Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G037003.493ON1861476862e-92
Smik_16.4023.493ON1731474622e-58
YPR149W (NCE102)3.493ON1731474552e-57
CAGL0L08448g3.493ON1731444524e-57
Skud_16.4443.493ON1731474482e-56
KNAG0B008003.493ON1821424405e-55
CAGL0I10494g3.493ON1721484292e-53
KAFR0C019703.493ON1791424134e-51
KNAG0A079503.493ON1821443971e-48
TBLA0D029603.493ON1891393972e-48
NDAI0B058803.493ON1821433953e-48
NDAI0G009303.493ON1761473892e-47
Suva_16.4783.493ON1661473873e-47
NCAS0E008003.493ON1741473804e-46
KLLA0D16280g3.493ON1691473701e-44
TDEL0D056103.493ON1751473659e-44
SAKL0F02750g3.493ON1701453622e-43
Suva_7.4193.493ON1741433536e-42
TBLA0C044903.493ON1861433521e-41
YGR131W (FHN1)3.493ON1741383422e-40
Smik_6.2273.493ON1741383398e-40
Kpol_1017.63.493ON1871433391e-39
ZYRO0D09966g3.493ON1781273344e-39
NCAS0F035603.493ON1831233311e-38
TPHA0D032803.493ON1841433198e-37
KLTH0F14850g3.493ON1711473111e-35
Skud_7.4423.493ON1741433111e-35
Kwal_55.212383.493ON1701452934e-33
AFR312W3.493ON1681422396e-25
Ecym_12363.493ON1691232222e-22
TBLA0B006702.61ON282118700.86
KNAG0L023302.61ON30535663.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03700
         (186 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   268   2e-92
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   182   2e-58
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   179   2e-57
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   178   4e-57
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   177   2e-56
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   174   5e-55
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   169   2e-53
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   163   4e-51
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   157   1e-48
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   157   2e-48
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   156   3e-48
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   154   2e-47
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   153   3e-47
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   150   4e-46
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   147   1e-44
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   145   9e-44
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   144   2e-43
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   140   6e-42
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   140   1e-41
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   136   2e-40
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   135   8e-40
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   135   1e-39
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   133   4e-39
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   132   1e-38
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   127   8e-37
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   124   1e-35
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   124   1e-35
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   117   4e-33
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...    97   6e-25
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    90   2e-22
TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61...    32   0.86 
KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {O...    30   3.7  

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  268 bits (686), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 134/147 (91%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFFEQLAWPII             TAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQAAVAFFYFSMAIFLVKGVFSIMKAI
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  182 bits (462), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 91/147 (61%), Positives = 110/147 (74%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA+ADN LR++NF F+VI++A I+ LLNT+  H S+RVNYCMFA A+GI TDS+YG+FA
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKH-SSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF E LAWP++             TAGTVLAVGIRAH+CNN +Y +SNKI +GS TRCR 
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQAAVAF YFS AIFL K + SI   I
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMI 146

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  179 bits (455), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 109/147 (74%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA+ADN LR++NF F+VI++  I+ LLNT+  H S+RVNYCMFA A+GI TDS+YG+FA
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRH-SSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF E LAWP++             TAGTVLAVGIRAH+CNN +Y +SNKI +GS TRCR 
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQAAVAF YFS AIFL K + S+   I
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMI 146

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  178 bits (452), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 89/144 (61%), Positives = 108/144 (75%), Gaps = 1/144 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA+ DN LR+VNF FMVI +  I+ L+ TR  H S+RVNYCMFA A+GI TDS+YG+FA
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRH-SSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFFE LAWP+I             TAG VLAVGIRAH+CNN  YR +NKI++GSE RCR 
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIM 144
           +QAAVAFF+FSMAIFL K + S++
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLL 143

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  177 bits (448), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 107/147 (72%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA ADN LR++NF F+VI +  I+ LLNT Q  NS+RVN+CMFA A+GI TDS+YG+FA
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNT-QDRNSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFFE LAWP++             TAGTVLAVGIRAH+CNN +Y +SN I +GS TRCR 
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQAAVAF YFS AIFL K + S+   I
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMI 146

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  174 bits (440), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 85/142 (59%), Positives = 104/142 (73%), Gaps = 1/142 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML +ADN LRL+NFCF+VI +AFI+ L+NT++ H S RVNYCMFA A+GI TD +YGL A
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHIS-RVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF+E LAWP+I             TAG VLAVGIRAH+C N  YR  N I++GSE RCR+
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFS 142
           +QAA AFF+FSM IF+ K V S
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMS 141

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  169 bits (429), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 108/148 (72%), Gaps = 2/148 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML++ADN LR+VN  F++I +   + L+NTR+ H S+RVN+C+FA A+GI TDS+YG+FA
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRH-SSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAY-RNSNKIVRGSETRCR 119
           NFFE LAWP++             TAGTVLAVGIRAH+CNN+ Y     KIV+GS TRCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAI 147
            AQA VAFFYFSMAIFL K + SI+  +
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVV 147

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  163 bits (413), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 102/142 (71%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML +ADN LRL+N  F++I +A  + L+NT+ GH+++RVNYCMFA AFG+  DSIYG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFF+ LAWP++             +A T LAVGIRAH+C N++Y +SNKIVRGS  RCR 
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 121 AQAAVAFFYFSMAIFLVKGVFS 142
           AQA VAF YFS AIF+ K + S
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMS 142

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  157 bits (397), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/144 (61%), Positives = 107/144 (74%), Gaps = 1/144 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA+AD  LRLVNF F+VI M  I+ LLNT+ GH S+R+NYCMF  A+GI TDS YG+ A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF+E L+WP++             TAG VLAVGIRAH+C N AYRN NKIV+GSE RCR 
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIM 144
           AQAAVAFF+FSMAIFL K + S++
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLV 143

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  157 bits (397), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 93/139 (66%), Gaps = 1/139 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML + DN  R+ NFCF VIT   I  LLNT  GH+S+RVNYCMF  A+G+++DS YG+ A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NFF-EQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           N   E  A+P I             TAGTVLAVGIR H+C N+ YR  N I++GSE RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 VAQAAVAFFYFSMAIFLVK 138
            AQA +AFFYFSM +FLVK
Sbjct: 121 EAQACIAFFYFSMFLFLVK 139

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  156 bits (395), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 2/143 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+  DN LR++N  F+V+TMAFI+ LLNT Q +NS+R+N+CMFA AFG+LTDS +G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNT-QRNNSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NFFEQLA-WPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           N F+ LA WPI+             TAGTVLAV IRAH+C NE Y NSN I +GSE RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 120 VAQAAVAFFYFSMAIFLVKGVFS 142
           ++QAAVAFFYFS  IFL K + S
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMS 142

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  154 bits (389), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 101/147 (68%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML++ADN LRL+N  F+VI +   + LLNT+QGHNS R+NYCMF   + +LTDS +G+ A
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFFE L++P I              AGTVLA GIR+H+CNN++Y + NKI +GS  RCR 
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           +QA VAFFYFSM IFL+K   S +  I
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMI 146

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  153 bits (387), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 8/147 (5%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLA  DN LR++NF F+VI++  I+ LLNT+ G NS+R+NYCMFAVA+ I+TDS+YG+FA
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSG-NSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFFE LAWP+I             TA       IRAH+C N+ Y  SN I +GS  RCR 
Sbjct: 60  NFFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQAAVAF YFS AIFL K + S+   I
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMI 139

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  150 bits (380), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML +ADN LR++N  F+VI +   + LLNT+  HN++R+NYCMF  A+ + TDSIYG+FA
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKT-HNNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NFF+ LA P +              AGTVLA GIRAH+C +E Y NSNKI +G + RCR 
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           +QA VAFFYFSMAIFL K + S +  I
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMI 146

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  147 bits (370), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 96/147 (65%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLR VNF F++I +  +  L+ T Q H+S+RVN+ +FA  FGI+ DS+Y L A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIAT-QDHSSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF   LAWPII             +A T LAVGIR  +C N+++ + NKI  GS+ RCR 
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQA+  F YFS AIFLVK + SI+ AI
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAI 146

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  145 bits (365), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 102/147 (69%), Gaps = 1/147 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           MLAI DN+LRLVNF F+VI +  + +L+++  GH S+RVN+CMFA AFGI+TDS YG+ A
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           N +E  AWP+I             +A T LAVGIR H+C N+ Y +SN I +GS  RCR+
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQA+VAFFYFS  IFL K + S++  I
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGII 146

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  144 bits (362), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 90/145 (62%), Gaps = 1/145 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLRLVNF F+VI +     L+ T+  H S RVN+ +F  AF ++TDS Y +FA
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEH-SPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           N F   AWPI+             +A T LAVGIR H+C NE+Y  SN I +GS  RCR 
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMK 145
           AQA VAF YFS  IFL K V S++ 
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVIN 144

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  140 bits (353), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 99/143 (69%), Gaps = 1/143 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML++ADN +R++N  F++I++  ++ L++++  H S+RVN+CMFA A+G+LTDS YG  A
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKH-SSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           N +  L +P+I              AGT LAVGIR H+C+N+ Y ++NKI +GS +RC  
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSI 143
           A+AAV FFYFS  +FL+K V SI
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSI 142

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  140 bits (352), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 94/143 (65%), Gaps = 1/143 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+   N LR++NFCF+VI    I +L+ + +  +S RVNYCMFA  F ++TDS Y + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NFFE-QLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           NF+    AWPI+             TAGTVL+VGIR H+C N+ Y  SNKI +GS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 VAQAAVAFFYFSMAIFLVKGVFS 142
           +AQA++AF+YFS  I+LV+ V S
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKS 143

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  136 bits (342), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 92/138 (66%), Gaps = 1/138 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+ ADN +R++N  F++I++  I+ L+ T+  H S+RVN+CMFA  +G++TDS+YG  A
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKH-SSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF+  L +P I              A T LAVGIR H+C N+ Y   NKI++GS +RC  
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 AQAAVAFFYFSMAIFLVK 138
           +QAAVAFFYFS  +FL+K
Sbjct: 120 SQAAVAFFYFSCFLFLIK 137

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  135 bits (339), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (65%), Gaps = 1/138 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+ ADN +R++N  F++I++  I+ L++T+  H+S RVN+CMF  A+G++TDS+YG  A
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSS-RVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF+  L +P I              A T LAVGIR H+C N+ Y   NKI + S +RC  
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 121 AQAAVAFFYFSMAIFLVK 138
           +QAAVAFFYFS  +FL+K
Sbjct: 120 SQAAVAFFYFSCFLFLIK 137

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  135 bits (339), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/143 (53%), Positives = 95/143 (66%), Gaps = 2/143 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML++ADN +R +NFCF VI M  I  LL T +GH S+RVNYCMF   F ++TDS YG+ A
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NFFE-QLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           N +    AWPII             TAGTVL+VGIR H+C N  Y ++NKI++GS  RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 120 VAQAAVAFFYFSMAIFLVKGVFS 142
            AQA++AFFYFS  IF VK V S
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMS 142

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  133 bits (334), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 83/127 (65%), Gaps = 2/127 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNT-RQGHNSARVNYCMFAVAFGILTDSIYGLF 59
           MLA+ DN LR VNFCF VI +  + +L+ + + GHNS RVN+CMFA AFGI+ DS YG+ 
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGIL 59

Query: 60  ANFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           AN F   A+P+I             TA T LAVGIR H+C N  Y +SNKI +GS +RCR
Sbjct: 60  ANIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 120 VAQAAVA 126
            AQA VA
Sbjct: 120 EAQAVVA 126

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  132 bits (331), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 2/123 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+  DN+LR  N  F+V+ +AFI+ LL+T Q H S+RVNYCMFA AFG+LTDS +G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLST-QNHGSSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NFFEQLA-WPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           N  + L+ WPII             TAGTVLAVGIR H+CNN  Y  SNKI++GS  RCR
Sbjct: 60  NLIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119

Query: 120 VAQ 122
           V+Q
Sbjct: 120 VSQ 122

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  127 bits (319), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 91/143 (63%), Gaps = 2/143 (1%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML +ADN LR VNFCF VI +  +  LL T+  H S+RVNYC+F   F ++TD+ YG  A
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQH-SSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NFFE-QLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119
           N +   LAWPII             TAGTVLAVG R H+C N++Y +SN I +GS  RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 120 VAQAAVAFFYFSMAIFLVKGVFS 142
            AQAA AFFYFS  IFL K + S
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMS 142

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  124 bits (311), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 89/147 (60%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLR +NF F+VI +     L  T + HN+ +VN+ +F  AFG+L DS+Y + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF   LAWP++              A T LAV IR H+C N+ Y +SN + +GS  RCR 
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAI 147
           AQA+VAF YFS  IFL K   S++  I
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLI 147

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  124 bits (311), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (63%), Gaps = 1/143 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+ ADN +R+V+  F++I++  I  L+ T Q + S+RVN+CMFA A+G++TDS YG  A
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGT-QTNGSSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF+  L +P I              A T LAVGIR H+C N+ Y   N I +GS +RC  
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSI 143
           +QAAVAFFYFS  +FL+K   S+
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSV 142

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  117 bits (293), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 1/145 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLR  NF F++I +     L  TR  +N+ +VN+ +FA AFG+L D++Y + A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRD-NNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF   LAWP++              A T LAV IR H+C N  Y ++NK+ +GS  RCR 
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFSIMK 145
           AQA+VAF YF+  +FLVK   S++ 
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVN 144

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score = 96.7 bits (239), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 78/142 (54%), Gaps = 1/142 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLR VNF F++I +     L++ ++  +S RVN+ +F   F ++TDS Y + A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF    AWPII              A T L   I AH+C+N  + + N I   S  RCR 
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 AQAAVAFFYFSMAIFLVKGVFS 142
            QA+  F +FS  IFL K VFS
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFS 141

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 90.1 bits (222), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60
           ML+I DNSLR  NF F++I +A    L+N  Q  + +RVN+ +F   F +L DS+Y + A
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLING-QNRSHSRVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120
           NF   LAWPI+              A T L   I  H+C+N  +   N I  G E RCR 
Sbjct: 60  NFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 AQA 123
            QA
Sbjct: 120 VQA 122

>TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61
           YDL218W
          Length = 282

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 49/118 (41%), Gaps = 19/118 (16%)

Query: 9   LRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFG--------ILTDSIYGL-F 59
           LR   FC  V+ M+ +A  ++    H S R N+ +   A G        +L   + GL F
Sbjct: 13  LRFWEFCSSVLVMSLLAAAMSESHFHGSKRFNFSLAQGAIGTCYSLFVILLPPIVPGLVF 72

Query: 60  ANFFEQLAWPIIXXXXXXXXXXXXXTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETR 117
           A F+    W +I                 V+A  +  H+C+N+  +  N    GS+TR
Sbjct: 73  AGFY--FCWEVIMNLLWLCCFI-------VVAKVVGEHSCHNKFTKTYNPKY-GSQTR 120

>KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa]
          {ON} Anc_2.61 YDL218W
          Length = 305

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 9  LRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCM 43
          LR + FC  V+ M+ +A  LN+     S R N+C+
Sbjct: 39 LRFLQFCSAVLVMSLLAYSLNSYNFFGSKRANFCL 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,213,767
Number of extensions: 339433
Number of successful extensions: 1116
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1087
Number of HSP's successfully gapped: 34
Length of query: 186
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 83
Effective length of database: 41,670,801
Effective search space: 3458676483
Effective search space used: 3458676483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 62 (28.5 bits)