++    +  +  L N
Sbjct: 104 GSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPLFLGNSSFSSDMRKGKNFHALDDGLPN 163

Query: 57  EQFTDIQQRD 66
            Q  D  ++D
Sbjct: 164 IQVIDASEKD 173

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 28.5 bits (62), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 7/76 (9%)

Query: 4   GSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGE-------LAN 56
           GS L   +P+V +T ++ K ++  + L+ GYRP+       P   R+          L N
Sbjct: 105 GSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPN 164

Query: 57  EQFTDIQQRDWNFRIK 72
            Q  D  ++D    ++
Sbjct: 165 IQLVDASEKDGKLNVQ 180

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 27.7 bits (60), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 1   MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNG--YRPVL 38
           ++ G ++  +LP +P T YL+   L  DI+ +G  Y P+ 
Sbjct: 266 IKKGQMIYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>TPHA0N00310 Chr14 complement(54950..56971) [2022 bp, 673 aa] {ON}
           Anc_7.33 YOR356W
          Length = 673

 Score = 27.3 bits (59), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%)

Query: 13  RVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLY 48
           RVP T    KS  KI  L   Y+P+ YP  +  + +
Sbjct: 534 RVPWTFGFHKSDAKITKLAKDYKPIQYPQPDGKITF 569

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 27.3 bits (59), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 31  YNGYRPVLYPMKENPL-LYRQNGELANEQFTDIQQRDW 67
           Y+G R  ++ +K+  + +Y +NGE   E++ +IQ +D+
Sbjct: 389 YDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDF 426

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 26.6 bits (57), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 11  LPRVPTTKYLDKSKLKIDILYNGYRPVLYP 40
           LP++     L    + + +LY+GYRP+  P
Sbjct: 94  LPKITPPSNLRHQDISMKLLYSGYRPLFIP 123

>Kpol_1031.9 s1031 complement(22263..24395) [2133 bp, 710 aa] {ON}
           complement(22263..24395) [2133 nt, 711 aa]
          Length = 710

 Score = 26.6 bits (57), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 17  TKYLDKSKLKIDIL--YNGYRPVLYPMKENPLLYRQNGELAN 56
           +K +DK   K+ +L  Y  Y+  + PM+ + L ++QN  + N
Sbjct: 478 SKTMDKENFKVFLLDLYQRYKKTILPMRSHNLYFQQNTGILN 519

>TDEL0F03750 Chr6 complement(686701..690243) [3543 bp, 1180 aa] {ON}
           Anc_8.248 YDR104C
          Length = 1180

 Score = 26.2 bits (56), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 1   MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPM 41
           MR G  L KNL  +  T   +K  LK+  L  GYR + +P+
Sbjct: 592 MRFGGDLIKNLVDIEAT---EKDWLKVSSLNRGYRVLQHPL 629

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.139    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,392,340
Number of extensions: 376765
Number of successful extensions: 926
Number of sequences better than 10.0: 58
Number of HSP's gapped: 926
Number of HSP's successfully gapped: 58
Length of query: 79
Length of database: 53,481,399
Length adjustment: 51
Effective length of query: 28
Effective length of database: 47,633,433
Effective search space: 1333736124
Effective search space used: 1333736124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)