Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G036803.491ON41541515600.0
Kpol_1017.73.491ON3784366421e-79
KNAG0A079303.491ON4522646333e-77
Skud_16.4433.491ON4204466208e-76
Suva_16.4773.491ON4234406061e-73
NDAI0B058503.491ON4732965099e-59
TDEL0D055903.491ON3442904954e-58
SAKL0F02794g3.491ON3972904891e-56
NCAS0F035403.491ON4442494912e-56
Smik_16.4013.491ON4273074632e-52
TPHA0D032703.491ON3883004593e-52
YPR148C3.491ON4352904613e-52
KLTH0F14806g3.491ON3582784538e-52
KLLA0E04621g3.491ON3892794341e-48
TBLA0D029803.491ON4432864371e-48
Kwal_55.212273.491ON3762624278e-48
ZYRO0D10010g3.491ON3822634191e-46
CAGL0L08492g3.491ON3854404146e-46
Ecym_12383.491ON3932764087e-45
AFR309C3.491ON3642663236e-33
Kwal_47.181487.221ON3232621885e-15
KLTH0A03894g7.221ON3232731851e-14
TDEL0H022407.221ON3382541815e-14
NCAS0A133807.221ON3292141744e-13
SAKL0F08162g7.221ON3301121736e-13
KNAG0D017607.221ON3422131728e-13
KAFR0I019507.221ON3302131701e-12
Kpol_1070.197.221ON3112521682e-12
ADL115W7.221ON3332621682e-12
CAGL0L00891g7.221ON3411011664e-12
KLLA0E04511g7.221ON3021011647e-12
Ecym_43777.221ON3331011631e-11
ZYRO0D16522g7.221ON3582361631e-11
Suva_9.1597.221ON3252131612e-11
TBLA0B015807.221ON3862001585e-11
Kpol_478.227.221ON3502031586e-11
Skud_9.1287.221ON3292131541e-10
YIL041W (GVP36)7.221ON3262131532e-10
Smik_9.1507.221ON3262131513e-10
NDAI0A026607.221ON3641041506e-10
TPHA0B027507.221ON363631426e-09
TPHA0C012307.221ON3052141391e-08
TBLA0D042007.221ON3311011354e-08
TPHA0E010007.375ON51268731.7
Kwal_56.226373.102ON59565704.0
Suva_6.2621.157ON60272688.1
Skud_5.2117.375ON50744679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03680
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   605   0.0  
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   251   1e-79
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   248   3e-77
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   243   8e-76
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   238   1e-73
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   200   9e-59
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   195   4e-58
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   192   1e-56
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   193   2e-56
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   182   2e-52
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   181   3e-52
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   182   3e-52
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   179   8e-52
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   171   1e-48
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   172   1e-48
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   169   8e-48
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   166   1e-46
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   164   6e-46
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   161   7e-45
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   129   6e-33
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    77   5e-15
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    76   1e-14
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    74   5e-14
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    72   4e-13
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    71   6e-13
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    71   8e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    70   1e-12
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    69   2e-12
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    69   2e-12
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    69   4e-12
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    68   7e-12
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    67   1e-11
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    67   1e-11
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    67   2e-11
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    65   5e-11
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    65   6e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    64   1e-10
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    64   2e-10
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    63   3e-10
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     62   6e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    59   6e-09
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    58   1e-08
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    57   4e-08
TPHA0E01000 Chr5 complement(204170..205708) [1539 bp, 512 aa] {O...    33   1.7  
Kwal_56.22637 s56 (213527..215314) [1788 bp, 595 aa] {ON} YDR484...    32   4.0  
Suva_6.262 Chr6 complement(462155..463963) [1809 bp, 602 aa] {ON...    31   8.1  
Skud_5.211 Chr5 (331968..333491) [1524 bp, 507 aa] {ON} YER090W ...    30   9.2  

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/415 (76%), Positives = 316/415 (76%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60
           MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60

Query: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXXXHQ 120
           KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN            HQ
Sbjct: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSDLKKSKKHQ 120

Query: 121 EKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXV 180
           EKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQ                          V
Sbjct: 121 EKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEEDDDEFLNLLEV 180

Query: 181 FNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRH 240
           FNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRH
Sbjct: 181 FNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRH 240

Query: 241 EIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEESTXXXXXXXXXXXXXXXXXXXXXX 300
           EIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEEST                      
Sbjct: 241 EIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEESTKEEQVNEESNKEETEKKKITED 300

Query: 301 XPAEDXXXXXXXXXXXXXXXXXXXXXXGSSKEEAPKEDVKHNGSSXXXXXXXXXXXXXXX 360
            PAED                      GSSKEEAPKEDVKHNGSS               
Sbjct: 301 KPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEAPKEDVKHNGSSEEETEEYKLLEKLED 360

Query: 361 XFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
            FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE
Sbjct: 361 EFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  251 bits (642), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/436 (38%), Positives = 222/436 (50%), Gaps = 80/436 (18%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTI---------LTPDVQTKLHFKKTARFWQEKV 51
           MFS F+ DK+T+SIS  A   Q+ + + +            D  TKL  K  ARF QEK+
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXX 111
           G I D+  SKLP  Y +LE K DA+EK LKRLL VTKTYE EGYDYPPNL+ESL+     
Sbjct: 61  GTINDQP-SKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTN 119

Query: 112 XXXXXXXH------QEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXX 165
                         Q   SF+  SF  AIS A+FD+ S ++ +                 
Sbjct: 120 DDNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSV-----TNTIKLNHKDDE 174

Query: 166 XXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLR 225
                         +F SL NCY+NID  K EMD +IV EFN KL+ LIN +FK V +LR
Sbjct: 175 EEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLR 234

Query: 226 TKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEESTXXXXXXX 285
             V++SRL+FDT+R+E+K+KE  +     E   K+DV K+ ++K+  PK+E+        
Sbjct: 235 KSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEA-------- 286

Query: 286 XXXXXXXXXXXXXXXXPAEDXXXXXXXXXXXXXXXXXXXXXXGSSKEEAP------KEDV 339
                                                       SK+E P      KED+
Sbjct: 287 --------------------------------------------SKKETPKKEINKKEDI 302

Query: 340 KHNGSSXXXXXXXXXXXXXXXXFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQ 399
            + G++                FVSNT  AVE M ELT+ S++INLVKL+QNFQL++YKQ
Sbjct: 303 TNEGNT-ENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQ 361

Query: 400 CVQEIENNMKFLDQLE 415
           C+QEIE+N+K L+ LE
Sbjct: 362 CIQEIESNLKILNGLE 377

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  248 bits (633), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 165/264 (62%), Gaps = 24/264 (9%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60
           MFSNF+ DK+T++I+ AAQSAQ  I++TIL+PD QTKL F KT R++QEKVG I + EI+
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60

Query: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXXXHQ 120
           KLPEGY  L+ K +A+EK+LKRLL+VTKT+E+EGYDYPPN++ESLN             Q
Sbjct: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKTQ 120

Query: 121 E--KSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXX 178
           +   SS +N SF +AI KA  DS+ IL DLKE+Q+                         
Sbjct: 121 DFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKREEEAEAAEEEDEAD 180

Query: 179 ----------------------XVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINN 216
                                   F   SNCYKNID+SKAEMD+MIVKEFN KL  ++  
Sbjct: 181 DGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEI 240

Query: 217 DFKKVSKLRTKVQDSRLEFDTLRH 240
           DFK V KL T+VQDSRLEFDTLRH
Sbjct: 241 DFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (88%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSN  AAVE MTELT++SE+I+LVKLFQN QL+HY+QCVQE+E +MK LD+LE
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  243 bits (620), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 161/446 (36%), Positives = 223/446 (50%), Gaps = 63/446 (14%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTPDV-----QTKLHFKKTARFWQEKVGQIPD 56
           FS F+ +KIT+SI+TAA   Q  +N+ + + +V     +T+L  K   RF QE +G + D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSD 64

Query: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL----------- 105
             ISKLP  Y  LE K D+LEK+ +R+L+V+KT+E+EGYDYPPNL+ES+           
Sbjct: 65  --ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGW 122

Query: 106 -NXXXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXX 164
                              +F+  SF  AISKAA D +     LK+ ++           
Sbjct: 123 FGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSESNE 182

Query: 165 XXXXXXXXXXXXXX----------XVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLI 214
                                    VF+S S CYKNID+ KAEMD+ ++KEFN KLE LI
Sbjct: 183 TAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEKLI 242

Query: 215 NNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPK 274
           N DFKKV +LR KV+DSRL+FDT+R+E+K KE            K    K +++KEV  K
Sbjct: 243 NKDFKKVHELRKKVEDSRLKFDTMRYEVKSKE-----------AKLKAQKAETSKEVDDK 291

Query: 275 EESTXXXXXXXXXXXXXXXXXXXXXXXPAEDXXXXXXXXXXXXXXXXXXXXXXGSSKEEA 334
             S                        P E+                      GS+ ++A
Sbjct: 292 AVSANAPIS------------------PDENPTTEDESPISKDLEGDSKKETSGSAADDA 333

Query: 335 P--KEDVKHNGS---SXXXXXXXXXXXXXXXXFVSNTGAAVELMTELTETSEVINLVKLF 389
              KED K N     +                FVSNT  AVE+M E+T++S+++ LVKLF
Sbjct: 334 AVVKEDSKANQGDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLF 393

Query: 390 QNFQLIHYKQCVQEIENNMKFLDQLE 415
           QNFQL++++QCVQE+E N+K L+ LE
Sbjct: 394 QNFQLVYFRQCVQEVEANLKVLNSLE 419

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  238 bits (606), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 161/440 (36%), Positives = 222/440 (50%), Gaps = 53/440 (12%)

Query: 7   FDKITNSISTAAQSAQQKINDTILTPDV-----QTKLHFKKTARFWQEKVGQIPDKEISK 61
           ++KIT+SI+TAA   Q  +N  +   +V     QT+L  K   RF QE +G + D  ISK
Sbjct: 5   WNKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD--ISK 62

Query: 62  LPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXX-----XXX 116
           LP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES++               
Sbjct: 63  LPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKK 122

Query: 117 XXHQEK-------SSFMNNSFPMAISKAAFDSKSIL--------DDLKEKQQXXXXXXXX 161
             H  K        +F+  SF  AISKAA D +S          +DLK+K++        
Sbjct: 123 TEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQET 182

Query: 162 XXXXXXXXXXXXXXXXX------XVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLIN 215
                                   VF+S S CYKNID+ KAEMD+M+VKEFN KLE LIN
Sbjct: 183 AEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLIN 242

Query: 216 NDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKE 275
            DFKKV +LR KV++SRL+FDT+R+E K KE   E +R +        K++++KE    +
Sbjct: 243 EDFKKVHELRRKVEESRLKFDTMRYEGKSKE---EQLRAQ--------KDETSKEADNND 291

Query: 276 ESTXXXXXXXXXXXXXXXXXXXXXXXPAEDXXXXXXXXXXXXXXXXXXXXXXGSSKEEAP 335
            S                        P E+                           E P
Sbjct: 292 NSANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTN---------ENP 342

Query: 336 KEDVKHNGSSXXXXXXXXXXXXXXXXFVSNTGAAVELMTELTETSEVINLVKLFQNFQLI 395
           K+   +N                   FVSNT AAVE M E+T++SE+++LVKLFQNFQL+
Sbjct: 343 KQQPTNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLV 402

Query: 396 HYKQCVQEIENNMKFLDQLE 415
           +++QC QE+E N+K L+ +E
Sbjct: 403 YFRQCAQEVEANLKVLNGME 422

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  200 bits (509), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 126/296 (42%), Positives = 160/296 (54%), Gaps = 49/296 (16%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTP-DVQTKLHFKKTARFWQEKVGQIPDKEI 59
           MFS+F+ DKITNSI  AAQ A   +N+ I T  D QTKL  K   R +QE++G I D  I
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHD--I 58

Query: 60  SKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXXXH 119
           SKLP+ Y +LE K D+LEK +KR+L+V+KT+E+EGYDYPPNL+ES +            H
Sbjct: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFS-DWWNITKKSSSH 117

Query: 120 QEK-------------------------------SSFMNNSFPMAISKAAFDSKSILDDL 148
           ++K                               SSF+  SF  AISK+A D   I   L
Sbjct: 118 RKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177

Query: 149 --------------KEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKS 194
                         + + Q                           F S SNCYKNID+ 
Sbjct: 178 SIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQG 237

Query: 195 KAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQE 250
           K+EMD+M+ KEFN KLE LINN+FKKV+ LR KV DSRL+FDT+RHEIK+KE  Q+
Sbjct: 238 KSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEEQD 293

 Score = 84.0 bits (206), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 49/54 (90%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVS+T +AVE+MTE+TE+S +I L+KLFQNFQL++Y+QCVQEIE N+K L++L+
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  195 bits (495), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 162/290 (55%), Gaps = 39/290 (13%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTIL-TPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60
            SNF+ +KIT++++ AA   Q  +N  I    D Q KL  K   R+ QE +G I DK  S
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTIDDK--S 62

Query: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSE------SLNXXXXXXXX 114
           KLP  Y +LE K DALEK  KR+L+VT+T+E+EGYDYPPNL+E      SLN        
Sbjct: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTK 122

Query: 115 XXXXHQEKSS-----FMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXX 169
                +  SS     F+  SF  AISKAA D  S+  +L+E                   
Sbjct: 123 KPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGD-------------EDE 169

Query: 170 XXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQ 229
                     +F+S S CYKNID+ K EMD+MI KEFN KLE +IN DFKKV   R KV+
Sbjct: 170 EDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVE 229

Query: 230 DSRLEFDTLRHEIKLKELAQESIRQENSQK---TDVFKEDSTK--EVPPK 274
           +SRL+FDT+R+EIKLKE        EN++K   TD   +D TK  E PPK
Sbjct: 230 ESRLKFDTVRYEIKLKE-------TENAKKSTETDEASKDETKTEEEPPK 272

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT AAVE+M E+TE++E++ L KLFQNFQL++++QCVQE+E ++K L  LE
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  192 bits (489), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 163/290 (56%), Gaps = 30/290 (10%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58
           FS+F+ DK+TNSIS+AA   Q K++  I      D Q KL  K    + QE +G I D  
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDD-- 62

Query: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL------------- 105
           ISKLP  Y  LE K D+LEKI +R+L+VTKT+E+EGYDYPPNLSES+             
Sbjct: 63  ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLS 122

Query: 106 ---NXXXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXX 162
                             E   F+  SF  A+SKAA DS  +L  LK++Q+         
Sbjct: 123 FMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQK-------EP 175

Query: 163 XXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVS 222
                            +F + S C + ID+ KAEMD+++ KEFN KL+ LIN DFKKV 
Sbjct: 176 PQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVH 235

Query: 223 KLRTKVQDSRLEFDTLRHEIKLKELAQE--SIRQENSQKTDVFKEDSTKE 270
            LR KV++SRL+FDTLR+E+ LKE  Q+    ++E ++K DV ++++ +E
Sbjct: 236 SLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEE 285

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 45/54 (83%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVS+T  AVE+M E+T++SE+++LVKLF  FQLI+++QCVQE+E + K LD L+
Sbjct: 342 FVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLD 395

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  193 bits (491), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 148/249 (59%), Gaps = 7/249 (2%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTP-DVQTKLHFKKTARFWQEKVGQIPDKEI 59
           MFSNF+ DKITNS++TAAQ     +++ I T  D  TKL  +   R +QE +G + D  I
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHD--I 58

Query: 60  SKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNX--XXXXXXXXXX 117
           S LPE Y  LE + DALEK L+R+LIV+KT+E+EGYDYPPNLSES +             
Sbjct: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQ 118

Query: 118 XHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXXXXXXXXXX 177
             ++K  F+  SF  AIS +A D   I   + +                           
Sbjct: 119 EKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVK 178

Query: 178 XXV--FNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEF 235
             +  F+S + CYKNID+ KAEMD+M++KEFN KLE L+N +FKKV  LR +V+DSRL+F
Sbjct: 179 NLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKF 238

Query: 236 DTLRHEIKL 244
           DT+R+E+K+
Sbjct: 239 DTVRYELKV 247

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 49/54 (90%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVS+T +AVE+M E+T++SE+I LVKLFQNFQL++Y+QCVQEIE N+K L++LE
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  182 bits (463), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 171/307 (55%), Gaps = 49/307 (15%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTP---------DVQTKLHFKKTARFWQEKVG 52
           FS+F+ +KIT+SI+TAA     K +DT+            D QT+L  K   RF QE +G
Sbjct: 5   FSSFSLNKITDSIATAAH----KTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 53  QIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXX-- 110
            I D  ISKLP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES++      
Sbjct: 61  TISD--ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLN 118

Query: 111 -----XXXXXXXXHQEKSS-----FMNNSFPMAISKAAFDS----KSILDD----LKEKQ 152
                        +++K S     F+  SF  AISKAA D     +++ +D    LK+K+
Sbjct: 119 KDGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKR 178

Query: 153 QXXXXXXXXXXXXXXXXXXXXXXXXX--------XVFNSLSNCYKNIDKSKAEMDAMIVK 204
           +                                  VF+S S CYKNID+ K EMD+M+VK
Sbjct: 179 ESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238

Query: 205 EFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFK 264
           EFN KLE LIN DFK+V +LR KV+ SRL+FDT+R+E+K KE       Q ++QK  V +
Sbjct: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEA------QLDAQKPGVTE 292

Query: 265 EDSTKEV 271
           E  TK+V
Sbjct: 293 EAHTKDV 299

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT AAVE M E+ ++SE++ L+KLFQNFQL++++QCVQE+E N+K L+ LE
Sbjct: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 426

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  181 bits (459), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 162/300 (54%), Gaps = 31/300 (10%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTI---------LTPDVQTKLHFKKTARFWQEKV 51
           MFSNF+ DK+T+SIS  A   Q+   + I         +  D  TKL  +  +R+ QE++
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXX 111
           G + D EISKLP+ Y+ LE K D++EKILKRLL+VT T+  EGYDYPPNL+ES++     
Sbjct: 61  GTL-DDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE 119

Query: 112 XXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILD-------------DLKEKQQXXXXX 158
                    E  +F+  SF  A++KA  DSK I D             +   K +     
Sbjct: 120 DETT-----ENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDENPEAG 174

Query: 159 XXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDF 218
                                 F +LSN + NID  K EMD MIV EFN KLEHL+  +F
Sbjct: 175 AEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEF 234

Query: 219 KKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEEST 278
           K+V++LR  V++SRL+FDT+R+++KLKE   E   QE +++    KE   KE   KE  T
Sbjct: 235 KEVAQLRRNVENSRLKFDTMRYDVKLKEAKAE---QEEAKEVSTDKEIEKKESETKEPET 291

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 48/54 (88%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT +AVE M ELT+++++++LVKLFQNFQL++Y+QCVQEIENN+K +  LE
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  182 bits (461), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 151/290 (52%), Gaps = 38/290 (13%)

Query: 2   FSNFNFDKITNSISTAAQSAQ-----QKINDTILTPDVQTKLHFKKTARFWQEKVGQIPD 56
           FS F+ +KIT+SI+TAA   Q        N  +   D QT+L  K   RF QE +G + D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD 64

Query: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL----------- 105
             ISKLP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES+           
Sbjct: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122

Query: 106 -NXXXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLKE-------------- 150
                              +F+  SF  AISKAA D +    +L+               
Sbjct: 123 FGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIK 182

Query: 151 -----KQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKE 205
                + Q                          VF+S S CYKNID+ KAEMD+M+VKE
Sbjct: 183 TAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKE 242

Query: 206 FNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQE 255
           FN KLE LIN DFKKV  LR KV++SRL+FDT+R+E+K KE   E+ + E
Sbjct: 243 FNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAE 292

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 47/54 (87%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT AAVE M E+T++SE++ L+KLFQNFQL++++QCVQE+E N+K L+ LE
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  179 bits (453), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 110/278 (39%), Positives = 146/278 (52%), Gaps = 30/278 (10%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58
           F  F+ +K+TNSI+  A   Q  ++  I      D Q KL  K    + QE +G I D  
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIED-- 62

Query: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN------------ 106
           ISKLP  Y  LE K D+LEK+ +R+L+VTKTYE+EGYDYPPNLSESL+            
Sbjct: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122

Query: 107 --XXXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXX 164
                            K + M  SF  AISKAA DS  ++  LK ++Q           
Sbjct: 123 FVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDEEDE 182

Query: 165 XXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKL 224
                          +F + S C  N+D+SKAEMDA++VKEFN KL   +   FK    L
Sbjct: 183 DITSLIK--------MFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTL 234

Query: 225 RTKVQDSRLEFDTLRHEIKLKE---LAQESIRQENSQK 259
           R KV+DSRL+FDT+R+E+K+ E     +E+ +Q  SQK
Sbjct: 235 RKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQK 272

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 45/54 (83%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT  AVE M E+T+++E+INLVKLF NFQLI+YKQCVQ +E ++  L++LE
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  171 bits (434), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/279 (40%), Positives = 143/279 (51%), Gaps = 36/279 (12%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKIN---DTILTPDVQTKLHFKKTARFWQEKVGQIPDK 57
           MFS  + + IT+SIS AAQ  Q++ +   + I   D +T+L   K     QE +G + D 
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD- 59

Query: 58  EISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXX 117
            IS+LP  Y  LE K DALEKI KRLL+VTKT+E+EGYDYPPNL+ES N           
Sbjct: 60  -ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIF 118

Query: 118 XHQEKSS-------------FMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXX 164
              +K +              +  SF  A+SKAA DS  IL  LK ++            
Sbjct: 119 SFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178

Query: 165 XXXXXXXXXXXXXX------------------XVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
                                             F S + C  +ID+SKAEMD+++VKEF
Sbjct: 179 DQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEF 238

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLK 245
           N KL  LI  DFKK  +LR KVQD+RL FDTLRHEIKLK
Sbjct: 239 NAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (79%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVS T   VE + ELT++SE+I+LVKLF NFQLIHYKQCV+ +E +++ L+ L+
Sbjct: 332 FVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  172 bits (437), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 155/286 (54%), Gaps = 34/286 (11%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTPDV-----QTKLHFKKTARFWQEKVGQIPD 56
           FSNF+ DK+ +S+ +AAQ  Q  +++ I   ++     QT+L       + QE +GQI  
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQI-- 87

Query: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXX 116
            EISKLP  Y  LE K DALEKI+KR+LIVT T+EIEGYDYPPNLSES++          
Sbjct: 88  NEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAF 147

Query: 117 XXHQEKSS-----------------------FMNNSFPMAISKAAFDSKSILDDLKEKQQ 153
               + ++                       F+  SFP AISKA+ DS +IL +L   ++
Sbjct: 148 LRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNNEK 207

Query: 154 XXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHL 213
                                     VF+S S C KNIDKSK + D +I+K+FN KL  L
Sbjct: 208 --LEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265

Query: 214 INNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQK 259
           ++ +FK V  LR KVQD+RL+FDT+R+EI   + A+  +R E + K
Sbjct: 266 LDVEFKNVKALRLKVQDARLKFDTMRYEI--AKAAEAKVRAEENDK 309

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 46/53 (86%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQL 414
           FVS+T AAVE M E+TE+S++++L+KLFQNFQL+HY+QC++E+E NMK L  L
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  169 bits (427), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 104/262 (39%), Positives = 139/262 (53%), Gaps = 27/262 (10%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58
           F  F+F+K+T++++ AA   Q  ++  I      D Q  L  K    + QE +G I D  
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIED-- 62

Query: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXXX 118
           ISKLP  Y  LE K D+LEK  +R+L+VTKT+E+EGYDYPPNLSESL+            
Sbjct: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFG 122

Query: 119 HQEKS--------------SFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXX 164
               S              + M  SF  AI+KAA DS  +L  LK+++Q           
Sbjct: 123 LMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQ--------QAS 174

Query: 165 XXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKL 224
                          +F++ S C   ID+ KAEMDA++ KEFN KL  LI   FK  S L
Sbjct: 175 ADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVL 234

Query: 225 RTKVQDSRLEFDTLRHEIKLKE 246
           R KV+DSRL+FDT+R+E+KL E
Sbjct: 235 RRKVEDSRLKFDTMRYEVKLTE 256

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 46/54 (85%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT  AVE M E+T+++E++NLVKLF NFQL++++QCVQ++E ++  L++LE
Sbjct: 319 FVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  166 bits (419), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 142/263 (53%), Gaps = 36/263 (13%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTP---DVQTKLHFKKTARFWQEKVGQIPDKE 58
           FS+F+F  + +SI+ AA   Q K+++ +      D QT+L  K   R+ +E +G +   E
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV--DE 62

Query: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXX--- 115
           ISKLP  Y+ LE K DALEK  KR+L+VT+T+E+EGYDYPPNL ES +            
Sbjct: 63  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 122

Query: 116 ------------XXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLK--EKQQXXXXXXXX 161
                             K   M  SF  AI+KA+ +      + +  EK+Q        
Sbjct: 123 STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDV 182

Query: 162 XXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKV 221
                             +FN+LS CY+NID+ K EMD  I +EFN KLE L+N DFKK+
Sbjct: 183 NLVE--------------MFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228

Query: 222 SKLRTKVQDSRLEFDTLRHEIKL 244
             LR KV++SRL+FDT+R+E++L
Sbjct: 229 HVLRNKVENSRLKFDTMRYEMRL 251

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (79%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT  AVE MT + E SE++ L+KLFQN QL++Y+QCVQE+E ++K L+ LE
Sbjct: 328 FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  164 bits (414), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 133/440 (30%), Positives = 196/440 (44%), Gaps = 81/440 (18%)

Query: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60
           MF  FN + IT SIS   QS  Q+ ND       +TKL  K   RF QE +G   +++IS
Sbjct: 1   MF-KFNLESITQSISEGTQSLVQQFNDP------KTKLSIKAKTRFLQEAIGN--ERDIS 51

Query: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNX------------- 107
           KLP  Y+ LE K D++EK+LKR+LIVTKTYEIEGYDYPPN+SESL+              
Sbjct: 52  KLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISEL 111

Query: 108 ------------XXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXX 155
                                   +E S     SF  AI++A  DS+ I + ++      
Sbjct: 112 TKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIE------ 165

Query: 156 XXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLIN 215
                                   +F   S+C+  I  SK EMD M++KEFN KLE  + 
Sbjct: 166 ---------TKDEDEKEDIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQ 216

Query: 216 NDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKE 275
            +F+K+               TLR +++   L  +++R E +Q +   K+  +KE+  ++
Sbjct: 217 KNFQKIH--------------TLRAKVEESRLNFDTMRYEVAQTS---KQTDSKELGNED 259

Query: 276 ESTXXXXXXXXXXXXXXXXXXXXXXXPAEDXXXXXXXXXXXXXXXXXXXXXXGSSKEEAP 335
           E+                         A D                       +   E  
Sbjct: 260 ET--------KPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDL 311

Query: 336 KEDVKHNGSSXXXXXXXXXXXXXXXXFVSNTGAAVELMTELTETSEVINLVKLFQNFQLI 395
           KED K +                   FVSNT  AVE+MTE++E SE+++L+KLFQ FQL 
Sbjct: 312 KEDSKTSTDGQLLEQLEDE-------FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLS 364

Query: 396 HYKQCVQEIENNMKFLDQLE 415
           +++ CV+ +E ++K L+ ++
Sbjct: 365 YHQHCVKSLEQSLKDLNAID 384

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  161 bits (408), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 144/276 (52%), Gaps = 41/276 (14%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDT----------ILTPDVQTKLHFKKTARFWQEKV 51
           FSNF+ DKI ++I+TAA   QQK+N+T          I   D QT L  +      QE +
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL------ 105
           G I  K+ISKLP  Y  LE K DA EK+  R+L+V+KT+E++GYDYPPNL+ES+      
Sbjct: 65  GTI--KDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGS 122

Query: 106 ----------------NXXXXXXXXXXXXHQEKSSFMNNSFPMAISKAAFDSKSILDDLK 149
                           N             +    ++  SF  AISKAA DS +IL +L 
Sbjct: 123 SSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKELN 182

Query: 150 EKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFK 209
           E+Q                           +  + +    NID++K +MD  ++ EFN K
Sbjct: 183 EEQ-------LVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKK 235

Query: 210 LEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLK 245
           L+ L+NNDF KV  LR KV++SRL+FDTLR+E++++
Sbjct: 236 LDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMR 271

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQL 414
           FVSNT  AV  MT++T++  +  LVKLF NFQLI++K+CVQE++ ++  ++ L
Sbjct: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  129 bits (323), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 130/266 (48%), Gaps = 36/266 (13%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDT----------ILTPDVQTKLHFKKTARFWQEKV 51
           F   + DK+ N+++ AAQ  QQK+++T          I   D +T L  K   R  QE +
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXX 111
           G    K+IS+LP  Y  LE K DA+E++ K++L+V+KT+E+EGYDYPPN +ES++     
Sbjct: 65  GSA--KDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNT 122

Query: 112 XXXXXX----------------XHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQXX 155
                                   Q   S    SF  A+ +AA  S+ I+          
Sbjct: 123 STKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGII--------QE 174

Query: 156 XXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLIN 215
                                   +F + ++   N+D +K EMD  +VKEFN KL+HL+ 
Sbjct: 175 LKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLE 234

Query: 216 NDFKKVSKLRTKVQDSRLEFDTLRHE 241
            +FKK   LR KV++SRL FDTL++E
Sbjct: 235 VEFKKGHTLRRKVEESRLTFDTLKYE 260

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415
           FVSNT  AVE MT + + +++I+LVKLFQNFQL+++++CVQE+E ++  L  LE
Sbjct: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 113/262 (43%), Gaps = 52/262 (19%)

Query: 4   NFNFDKITNSISTAAQSAQ--QKIND-----TILTPDVQTKLH--FKKTARFWQEKVGQI 54
           N  F +I++ +S  AQ AQ  +K  D     +  T D  T+L    + T R  QEK+GQ+
Sbjct: 11  NRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQRLMQEKLGQV 70

Query: 55  PDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNX------X 108
            D  IS+LP+ Y+ LENK+D ++ + +  L VT+ YE E YDYP N+ +S+N        
Sbjct: 71  TD--ISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEFSSIVGT 128

Query: 109 XXXXXXXXXXHQEKSSFMNNSFP--------MAISKAAFDSKSILDDLKEKQQXXXXXXX 160
                       E  S + +  P         A+SK A  S   L+              
Sbjct: 129 KLHELSRATSTNEAQSVLISPGPHKDPKTLNYALSKVALTSSEYLN-------------- 174

Query: 161 XXXXXXXXXXXXXXXXXXXVFNSL---SNCYKNIDKSKAEMDAMIVKEFNFKLEHLINND 217
                              V +SL   S+    I +++   D +I  +FN KL   + +D
Sbjct: 175 ----------KSPGAEDSEVSSSLLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADD 224

Query: 218 FKKVSKLRTKVQDSRLEFDTLR 239
             +  K R  V++ RL++D  R
Sbjct: 225 LNRAQKARKNVENKRLQYDIAR 246

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 115/273 (42%), Gaps = 58/273 (21%)

Query: 2   FSNF------NFDKITNSISTAAQSAQ--QKIND-----TILTPDVQTKL--HFKKTARF 46
           F+NF         ++++ +S  AQ AQ  +K  D     +  T D+ T+L    + T R 
Sbjct: 3   FNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQRL 62

Query: 47  WQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
            QEK+GQ+ D  IS+LP+ Y+ LENK+D +  + +  L VT+ YE E YDYP N+ +S+N
Sbjct: 63  VQEKLGQVTD--ISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 107 XXXXXXX------XXXXXHQEKSSFMNNSFP--------MAISKAAFDSKSILDDLKEKQ 152
                               E  S +    P         A+SK A  S   L+      
Sbjct: 121 EFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYALSKVALTSSEYLN------ 174

Query: 153 QXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSL---SNCYKNIDKSKAEMDAMIVKEFNFK 209
                                      V N+L   S+    + +++ + D +I   FN K
Sbjct: 175 ------------------KSVGGDDSEVSNALLKYSDVQAKVAQARLQQDTLIQTRFNKK 216

Query: 210 LEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEI 242
           L  ++ ND  +  K R  V+  RL++D  R  +
Sbjct: 217 LRDILANDLNEAQKARKNVEHKRLQYDIARSNL 249

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 107/254 (42%), Gaps = 51/254 (20%)

Query: 7   FDKITNSI-------STAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEI 59
           F+  TNS+       STA     Q+I+  +  P +      + T R  QE++GQ+ D  I
Sbjct: 4   FNNFTNSLNQKFQELSTAVSQRTQEISTNL--PSLT-----QSTQRLVQERLGQVTD--I 54

Query: 60  SKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN--XXXXXXXXXXX 117
           S+LP  YL LE KVD ++ I +  L VT  YE E YDYP  ++ES+N             
Sbjct: 55  SQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQEL 114

Query: 118 XHQEKSSFMNN------------SFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXX 165
            H   +S   N            +   A+SK +  S   L+ + +  +            
Sbjct: 115 SHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLNHIGDHDE------------ 162

Query: 166 XXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLR 225
                         V    S+    + +++ + D MI   FN +L+  + ++FKK  K R
Sbjct: 163 ---------AQVASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKAR 213

Query: 226 TKVQDSRLEFDTLR 239
             V+  RL++D  R
Sbjct: 214 KDVEYKRLQYDVAR 227

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 91/214 (42%), Gaps = 37/214 (17%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QE++GQ+ D  IS+LPE YL LE K+D++++I    L V+  YE + YDYP  
Sbjct: 38  QSTQRMVQERLGQVTD--ISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYV 95

Query: 101 LSESL-------NXXXXXXXXXXXXHQEKSSFMNNS--------FPMAISKAAFDSKSIL 145
             ESL                    H+ ++    +S           A+SK A  S   L
Sbjct: 96  AKESLIEFSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHL 155

Query: 146 DDLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKE 205
           +   + +                              + SN    I +++ + D +I ++
Sbjct: 156 NQFNDNE--------------------AFKSSASALLNFSNIQAKIAQARLQQDLLIKQK 195

Query: 206 FNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           FN  L H +  +  K +K+R +VQ  RL++D  R
Sbjct: 196 FNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (58%), Gaps = 11/112 (9%)

Query: 4   NFNFDKITNSISTAAQSAQ--QKIND-----TILTPDVQTKLH--FKKTARFWQEKVGQI 54
           N  F +++ S+S  AQ AQ  +K  D     +  T D+ T L    + T R  QE++GQ+
Sbjct: 11  NKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQV 70

Query: 55  PDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
            D  IS+LP+ YL LEN++D +  + +  L VT+ YE E YDYP N+ +S+N
Sbjct: 71  TD--ISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 185 SNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           S+    I +++ + D +I  +FN KL   + +D  K  K R +V++ RL++D  R
Sbjct: 191 SDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 88/213 (41%), Gaps = 34/213 (15%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QEK+GQ+ D  IS+LP+ YL LE +VDAL+ + +  L VT  YE E YDYP  
Sbjct: 38  QTTQRLVQEKLGQVTD--ISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKY 95

Query: 101 LSESLNXXXXXXXXXXXXHQEKSSFMN--------------NSFPMAISKAAFDSKSILD 146
           + +S+N             +  SS                  +   A+SK A +   ++D
Sbjct: 96  VRDSVNEWSRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVD 155

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
           +L   +                                S     + +++ E DA +  +F
Sbjct: 156 NLDAPRTPRETQLSSG------------------LLEFSGVEAELAQARLEQDAAVKAQF 197

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N KL   ++ +  + +  R +V   RL++D  R
Sbjct: 198 NEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 89/213 (41%), Gaps = 36/213 (16%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QEK+GQ+ D  IS+LP+ YL LE KVD+++ I +  L VT  YE E YDYP  
Sbjct: 38  QSTQRLVQEKLGQVTD--ISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKV 95

Query: 101 LSESLN--XXXXXXXXXXXXHQEKSSFMNN------------SFPMAISKAAFDSKSILD 146
           + +S+N              H   +S   N            +   A+SK +  +  +++
Sbjct: 96  IKDSVNDFSKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASEVIN 155

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
            +                                    SN    I +++ + D +I  +F
Sbjct: 156 QVGSTPNESALSSKLLE--------------------FSNVQSKIAQARLQQDTLIQTKF 195

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N  L   ++    K +K R +VQ+ RL++D  R
Sbjct: 196 NKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 101/252 (40%), Gaps = 37/252 (14%)

Query: 5   FNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPE 64
            +F+  TNS+S   Q     +++             + T R  QEK+G + D  IS+LP+
Sbjct: 1   MSFNSFTNSLSQKFQELSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTD--ISQLPQ 58

Query: 65  GYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN------XXXXXXXXXXXX 118
            Y+ LE +VD ++ + +  L +T  YE E YDYP  +S+S+N                  
Sbjct: 59  EYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKVTELSHATS 118

Query: 119 HQEKSSFMNNSFPM--------AISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXXX 170
            QE  + +    P         A+SK A +S   L  L +  +                 
Sbjct: 119 AQEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQLADPNE----------------- 161

Query: 171 XXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQD 230
                         S+    I +++   D +I  +FN +L   +  D  K SK R  VQ 
Sbjct: 162 ----GPVADALLKFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQY 217

Query: 231 SRLEFDTLRHEI 242
            RL++D  R ++
Sbjct: 218 KRLQYDVARSKL 229

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 112/262 (42%), Gaps = 57/262 (21%)

Query: 6   NFDKITNSISTAAQSAQ--QKINDTIL-----TPDVQTKLH--FKKTARFWQEKVGQIPD 56
            F +I++++   AQ AQ  +K+ D  L     T D+ + L    + T R  QE++GQ+ D
Sbjct: 13  RFQEISSTVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQRRVQERLGQVTD 72

Query: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN------XXXX 110
             IS++PE Y+ LE +VD  + I    L V++ YE E YDYP ++S+S+N          
Sbjct: 73  --ISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKV 130

Query: 111 XXXXXXXXHQEKSSFMNNSFPM--------AISKAA-----FDSKSILDDLKEKQQXXXX 157
                    +E  S + +  P         A+SK A     + SKS  DD+         
Sbjct: 131 QELTKATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDDV--------- 181

Query: 158 XXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINND 217
                                 +    S+    I +++ + D +I   FN +L   +N  
Sbjct: 182 ------------------VTADILLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQ 223

Query: 218 FKKVSKLRTKVQDSRLEFDTLR 239
           F +  + R +V   RL++D  R
Sbjct: 224 FAEAMQSRKQVDQKRLQYDIAR 245

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 55/101 (54%), Gaps = 2/101 (1%)

Query: 6   NFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPEG 65
           NF+   NS+    QS    ++              + T R  QEK+GQ+ D  IS+LP+ 
Sbjct: 3   NFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTD--ISQLPQE 60

Query: 66  YLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
           YL LENKVD ++ + +  L VT  YE E YDYP  +SES+N
Sbjct: 61  YLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVN 101

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 12/101 (11%)

Query: 10  ITNSISTAAQSAQ--QKINDTILTPDVQTKLHF--KKTARFWQEKVGQIPDKEISKLPEG 65
           ++ S+S  AQ AQ  QK  D      ++T L      T R  QEK+GQ+ D  IS+LP+ 
Sbjct: 15  LSTSVSQKAQEAQLDQKFKD------LKTNLPLLANSTQRMLQEKLGQVTD--ISQLPDE 66

Query: 66  YLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
           Y+ LE++V+ ++ I +  L VTK YE E YDYP N+ ES++
Sbjct: 67  YVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVD 107

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 9/101 (8%)

Query: 6   NFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPEG 65
           N DK    +S       Q +  T+  P +    H     R  QEK+GQI D  IS++PE 
Sbjct: 29  NLDKRFKDLSMTVTQKTQDLTSTL--PSIAQTTH-----RMVQEKLGQITD--ISQMPEE 79

Query: 66  YLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
           Y+++E +VD +  I +  L VT+ YE E YDYP ++SES+N
Sbjct: 80  YVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 185 SNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           S+    I +++ + D +I   FN +L+  +NN+F   ++ R +V + RL++D  R
Sbjct: 191 SDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 96/236 (40%), Gaps = 24/236 (10%)

Query: 4   NFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISKLP 63
           N  F +++ ++S  AQ   Q I                 T R+ QEK+G   D  IS++P
Sbjct: 11  NEKFQQLSTTVSGKAQEFSQGI---------------PVTHRYMQEKLGHATD--ISEMP 53

Query: 64  EGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNXXXXXXXXXXXXHQEKS 123
           + Y++L  KVDA++ I    L VT+ Y+ E YDYP  ++ES+N             QE S
Sbjct: 54  QEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINEFSRTVGSKI---QELS 110

Query: 124 SFMNNSFPMAISKAAFDSKSILDDLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNS 183
              +     +I  A   SK    D K                                  
Sbjct: 111 HASSAHEAHSILSAPGPSK----DPKTLNYALSRVSLVSSECMEHLSTHDDALLASYLMK 166

Query: 184 LSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
            S+    + +++   D+++   FN KL   I+ + K+  ++R  V++ RL +D  R
Sbjct: 167 YSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 86/213 (40%), Gaps = 37/213 (17%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QE++GQ+ D  IS+LP  Y  LE+KVD ++ I    L VT  YE   YDYP  
Sbjct: 33  QSTQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKY 90

Query: 101 LSESLN--XXXXXXXXXXXXHQEKSSFMNN------------SFPMAISKAAFDSKSILD 146
           ++ES+N              H   +S   N            +   A+SK A +S   L+
Sbjct: 91  INESVNEFSSSLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNSSECLN 150

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
            +   ++                               S+    I +++ + D +I  +F
Sbjct: 151 KMFPTEEQPLASSLLQ---------------------FSDVQAKIAQARIQQDTLIQTKF 189

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N KL   ++ +  K  K R +V   RL +D  R
Sbjct: 190 NKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 88/200 (44%), Gaps = 12/200 (6%)

Query: 47  WQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLN 106
            QEK GQ+ D  IS LP+ YL+LE +VD+++ +    L +T  YE E YDYP ++ +S+ 
Sbjct: 1   MQEKFGQVTD--ISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSIT 58

Query: 107 XXXXXXXXXXXXHQEKSSFMNNSF-------PMAISKAAFDSKSILDDLKEKQQXXXXXX 159
                        Q K S  +++        PM  S ++  S   +++  +         
Sbjct: 59  EFQKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGS---INNYNQNSPRTLNNA 115

Query: 160 XXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFK 219
                               VF+S S     I   + + D +I K FN +L++++ N   
Sbjct: 116 LSKAALFAAEQLKMDKDSSTVFHSFSEAESIISDERIKQDKIIQKSFNTELKNVLTNRID 175

Query: 220 KVSKLRTKVQDSRLEFDTLR 239
             +K R  VQ+ RL++D  R
Sbjct: 176 VANKHRKDVQNKRLQYDISR 195

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 83/203 (40%), Gaps = 29/203 (14%)

Query: 43  TARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLS 102
           T R  +EK+GQ+ D  IS LP+ YL+LE K+D  + + +  L +T  YE E YDYP   S
Sbjct: 35  THRMVKEKLGQVDD--ISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 103 ESLNXXXXXXXXXXXXHQEKSSFMNNS------FPMAISKAAFDSKSILDDLKEKQQXXX 156
           ES+N                 S   +S         A+SK +  +      L +      
Sbjct: 93  ESVNEFTDSIGNKMYEFSNGVSTEGSSGKTPRTLNYAVSKVSMGASEQFQKLHD------ 146

Query: 157 XXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINN 216
                                  +  ++ N   +I +++   D  I  +FNF+L   I  
Sbjct: 147 ---------------TDDKRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQ 191

Query: 217 DFKKVSKLRTKVQDSRLEFDTLR 239
             ++ SK R +V   RL++D  R
Sbjct: 192 SIERASKYRKEVYHKRLKYDIAR 214

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 85/213 (39%), Gaps = 37/213 (17%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QE++GQ+ D  IS+LP  Y  LE+KVD ++ I    L VT  YE   YDYP  
Sbjct: 33  QSTQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKY 90

Query: 101 LSESLN--XXXXXXXXXXXXHQEKSSFMNN------------SFPMAISKAAFDSKSILD 146
           ++ES+N              H   +S   N            +   A+SK + +S   L+
Sbjct: 91  INESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSECLN 150

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
            +   ++                               S+    I +++ + D +I  +F
Sbjct: 151 KMFPAEE---------------------QPLASALLQFSDVQAKIAQTRIQQDTLIQTKF 189

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N KL   ++ +  K  K R  V   RL +D  R
Sbjct: 190 NKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 84/213 (39%), Gaps = 37/213 (17%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QE++GQ+ D  IS+LP  Y  LE+KVD ++ I    L VT  YE   YDYP  
Sbjct: 33  QSTQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKY 90

Query: 101 LSESLN--XXXXXXXXXXXXHQEKSSFMNN------------SFPMAISKAAFDSKSILD 146
           ++ES+N              H   +S   N            +   A+SK A +S   L+
Sbjct: 91  INESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLN 150

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
            +   ++                               S+    I +++ + D +I  +F
Sbjct: 151 KMFPTEE---------------------QPLASALLQFSDVQAKIAQARIQQDTLIQTKF 189

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N  L   ++ +  K  K R  V   RL +D  R
Sbjct: 190 NKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 83/213 (38%), Gaps = 37/213 (17%)

Query: 41  KKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPN 100
           + T R  QE++GQ+ D  IS+LP  Y  LE KVD ++ I    L VT  YE   YDYP  
Sbjct: 33  QSTQRMVQERLGQVTD--ISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKY 90

Query: 101 LSESLN--XXXXXXXXXXXXHQEKSSFMNN------------SFPMAISKAAFDSKSILD 146
           ++ES+N              H   +S   N            +   A+SK A +S   L+
Sbjct: 91  INESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLN 150

Query: 147 DLKEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEF 206
            +   ++                               S+    I +++ + D +I  +F
Sbjct: 151 KMLPTEE---------------------QPLASALLQFSDVQAKIAQARIQQDTLIQTKF 189

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
           N  L   ++ +  K  K R  V   RL +D  R
Sbjct: 190 NKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 7/104 (6%)

Query: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISK 61
           F+N +F+K    +ST      Q+ +  +  PD+ +    + T R  QE++GQ+ D  IS+
Sbjct: 7   FTN-SFNKRLQELSTTVSQKTQEFSTNM--PDINSLA--QSTQRMVQERLGQVTD--ISQ 59

Query: 62  LPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL 105
           LPE YL LE K+D ++ +    L VT T+E + YDYP    ES+
Sbjct: 60  LPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESV 103

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%)

Query: 184 LSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLR 239
            S+    I +++ + D +I ++FN  L + +N  F++  K+R  VQ+ RL++D  R
Sbjct: 184 FSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 43  TARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLS 102
           T R  +EK+GQ  D  IS LP+ Y+ LE K+D +++I +  L VT  YE E YDYP    
Sbjct: 35  TQRLMKEKLGQAKD--ISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFG 92

Query: 103 ESL 105
           ES 
Sbjct: 93  ESF 95

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 90/214 (42%), Gaps = 37/214 (17%)

Query: 43  TARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLS 102
           T R  QEK+G + D  IS+LP+ YL LE ++D ++ + +  L +T  Y+ E YDYP  +S
Sbjct: 39  TQRLVQEKLGNVTD--ISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVS 96

Query: 103 ESLN------XXXXXXXXXXXXHQEKSSFMNNSFPM--------AISKAAFDSKSILDDL 148
           +S+N                   +E  + +    P+        A+SK A  S   L+ L
Sbjct: 97  DSVNDYSKLFQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVALTSSESLNQL 156

Query: 149 KEKQQXXXXXXXXXXXXXXXXXXXXXXXXXXVFNSLSNCYKNIDKSKAEMDAMIVKEFNF 208
           ++                                  S+    I + + + D +I  + N 
Sbjct: 157 QDPN---------------------VSAVASTLLKFSDMQTKIAQQRLQQDTLIQTKVNK 195

Query: 209 KLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEI 242
            ++  +++  +K +K R  VQ  RL++D  R ++
Sbjct: 196 VIKEKLSSLIEKATKSRRDVQYKRLQYDVARSKL 229

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 56/101 (55%), Gaps = 2/101 (1%)

Query: 5   FNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPE 64
            +F+ + +SI  A Q   + ++            + +   R  QEK+GQI D  IS++P 
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYAQVQQRLAQEKLGQITD--ISQMPR 58

Query: 65  GYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESL 105
            Y++LE+++D L+  ++ LL VT+ YE   YD+P +  ES+
Sbjct: 59  EYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESV 99

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 199 DAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIK 243
           D  +  +FN +L  ++NN   K +K R  VQ  R+ +D  R  ++
Sbjct: 188 DTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIARTNLQ 232

>TPHA0E01000 Chr5 complement(204170..205708) [1539 bp, 512 aa] {ON}
           Anc_7.375 YER090W
          Length = 512

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 43  TARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLI-----VTKTYEIEGYDY 97
             R+++ K  + P K++ K+PE YL L + + A + + +R  I     +++T   EGY  
Sbjct: 138 CVRYFEPKTAR-PLKDVLKVPEAYLMLCDTIIAFDHVFQRFQIIHNINISQTTLSEGYSL 196

Query: 98  PPNLSESL 105
             N+ E++
Sbjct: 197 ATNVIENI 204

>Kwal_56.22637 s56 (213527..215314) [1788 bp, 595 aa] {ON} YDR484W
           (SAC2) - involved in localization of actin and chitin
           [contig 184] FULL
          Length = 595

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 9/65 (13%)

Query: 25  INDTILTPDVQTKLHFKKTARFWQEKVGQIPDK---------EISKLPEGYLNLENKVDA 75
           +ND +++PDV +++   K    W E +  I DK         E  ++P  +  L   +D 
Sbjct: 113 VNDLVISPDVVSQITHGKIDGSWVENIAYIKDKQEIYAKYREEAREVPSDFAQLSELLDV 172

Query: 76  LEKIL 80
           L+ ++
Sbjct: 173 LQSLI 177

>Suva_6.262 Chr6 complement(462155..463963) [1809 bp, 602 aa] {ON}
           YJL181W (REAL)
          Length = 602

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDT--LRHEIKLKELAQESIRQENSQK-TDVF 263
           N ++ H  NN +KK+S  ++++   RL   +  + H+   K L Q  IR  +  K T   
Sbjct: 449 NVRISHWSNNSWKKISSAQSQLSVIRLRMGSFIVAHDPDFKNLHQLVIRLSDDIKCTQST 508

Query: 264 KEDSTKEVPPKE 275
           K+D    V P E
Sbjct: 509 KQDIQLRVSPSE 520

>Skud_5.211 Chr5 (331968..333491) [1524 bp, 507 aa] {ON} YER090W
           (REAL)
          Length = 507

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 43  TARFWQEKVGQIPDKEISKLPEGYLNLENKVDALEKILKRLLIV 86
             R+++ K  + P K++ KLPE YL L + + A + + +R  I+
Sbjct: 133 CVRYFEPKTSR-PLKDVLKLPESYLMLCDTIIAFDNVFQRFQII 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,152,625
Number of extensions: 1242768
Number of successful extensions: 5068
Number of sequences better than 10.0: 90
Number of HSP's gapped: 5184
Number of HSP's successfully gapped: 134
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)