Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0G036753.484ON60602255e-26
NOTE: 11 genes in the same pillar as KAFR0G03675 were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A Skud_16.440 Smik_16.397 YPR145C-A NCAS0F03520 KNAG0A07925 Suva_16.475 Agos_YGOB_YPR145C-A TPHA0D04205 NDAI0B05820 Cgla_YGOB_Anc_3.484

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0G03675
         (60 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0G03675 Chr7 complement(759961..760143) [183 bp, 60 aa] {ON}       91   5e-26

>KAFR0G03675 Chr7 complement(759961..760143) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 91.3 bits (225), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 47/60 (78%)

Query: 1  MNMAMAKLVNIITTIKWKASNKKPRRVTRYDILKQDXXXXXXXXXXXXXGHTITRDISSI 60
          MNMAMAKLVNIITTIKWKASNKKPRRVTRYDILKQD             GHTITRDISSI
Sbjct: 1  MNMAMAKLVNIITTIKWKASNKKPRRVTRYDILKQDSAYSTTASSKSSSGHTITRDISSI 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,104,083
Number of extensions: 81922
Number of successful extensions: 143
Number of sequences better than 10.0: 1
Number of HSP's gapped: 143
Number of HSP's successfully gapped: 1
Length of query: 60
Length of database: 53,481,399
Length adjustment: 33
Effective length of query: 27
Effective length of database: 49,697,421
Effective search space: 1341830367
Effective search space used: 1341830367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)