Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G036903.492ON36336318310.0
KNAG0A079403.492ON2752413023e-31
NDAI0G009403.492ON6562901932e-15
NCAS0E008103.492ON6923031826e-14
Kpol_480.143.492ON6991111684e-12
Smik_6.2263.492ON8391571641e-11
TPHA0D042503.492ON6291231632e-11
Skud_7.4413.492ON8071201604e-11
YGR130C3.492ON8161551595e-11
Suva_7.4183.492ON8311201579e-11
ZYRO0D09988g3.492ON994981427e-09
TBLA0C044803.492ON8021011382e-08
KLLA0D16236g3.492ON8711471312e-07
SAKL0F02772g3.492ON7731351204e-06
CAGL0I10516g3.492ON813911204e-06
Kwal_55.212293.492ON7871321151e-05
KLTH0F14828g3.492ON8361541151e-05
TDEL0D056003.492ON700941132e-05
KNAG0B008103.492ON757103970.002
Ecym_12373.492ON727124950.004
KAFR0C019603.492ON563107950.004
NCAS0F035503.492ON441181920.006
KNAG0C022901.154ON12335780.089
AFR310C3.492ON62348780.42
KLTH0G12144g8.331ON3582164731.9
NDAI0B058603.492ON681187721.9
TBLA0G035308.68ON123263722.2
TBLA0A073201.46ON32033712.2
TBLA0A075201.31ON615164712.6
KAFR0E006101.464ON1119171712.7
NDAI0B034102.309ON18758683.5
TPHA0C001504.385ON51097703.6
SAKL0H03300g4.238ON170780704.5
TDEL0B054001.467ON115243695.8
Ecym_33472.309ON18582666.4
KNAG0A031708.636ON47192678.1
SAKL0C00990g1.26ON86343678.6
YNL250W (RAD50)1.110ON1312102679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03690
         (363 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...   709   0.0  
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...   120   3e-31
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    79   2e-15
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    75   6e-14
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    69   4e-12
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    68   1e-11
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    67   2e-11
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    66   4e-11
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    66   5e-11
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    65   9e-11
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    59   7e-09
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    58   2e-08
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    55   2e-07
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    51   4e-06
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    51   4e-06
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    49   1e-05
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    49   1e-05
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    48   2e-05
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    42   0.002
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    41   0.004
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    41   0.004
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    40   0.006
KNAG0C02290 Chr3 (453135..453506) [372 bp, 123 aa] {ON} Anc_1.15...    35   0.089
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    35   0.42 
KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 a...    33   1.9  
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    32   1.9  
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    32   2.2  
TBLA0A07320 Chr1 (1820257..1821219) [963 bp, 320 aa] {ON} Anc_1....    32   2.2  
TBLA0A07520 Chr1 complement(1861006..1862853) [1848 bp, 615 aa] ...    32   2.6  
KAFR0E00610 Chr5 complement(134025..137384) [3360 bp, 1119 aa] {...    32   2.7  
NDAI0B03410 Chr2 complement(866982..867545) [564 bp, 187 aa] {ON...    31   3.5  
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    32   3.6  
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    32   4.5  
TDEL0B05400 Chr2 complement(957161..960619) [3459 bp, 1152 aa] {...    31   5.8  
Ecym_3347 Chr3 (659255..659812) [558 bp, 185 aa] {ON} similar to...    30   6.4  
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    30   8.1  
SAKL0C00990g Chr3 (89385..91976) [2592 bp, 863 aa] {ON} similar ...    30   8.6  
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    30   9.2  

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/363 (98%), Positives = 356/363 (98%)

Query: 1   MAVNYYADDRFIEVLKEQERAKNPHRNFLKDTIAHDAKYQSPFRRNINPNYLNYIREHKN 60
           MAVNYYADDRFIEVLKEQERAKNPHRNFLKDTIAHDAKYQSPFRRNINPNYLNYIREHKN
Sbjct: 1   MAVNYYADDRFIEVLKEQERAKNPHRNFLKDTIAHDAKYQSPFRRNINPNYLNYIREHKN 60

Query: 61  AKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKT 120
           AKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKT
Sbjct: 61  AKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKT 120

Query: 121 KENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKKE 180
           KENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKKE
Sbjct: 121 KENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKKE 180

Query: 181 LKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASK 240
           LKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASK
Sbjct: 181 LKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASK 240

Query: 241 INEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYG 300
           INEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYG
Sbjct: 241 INEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYG 300

Query: 301 EIEAIKNQRNQLEQNQPVAVKPKKVDEPINRRSKLYEIKTDDVEEGGNLSVKXXXXXXXF 360
           EIEAIKNQRNQLEQNQPVAVKPKKVDEPINRRSKLYEIKTDDVEEGGNLSVK       F
Sbjct: 301 EIEAIKNQRNQLEQNQPVAVKPKKVDEPINRRSKLYEIKTDDVEEGGNLSVKEEEEEEEF 360

Query: 361 VVV 363
           VVV
Sbjct: 361 VVV 363

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score =  120 bits (302), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 131/241 (54%), Gaps = 13/241 (5%)

Query: 65  ITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENN 124
           I+NP+S +N L    +GYK     +  +K A++I FP  L ENE  Q   L +L  KE +
Sbjct: 15  ISNPHSSYNTLKPEELGYK----QKFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQH 70

Query: 125 LKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKKELKNS 184
           L  LK SQ +VYID+         K  ++ +P++I  VPKIP   +++     + E +N 
Sbjct: 71  LDHLKKSQRVVYIDK------PVEKEDVVREPVDIQKVPKIP---YSEYGQCNEAEFRNP 121

Query: 185 LATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEY 244
           +ATP+  E+V++ +  +G    +SKE+FDNIQ +   H+  L     K +++ A+K+ EY
Sbjct: 122 VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181

Query: 245 DTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEA 304
           + Q++ L+ +I  E   +  L  K     D ++ + TK +L +  ++   K ++Y E E 
Sbjct: 182 NKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETER 241

Query: 305 I 305
           +
Sbjct: 242 L 242

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 141/290 (48%), Gaps = 27/290 (9%)

Query: 39  YQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDI 98
           Y SPFR N+  N   YI+  K  ++   +  S++       +G+K IP D+     AKDI
Sbjct: 68  YLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKN---FAKDI 124

Query: 99  DFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDD--------ISYEGDSKY 150
            FP  L +NE+ Q   L +L   E +L++ KDSQN++ + +          +    +++ 
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDDSANAEK 184

Query: 151 KIIEKPINIYSVPKIPSYVFTK-----------VPGNKKKELKNSLATPQNKEQVIVLRK 199
             +EKPI+    P +   + T            VP  ++KE +N  ATP +KE+ IV  K
Sbjct: 185 PPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKE-RNPKATPNSKEE-IVKTK 242

Query: 200 KDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIEN 259
           K G+L   SK ++D +QY+ + H   L    A+  E++  K+ EY+ ++ +L+ KI   N
Sbjct: 243 KFGIL---SKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASN 299

Query: 260 EKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQR 309
           E I +         D  + +  K    + +   + K +++ E + IK ++
Sbjct: 300 ELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREK 349

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 128/303 (42%), Gaps = 83/303 (27%)

Query: 22  KNPHRNFLKDTIAHDAKYQSPFR---RNINPNYLNYIREHKNAKYTITNPNSDFNKLNLN 78
           K P +          + Y SPFR    N+N      ++  K  ++   +  S++   N  
Sbjct: 56  KQPKKKIAASEAKAMSDYASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPK 109

Query: 79  TVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV--- 135
             G+ TI   +K +  AKDI FP  L ENE+ Q   L  L+ KE +LK+L+DSQN++   
Sbjct: 110 QKGFTTI---KKGQNFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLT 166

Query: 136 -----------------YIDE-----DDISYEGDSKYK---------------------- 151
                             IDE      +IS E +  Y+                      
Sbjct: 167 KKQEPKKAPTPVASTTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEI 226

Query: 152 ----IIEKPINIYSVPKIPSYVFTKVPGNK-KKELK------NSLATPQNKEQVIVLRKK 200
               ++E PI+    P +P  + T  P  K KKE +      N +A+P N+E+++    K
Sbjct: 227 HTPNVVEPPIDPALAPMVPFSLAT--PNQKSKKETEAPEKPSNPVASPTNQEEIV----K 280

Query: 201 DGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEY-------DTQVSNLNT 253
                Y SK V+D IQY+ + H   L     K +E++ +K+ EY       D Q+S LN 
Sbjct: 281 TAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELND 340

Query: 254 KID 256
            I+
Sbjct: 341 LIE 343

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 27  NFLKDTIA--HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKT 84
           + LK  ++  H+ +Y SPFR   N    NY +  K  ++   + +S F++++ N +GYK 
Sbjct: 24  SMLKKVVSRDHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKN 83

Query: 85  IPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV 135
           I    KS K AKDI FP  L  NE  Q   + +L+ KE NLK+L++SQ L+
Sbjct: 84  IS---KSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL 131

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 70/125 (56%), Gaps = 4/125 (3%)

Query: 182 KNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKI 241
           KN +++P+N E VI  ++      Y SK V+D +QY+  +H   L  L    +E++ +K 
Sbjct: 354 KNPMSSPENPEYVIKTKQHG----YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKK 409

Query: 242 NEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGE 301
            EY+  ++++ +KID  ++ + +L  K S   +  +++  KN L     +N++K +++ E
Sbjct: 410 TEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKE 469

Query: 302 IEAIK 306
            E +K
Sbjct: 470 TELMK 474

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 86/157 (54%), Gaps = 23/157 (14%)

Query: 3   VNYYADDRFIEVL---------KEQERAKNPHRNFLKDTIAHDAK----YQSPFRRNI-- 47
           +N   DD F +++         K+ ++ +NP++ FL+  ++++ K    + SPFR++   
Sbjct: 5   INRQNDDPFTQLINQSSENGQSKQAQQKENPYQ-FLQKVVSNEPKGKEEWISPFRQDALA 63

Query: 48  ---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSL 104
              N N L Y+ + KN K+   +  S ++K     +GYK IP   K+ K AKDI FP  L
Sbjct: 64  SKQNNNRL-YVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP---KNAKRAKDIRFPTYL 119

Query: 105 RENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDD 141
            +NEE Q   L EL+ KE +L++LK  Q +  + +D+
Sbjct: 120 TQNEERQYQLLTELELKEKHLQYLKKCQKITDLTKDE 156

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242
           N +ATP+ K ++IV  K+ G   Y SK V+D I Y+ K+H   L  L A+   ++ +K  
Sbjct: 420 NPVATPE-KPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNK 475

Query: 243 EYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEI 302
           EY+ ++ +L  +ID   + ++ +  + S   + S  +  K  +     +NN K  ++ + 
Sbjct: 476 EYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDT 535

Query: 303 EAIKNQR 309
           E +KNQ+
Sbjct: 536 ENMKNQK 542

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 6/123 (4%)

Query: 21  AKNPHRNFLKDTIA---HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNL 77
            + P + FL   I+    + +Y SPFR   +    NY +  K  K+  T+  S+FNK+  
Sbjct: 16  GQEPQQTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVP 75

Query: 78  NTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137
             +GY ++    K+ K AKDI FP+ L +NE+ Q   L EL+ KE+ L  L+ S  ++ +
Sbjct: 76  GEMGYSSLA---KNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132

Query: 138 DED 140
           DED
Sbjct: 133 DED 135

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242
           +++A+P+N E ++    +       SK V+D + YE K+H + LK  NA  DE++ +K  
Sbjct: 313 HAVASPENPEYLV----RTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQ 368

Query: 243 EYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEI 302
           EY+ ++  L  ++D   EK +  N K     +  +++  KN L   ++YN  K ++  E 
Sbjct: 369 EYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKET 428

Query: 303 EAIKNQR 309
           E +K Q+
Sbjct: 429 ELMKLQK 435

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 67/120 (55%), Gaps = 10/120 (8%)

Query: 28  FLKDTIAHDAK----YQSPFRRNI---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTV 80
           FL+  ++++ K    + SPFR++    N N   Y+ + KN K+   +  S ++K     +
Sbjct: 38  FLQKVVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDL 97

Query: 81  GYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDED 140
           GYK IP   K+ K AKDI FP  L +NEE Q   L EL+ KE +LK+LK+ Q +  +  D
Sbjct: 98  GYKNIP---KNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLTSD 154

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 23/174 (13%)

Query: 156 PINIYSVPKIP-----------SYVFTKVPGNKKKE------LKNSLATPQNKEQVIVLR 198
           PI+    PK+P            +   K P +   +        N +ATP+N E +IV  
Sbjct: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPE-LIVKT 402

Query: 199 KKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID-I 257
           K+ G   Y SK V+D I Y+ K+H   L  L AK   ++ +    Y  ++ +L  +ID I
Sbjct: 403 KEHG---YLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEI 459

Query: 258 ENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQRNQ 311
           EN  ++ +  + S   + S  +  K  +   T +NN K  ++ + E +KNQ+ Q
Sbjct: 460 EN-SMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQ 512

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 83/155 (53%), Gaps = 20/155 (12%)

Query: 3   VNYYADDRFIEVL---------KEQERAKNPHRNFLKDTIAHDAK----YQSPFRRNINP 49
           +N   DD F +++         ++  + ++P++ FL+  ++++ K    + SPFR++   
Sbjct: 5   INRQEDDPFTQLINQSSANTQNQQAHQQESPYQ-FLQKVVSNEPKGKEEWVSPFRQDALA 63

Query: 50  NYLN---YIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRE 106
           N  N   Y  + KN K+   +  S ++K     +GYK IP   K+ K AKDI FP  L +
Sbjct: 64  NRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP---KNAKRAKDIRFPTYLTQ 120

Query: 107 NEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDD 141
           NEE Q   L EL+ KE +LK+LK  Q +  + +D+
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKKCQKITDLTKDE 155

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 8/154 (5%)

Query: 159 IYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYE 218
           I+++ K P+   T+   +K     N +ATP+N E +IV  K+ G   Y SK V+D I Y+
Sbjct: 375 IFALWKSPTSSSTQ--KSKTAAPSNPVATPENPE-LIVKTKEHG---YLSKAVYDKINYD 428

Query: 219 NKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID-IENEKIRKLNSKISHFKDFSD 277
            KIH   L  L AK  +++ +K  EY  ++ +L  +ID IEN  ++ +  + S   + S 
Sbjct: 429 EKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIEN-SMKAMREETSEKIEVSK 487

Query: 278 FKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQRNQ 311
            +  K  +    E+NN K  +  + E +KNQ+ Q
Sbjct: 488 NRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQ 521

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 65/120 (54%), Gaps = 10/120 (8%)

Query: 28  FLKDTIAHDAK----YQSPFRRNI---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTV 80
           FL+  ++++ K    + SPFR++    N N   Y+ + KN K+   +  S ++K     +
Sbjct: 36  FLQKVVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDL 95

Query: 81  GYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDED 140
           GYK IP D K    AKDI FP  L +NEE Q   L EL+ KE +LK+LK  Q +  +  D
Sbjct: 96  GYKNIPKDVKR---AKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTGD 152

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242
           N +ATP+N E +IV  K+ G   Y SK V+D I Y+ KIH   L  L A+   ++ +K  
Sbjct: 411 NPVATPENPE-LIVKTKEHG---YLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466

Query: 243 EYDTQVSNLNTKID-IENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGE 301
           EY  ++ +L  +ID IEN  +++L  + S   + +  +  K  +   TE+NN K  ++ +
Sbjct: 467 EYKEKLQDLQNQIDEIEN-SMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKD 525

Query: 302 IEAIKNQR 309
            E +K Q+
Sbjct: 526 TENMKKQK 533

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 35  HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKI 94
           H  ++ SPFR   N       R  +   +   +PNS F+K++   +GY+T+   R SR+ 
Sbjct: 65  HLGEFASPFRLESNEKDAEKRRLQR---FPTVSPNSVFSKVHPKELGYRTM--GRGSRR- 118

Query: 95  AKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQ 132
           AKDI FP  LRENE  Q   L E++ +E  L ++K+SQ
Sbjct: 119 AKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQ 156

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 90/175 (51%), Gaps = 16/175 (9%)

Query: 148 SKYKIIEKPINIYSVPKIPSY--------VFTKVPGNKKKE---LKNSLATPQNKEQVIV 196
           S   +   P++  +VP++ ++        +F+ + G KKK      N LATP+N E ++V
Sbjct: 442 SDVSVTSPPVDYAAVPRVVTFPEVEKKRSIFS-IFGRKKKSQNRAPNPLATPENPE-ILV 499

Query: 197 LRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID 256
              ++G L   SK V+D ++YEN  H + L +  +   +R+  K  +YD ++  L  +++
Sbjct: 500 KTDREGFL---SKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVE 556

Query: 257 IENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQRNQ 311
              E ++++    +   +    + +K +L    +Y   K  ++ E +AI++Q+++
Sbjct: 557 KLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDK 611

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 38  KYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKD 97
           +Y+SPFR    P+ +N   + KN +Y   +  S ++ +    +GYK I     S K AKD
Sbjct: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNI---HPSTKRAKD 111

Query: 98  IDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYID 138
           I FP  L ENE  Q     +L  KE+ L +L+ SQ L+ ++
Sbjct: 112 IPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVE 152

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 75/147 (51%), Gaps = 20/147 (13%)

Query: 167 SYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKL 226
           +   T VPG+        +ATP++ E  +++R ++G   Y SK V+D +QY+   H  KL
Sbjct: 432 AAAGTVVPGDDA-----PVATPEDPE--LIVRTQEG---YVSKSVYDKLQYDEDQHQAKL 481

Query: 227 KKLNAKGDERHASKINEYDTQVSNLNTKI---DIENEKIRKLNSKISHFK--DFSDFKST 281
              + + DER+ +K  EY+ ++ ++  +I   D + E++R     + H +       + +
Sbjct: 482 ALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVR-----LEHEEKLKLKQVEKS 536

Query: 282 KNYLFKMTEYNNTKTRLYGEIEAIKNQ 308
           +  L    ++ N K  LY + E IKNQ
Sbjct: 537 QALLETNVKHINAKGDLYKQTEEIKNQ 563

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 16/135 (11%)

Query: 9   DRFIEVLKEQERAKNPHRNFLKDTIAHDAK------YQSPFRRNINPNYLNYIREHKNAK 62
           D F  +L+ ++  + P  NFL+  + +  K      Y SPFR       L   +  K  K
Sbjct: 11  DPFAHLLQPEQPQEQP--NFLRKVVTNKKKEEEEKDYSSPFRSQ---QELIAAKNVKAKK 65

Query: 63  YTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKE 122
           +   +  S     +   +GYK I +   +++ AKDI  PR L+  +E Q   L++L+ KE
Sbjct: 66  FPTVSATS--GTASAADLGYKVIDS---AKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE 120

Query: 123 NNLKFLKDSQNLVYI 137
           N+L++LKDSQ +V +
Sbjct: 121 NHLQYLKDSQKIVDV 135

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 106/211 (50%), Gaps = 35/211 (16%)

Query: 153 IEKPINIYSVPKIP----SYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFS 208
           + +PI+    P++P    + VF     + K++    LATPQ+ E ++  R   G   Y S
Sbjct: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQD--QPLATPQDPEYIV--RTDKG---YMS 369

Query: 209 KEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID-----IEN---- 259
           K ++D ++Y+ ++H ++L   N +  +++ +   EY+ +++ L ++ID     +E     
Sbjct: 370 KAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLD 429

Query: 260 --EKIRKLNSKISHFKDFSDFKST----KNYLFKMTEYNNTKTRLYGEIEAIKNQRNQLE 313
             EKI+   S++S  K   D  +T    KN +FK TE  N KT+   E + I  +  +++
Sbjct: 430 TKEKIKVSESELS--KKMLDLNATHISSKNVIFKETE--NIKTQKIAERDEITAKHEEVK 485

Query: 314 QN-QPVAVKPKKVDEPINRRSKLYEIKTDDV 343
              + + V  K+VD   N     Y+ K DD+
Sbjct: 486 AEIEELNVLKKQVDAEFNE----YQAKLDDL 512

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (52%), Gaps = 5/91 (5%)

Query: 47  INP--NYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSL 104
           +NP  N   Y +  K  K+   +  S     +   +G+KT+    KS K AKDI FP  L
Sbjct: 105 VNPFTNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTL---DKSTKRAKDIKFPVYL 161

Query: 105 RENEEAQTNFLNELKTKENNLKFLKDSQNLV 135
            ENE  Q   L EL+ KE  L++LKDSQ ++
Sbjct: 162 TENEFRQQTILKELELKEGKLQYLKDSQKII 192

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 70/153 (45%), Gaps = 14/153 (9%)

Query: 159 IYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYE 218
           I  VP IP       P          +ATP+N E +I   ++ G   Y SK ++D + Y+
Sbjct: 403 ITDVPVIPDQSQLDFP----------IATPENPE-LIAKTEEYG---YMSKPIYDKVVYD 448

Query: 219 NKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDF 278
              H   LK        ++  K+ EY+ ++  L  +ID+ NE +  L  + +   + S+ 
Sbjct: 449 ETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSEN 508

Query: 279 KSTKNYLFKMTEYNNTKTRLYGEIEAIKNQRNQ 311
              K    + T +N  K +++ E E IKNQ+ Q
Sbjct: 509 NLVKKIFERNTLHNEQKNKIFKETENIKNQKIQ 541

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 65/132 (49%), Gaps = 11/132 (8%)

Query: 9   DRFIEVLKEQERAKNPHRNFLKDTIA---HDAKYQSPFRRNINPNYLNYIREHKNAKYTI 65
           D F  + ++ +  K   + FL+  +     DA Y SPFR +      + +   K      
Sbjct: 7   DPFEHLFQQDQPKKETSKGFLRKVVTKEQEDATYSSPFRTS-----QSQVEAQKRKVQRF 61

Query: 66  TNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNL 125
              ++     +   +G+K I     +RK AKDI  PR L+ N+E Q   L++L+ KE++L
Sbjct: 62  PTVSASSGGNSSAEMGFKVIDA---ARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSL 118

Query: 126 KFLKDSQNLVYI 137
           ++ KDSQ +V +
Sbjct: 119 QYKKDSQKIVKV 130

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/151 (19%), Positives = 71/151 (47%), Gaps = 5/151 (3%)

Query: 153 IEKPINIYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVF 212
           ++KP NI   P++P          +  +    +A+P + E ++   K      Y SK ++
Sbjct: 317 LQKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKFDKG-----YMSKALY 371

Query: 213 DNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHF 272
           D ++YE  +H  ++ +   +  +++ +K  EY+  +++L ++I      + +L    +  
Sbjct: 372 DTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDK 431

Query: 273 KDFSDFKSTKNYLFKMTEYNNTKTRLYGEIE 303
            + S  + +   +    +++NTK  ++ E E
Sbjct: 432 INISAAELSARMIESNAKHSNTKNVIFKETE 462

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 79/154 (51%), Gaps = 22/154 (14%)

Query: 152 IIEKPINIYSVPKIP--SYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSK 209
           + EKP +I   P++P  + +F     + K+     +A+P + E ++   K      Y SK
Sbjct: 344 VPEKPKDIKETPRVPFATGIFALWTRSDKR--GQPVASPNDPEFIVKFDKG-----YMSK 396

Query: 210 EVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKI-DIE---------- 258
            ++D ++YE  IH  ++     + D ++ +K NEY+ ++++L ++I ++E          
Sbjct: 397 ALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDT 456

Query: 259 NEKIRKLNSKIS-HFKDF-SDFKSTKNYLFKMTE 290
            EKI    +K+S    D  ++  S+KN +FK TE
Sbjct: 457 TEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETE 490

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 62/115 (53%), Gaps = 11/115 (9%)

Query: 26  RNFLKDTIAHD---AKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGY 82
           + FL   ++ +   + Y SPFR +     L   ++ K  K+   +  +  +  + + +GY
Sbjct: 25  KGFLHKVVSKEQEQSAYNSPFRTS---QSLAAAQKRKMQKFPTVS--ASVSAHSSSDMGY 79

Query: 83  KTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137
           K I     +R+ AKDI  PR L+ N+E Q   L++L+ KE+ LK+ KDSQ +V +
Sbjct: 80  KVIDA---ARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 39  YQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDI 98
           Y SPFR   +   +   +  +  ++  T+  S +       +GYK I    K    AKDI
Sbjct: 40  YVSPFR---DEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKR---AKDI 93

Query: 99  DFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQ 132
            FP  L E E+ Q   L EL+ KE +L++LKD Q
Sbjct: 94  SFPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 85/160 (53%), Gaps = 19/160 (11%)

Query: 157 INIYSVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQ 216
           + + ++P  P     K+  +    + N  ATP+N E V+  + KDG   Y +K ++D I 
Sbjct: 314 VPMVALPAAPRAFLDKIFKSPPAPVPNPPATPENPEHVV--KTKDG---YLTKVIYDKIT 368

Query: 217 YENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFS 276
            +++ H++ + K   K DE+      ++D + +  N KI+    +I+++ ++++  +  +
Sbjct: 369 LQDRQHNEWIAKY--KKDEQQ-----KFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDT 421

Query: 277 DFK--STKNYL----FKMTEYN-NTKTRLYGEIEAIKNQR 309
           D K   ++N L    F+MT+ +   K +++ + E IK+Q+
Sbjct: 422 DAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQK 461

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 34  AHDAKYQSPFRRN-INPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSR 92
           A   +Y SPFR   +       ++  +  K+   +  S +N  N   +G+  +  D++  
Sbjct: 43  AATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRR- 101

Query: 93  KIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV 135
             A+DI FP  L ENE+ Q   L +L+ +E  L  L+  Q+++
Sbjct: 102 --ARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 5/124 (4%)

Query: 186 ATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYD 245
           ATP++ E +++  K      Y SK ++D ++YE ++H +KL  L+     ++      Y+
Sbjct: 323 ATPEDPEFIVLTEKG-----YMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYE 377

Query: 246 TQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAI 305
            ++++LN +I   +  + +L S+  +     +   ++N +    +++  K  L  E E  
Sbjct: 378 EKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENE 437

Query: 306 KNQR 309
           KN +
Sbjct: 438 KNAK 441

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 33  IAHDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGY-KTIPTDRKS 91
           +    +Y SPFR +        IR+                 L   T G+  T+      
Sbjct: 51  VEGGGEYVSPFRDDKAVAEAERIRD-----------------LKFPTTGHHSTVRVKDNV 93

Query: 92  RKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137
           ++ A+DI  PRS    +  Q   L+EL  KEN L++L++SQ +V +
Sbjct: 94  KRKAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 38  KYQSPFRRNI-NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRK-IA 95
           KY SPFR N  +      +++ K AK+ + +  S +N         K +  D   +K  A
Sbjct: 50  KYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN------TDTKDVYKDLDPKKNFA 103

Query: 96  KDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDI 142
           +DI FP  L +NE  Q   L +LK K++ L  LKDS  L  ID +D+
Sbjct: 104 RDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDS--LQVIDVEDL 148

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 79/181 (43%), Gaps = 26/181 (14%)

Query: 86  PTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYE 145
           P+ RK      +I  P  L+  EE Q N L  L+ KE NL+ LK+SQ ++          
Sbjct: 84  PSLRKYESRNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII---------- 133

Query: 146 GDSKYKIIEKPINIYSVPKIPSYVFTK--VPGNKKKEL---------KNSLATPQNKEQV 194
             S  +   +  NIY  PK+  Y  +K   P  ++++          K  +ATPQN E +
Sbjct: 134 TSSTARTYPQQQNIY--PKV-YYEHSKKRTPPTEQEQFHRGMNPPSPKYPIATPQNPEIL 190

Query: 195 IVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTK 254
           + L +    +   SKE +D +      H   LK  NA+    +  +   Y  Q+  L+ K
Sbjct: 191 VQLTENQNKI--VSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEK 248

Query: 255 I 255
           I
Sbjct: 249 I 249

>KNAG0C02290 Chr3 (453135..453506) [372 bp, 123 aa] {ON} Anc_1.154
           YJL184W
          Length = 123

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 153 IEKPINIYSVPKIPSYVFTKVPGNKKKELKNSLAT 187
           +++P  +Y  P IPS  FT VPGN + E  + + T
Sbjct: 1   MDRPYAVYESPDIPSKKFTVVPGNPRYETTDGVTT 35

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 90  KSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137
           ++R+   DID P+ L   +E Q   L EL+ KE  L+  K+SQ +V +
Sbjct: 87  EARRRVPDIDEPKRLSTVDERQRQQLQELELKEGQLRLYKESQKIVDV 134

>KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 aa]
            {ON} weakly similar to uniprot|Q00402 Saccharomyces
            cerevisiae YDR150W NUM1 Protein required for nuclear
            migration localizes to the mother cell cortex and the bud
            tip may mediate interactions of dynein and cytoplasmic
            microtubules with the cell cortex
          Length = 3582

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 70/164 (42%), Gaps = 19/164 (11%)

Query: 56   REHKNAKYTITNPNSDFNKLNLNTVGYKTIP-TDRKSRK-----IAKDIDFP-RSLRENE 108
            ++H+  K T+  P++ F +     +G+  +P TD +S K     + K ++ P  S  E +
Sbjct: 1106 KDHETLKKTVETPDASFLEEKAGELGFVLVPKTDHESMKKDNAAMKKAVETPDASYLEEK 1165

Query: 109  EAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYEGD--------SKYKIIEKPINIY 160
              Q +F+   K     LK   ++ ++ +++E     + D        +  KI+E P   +
Sbjct: 1166 AGQLDFILVPKKDHETLKKTVETPDVSFLEEKAGQLDFDLVPKKDHATMKKIVEMPDASF 1225

Query: 161  SVPKIPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLL 204
               K     F  VP    + LK ++ TP        L  K GLL
Sbjct: 1226 LEKKAGELDFVLVPKKDHETLKKAVETPDAS----YLAAKAGLL 1265

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 83/187 (44%), Gaps = 38/187 (20%)

Query: 101 PRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIY 160
           P  L EN+  Q   L ++ T+E N   LK+ Q ++   E +      +  KI  K   IY
Sbjct: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQDLTPTMQKI--KDSKIY 347

Query: 161 SVPKI--PSYVFTKVPGNKKKELK-------------NSLATPQNKEQVIVLRKKDGLLY 205
             PK+   ++  TK P N  ++L              N +AT  N E +I L     ++ 
Sbjct: 348 --PKVYYKNFNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILIKLNDDKTII- 404

Query: 206 YFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNL-NTKIDIENEKIRK 264
             +K+ +           DKL +LN    + HA+ +   + + SNL NTK     EK+ K
Sbjct: 405 --TKQTY-----------DKLLELN----QDHANWMINNNGESSNLYNTKFKTYQEKLNK 447

Query: 265 LNSKISH 271
           LN +I+H
Sbjct: 448 LNEQINH 454

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 246 TQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAI 305
           ++++ L   +++  E I K+N K + FK++SD+ + +N L K   +        G++E I
Sbjct: 95  SEITELMRIVNLSGETIYKINGKTTSFKNYSDWLAKENILIKAKNF----LVFQGDVETI 150

Query: 306 KNQ 308
            +Q
Sbjct: 151 ASQ 153

>TBLA0A07320 Chr1 (1820257..1821219) [963 bp, 320 aa] {ON} Anc_1.46
           YCL029C
          Length = 320

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 241 INEYDTQVSNLNTKIDIENEKIRKLNSKISHFK 273
           I+ Y+T V +LN  +  ++ +I  LNSK+SHF+
Sbjct: 166 IDNYETTVQSLNESLASKDREIASLNSKLSHFE 198

>TBLA0A07520 Chr1 complement(1861006..1862853) [1848 bp, 615 aa]
           {ON} Anc_1.31 YDR518W
          Length = 615

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 66/164 (40%), Gaps = 37/164 (22%)

Query: 50  NYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLREN-- 107
           N++  ++   +A  TI N + +                D   + I  +I     L E   
Sbjct: 129 NFITTLQSLLSAPVTIINSDEELQNF-----------IDNSDKTIIANIGGIEGLNETFY 177

Query: 108 EEAQTNFLN---ELKTKENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPK 164
           E AQ N L+    L  KEN  +   + + LVY+ EDD  Y+G             YSV  
Sbjct: 178 EAAQNNTLDFDFILYPKENITE--AEKELLVYVKEDDPEYDGS------------YSVAS 223

Query: 165 IPSYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDG--LLYY 206
            PSY F K+  NK+      L    N + + V+ + +G   +YY
Sbjct: 224 YPSYSFYKLVANKEL-----LMVWVNGQTLPVIGELNGENFMYY 262

>KAFR0E00610 Chr5 complement(134025..137384) [3360 bp, 1119 aa] {ON}
           
          Length = 1119

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 62/171 (36%), Gaps = 49/171 (28%)

Query: 101 PRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIY 160
           P   R+NE+  T+F+N    K +   F+   + L+Y      S             IN+Y
Sbjct: 275 PFKFRKNEKETTHFINSTVEKLDRYGFMY--RILLYFSTGACS----------SGIINLY 322

Query: 161 SV--PKIPSYVFTKVPGNKKKELKNSLATPQ---------------NKEQVIVLRKKDGL 203
           ++  P   +    +  G  KK LK  L  P                NK   IV  K DG+
Sbjct: 323 ALYNPTNKNVKSERASGGLKKILKWQLLNPLSHWEGEVPINFMQRVNKSNFIVFNKADGV 382

Query: 204 LYYFSKEV----------------FDNIQYENKIHHDKLKKLNAKGDERHA 238
              F  EV                 D   +ENK++HD    LN+ GD  H 
Sbjct: 383 ---FCVEVKSNKENDFNFESWKVKIDGFNFENKLYHDT-GLLNSVGDLNHT 429

>NDAI0B03410 Chr2 complement(866982..867545) [564 bp, 187 aa] {ON}
           Anc_2.309 YDL120W
          Length = 187

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 162 VPKIPSYVFTKVPGNKKKELKNSLATPQN----KEQVIVLRKKDGLLYYFSKEVFDNI 215
           VP I +YV  K P NK+    + ++ P      K+Q I LR  + LL    KE+ D I
Sbjct: 121 VPAIGAYVINKQPPNKQIWFASPISGPDRFDFYKKQWISLRNGNKLLDVLQKELNDAI 178

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 4/97 (4%)

Query: 56  REHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFL 115
           RE +     I+NP S  N++NL       +P   K+ K     D P  + EN+E      
Sbjct: 278 RELELTTSGISNPQSVHNEINLGENSDDPLPI-HKANKTPSISDLPNPILENDENINTID 336

Query: 116 NELKTKENNLKFLKDSQNLVYIDEDDISYEGDSKYKI 152
            +L   +     LK   N++ +++D++S +  SK+ I
Sbjct: 337 GDLAQGDT---ILKKGFNVLLVEDDEVSIQLCSKFLI 370

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 12/80 (15%)

Query: 247  QVSNLNTKIDIENEKIRKLNSKISHFK-----------DFSDFKSTKN-YLFKMTEYNNT 294
            Q+  +   ++ ++E I  L SK S  K           +  + +S  N Y+  +   N  
Sbjct: 1533 QLDEMKDSVNQKDETIESLTSKCSELKFEKEKSEKTSLELKELESKHNRYMNDLETCNKA 1592

Query: 295  KTRLYGEIEAIKNQRNQLEQ 314
            KT L  EIE I+NQ+N L +
Sbjct: 1593 KTSLLTEIETIRNQKNNLSE 1612

>TDEL0B05400 Chr2 complement(957161..960619) [3459 bp, 1152 aa] {ON}
           Anc_1.467 YJR041C
          Length = 1152

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 266 NSKISHF----KDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEA 304
           N K SHF    KDF++  ST++  F +++Y    ++L  E+EA
Sbjct: 386 NGKSSHFLLTDKDFTEAVSTRSASFSISQYKTAVSKLLDELEA 428

>Ecym_3347 Chr3 (659255..659812) [558 bp, 185 aa] {ON} similar to
           Ashbya gossypii AGR387C
          Length = 185

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 11/82 (13%)

Query: 140 DDISYEGDSKYKII-----EKPINIYSVPKIPSYVFTKVPGNKKKELKNSLATPQ----- 189
           D I   GDS  ++I      + +    +PKI +YV  K P NK+  L + ++ P      
Sbjct: 94  DKIELVGDSHPEVITDAEFSQGVLTIVIPKIGTYVINKQPPNKQIWLSSPISGPNRYDLY 153

Query: 190 NKEQVIVLRKKDGLLYYFSKEV 211
           N E V  LR    LL   SKE+
Sbjct: 154 NGEWV-SLRDGTKLLDVLSKEL 174

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
           YOR216C
          Length = 471

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 226 LKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKD-FSDFKSTKNY 284
           L+K  A+  E HA ++   DT++  L T+ D +  +   L S+IS  KD F + + +K  
Sbjct: 83  LEKEIARLKEEHAEQLRMKDTEMEKLRTERDAKESQYNTLLSRISSMKDVFQNLRDSKQE 142

Query: 285 L----FKMTEYNNTKTRLYGEIEAIKNQRNQL 312
           L     ++ EY +   RL  ++ +   +  +L
Sbjct: 143 LENVQEQLQEYESQNLRLKNKVSSTSKENEEL 174

>SAKL0C00990g Chr3 (89385..91976) [2592 bp, 863 aa] {ON} similar to
           uniprot|Q04411 Saccharomyces cerevisiae YDR520C
           Hypothetical ORF
          Length = 863

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 29/43 (67%)

Query: 238 ASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKS 280
           +S++N+ ++ V +LN+K+D+    ++  NS IS+ K+ +  K+
Sbjct: 164 SSRLNKLESSVGSLNSKLDLALMLLQGSNSAISNLKNLTSSKA 206

>YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}
           RAD50Subunit of MRX complex, with Mre11p and Xrs2p,
           involved in processing double-strand DNA breaks in
           vegetative cells, initiation of meiotic DSBs, telomere
           maintenance, and nonhomologous end joining
          Length = 1312

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 15/102 (14%)

Query: 221 IHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSD--F 278
           + H KL K     D   A K+N     +  L TKID  NE++ ++ S+++   + SD  F
Sbjct: 209 VEHLKLDK-----DRSKAMKLN-----IHQLQTKIDQYNEEVSEIESQLNEITEKSDKLF 258

Query: 279 KSTKNY---LFKMTEYNNTKTRLYGEIEAIKNQRNQLEQNQP 317
           KS +++   L K+    NTK  +  +++ + N  + L+ ++P
Sbjct: 259 KSNQDFQKILSKVENLKNTKLSISDQVKRLSNSIDILDLSKP 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,053,786
Number of extensions: 2383758
Number of successful extensions: 10632
Number of sequences better than 10.0: 579
Number of HSP's gapped: 11015
Number of HSP's successfully gapped: 678
Length of query: 363
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 252
Effective length of database: 40,753,473
Effective search space: 10269875196
Effective search space used: 10269875196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)